Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54705.1
JCVISYN3A_0296

Uncharacterized protein.
M. mycoides homolog: Q6MTQ1.
TIGRfam Classification: 1=Unknown.
Category: Essential.

Statistics

Total GO Annotation: 110
Unique PROST Go: 110
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 145
Unique PROST Homologs: 145
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Ribonuclease HII
Antczak et al. [3]: Transmembrane protein, likely a cation transporter
Zhang et al. [4]: GO:0016286|small conductance calcium- activated potassium channel activity
Bianchi et al. [5]: "Unclear, Possible Ion Transport protein"

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was P33250 (ATP synthase protein I) with a FATCAT P-Value: 3.93e-07 and RMSD of 2.55 angstrom. The sequence alignment identity is 22.4%.
Structural alignment shown in left. Query protein AVX54705.1 colored as red in alignment, homolog P33250 colored as blue. Query protein AVX54705.1 is also shown in right top, homolog P33250 showed in right bottom. They are colored based on secondary structures. 

  AVX54705.1 MENQNKEQLLDN--IKFNNTRTPFWINLLV-QLFTTIGLFLIILFFIGADLQNYSWNHFNK-LGKLTYLYLFLICLAY----LII-VFLINLLLV-LFKV 90
      P33250 -------MIVDKKIIKY---------NLIIFNVFSIVG--LIIL--LG--LT------FTKIIG-FQWVYSSLLTVVFSNISLVIGLILPNLLYTSATKL 71

  AVX54705.1 ----IKSDSFTYSFGLAFVGILIILTGNLFYY------------WNTTLVIKTILRFVLVIISMV-LGVLFGTFISIIFKNKEYQKEEENLAILNAYLNN 173
      P33250 NTQQVKSA----RFGFFILGI-ITLSSRLFWYAVPIVIIGFVNQWQFQGAVFNVFPAILWPLSMIAVHVVV-NYL-LL--NKEI-KERNKLKELN---NN 158

  AVX54705.1 QIVPTKKQLKQIKKQEYKLSKQKEYEELLKFKENLYKKKTD 214
      P33250 --VATGDSLHEAF---------------------------- 169

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
5. P GO:0110146 magnetosome membrane
5. P GO:0044214 spanning component of plasma membrane
5. P GO:0043020 NADPH oxidase complex
5. P GO:0001938 positive regulation of endothelial cell proliferation
5. P GO:0048246 macrophage chemotaxis
5. P GO:0010923 negative regulation of phosphatase activity
5. P GO:0001725 stress fiber
5. P GO:1904385 cellular response to angiotensin
5. P GO:0046530 photoreceptor cell differentiation
5. P GO:0007611 learning or memory
5. P GO:0072659 protein localization to plasma membrane
5. P GO:0043065 positive regulation of apoptotic process
5. P GO:0001666 response to hypoxia
5. P GO:0030494 bacteriochlorophyll biosynthetic process
5. P GO:0045087 innate immune response
5. P GO:0015031 protein transport
5. P GO:0150007 clathrin-dependent synaptic vesicle endocytosis
5. P GO:0033864 positive regulation of NAD(P)H oxidase activity
5. P GO:0032760 positive regulation of tumor necrosis factor production
5. P GO:0035212 cell competition in a multicellular organism
5. P GO:0014895 smooth muscle hypertrophy
5. P GO:0015813 L-glutamate transmembrane transport
5. P GO:0005774 vacuolar membrane
5. P GO:0008217 regulation of blood pressure
5. P GO:0060271 cilium assembly
5. P GO:0071333 cellular response to glucose stimulus
5. P GO:0048488 synaptic vesicle endocytosis
5. P GO:1904845 cellular response to L-glutamine
5. P GO:0032930 positive regulation of superoxide anion generation
5. P GO:0005765 lysosomal membrane
5. P GO:0005262 calcium channel activity
5. P GO:0045777 positive regulation of blood pressure
5. P GO:0071310 cellular response to organic substance
5. P GO:0030137 COPI-coated vesicle
5. P GO:0098712 L-glutamate import across plasma membrane
5. P GO:0032588 trans-Golgi network membrane
5. P GO:0006801 superoxide metabolic process
5. P GO:0051051 negative regulation of transport
5. P GO:0042802 identical protein binding
5. P GO:0005794 Golgi apparatus
5. P GO:0070555 response to interleukin-1
5. P GO:0016192 vesicle-mediated transport
5. P GO:0010917 negative regulation of mitochondrial membrane potential
5. P GO:0042543 protein N-linked glycosylation via arginine
5. P GO:0032755 positive regulation of interleukin-6 production
5. P GO:0070257 positive regulation of mucus secretion
5. P GO:0005783 endoplasmic reticulum
5. P GO:0009808 lignin metabolic process
5. P GO:0031667 response to nutrient levels
5. P GO:0017124 SH3 domain binding
5. P GO:0043525 positive regulation of neuron apoptotic process
5. P GO:0072593 reactive oxygen species metabolic process
5. P GO:0006749 glutathione metabolic process
5. P GO:0017004 cytochrome complex assembly
5. P GO:0034137 positive regulation of toll-like receptor 2 signaling pathway
5. P GO:0050766 positive regulation of phagocytosis
5. P GO:1900426 positive regulation of defense response to bacterium
5. P GO:0050665 hydrogen peroxide biosynthetic process
5. P GO:0070916 inositol phosphoceramide synthase complex
5. P GO:0042554 superoxide anion generation
5. P GO:0048661 positive regulation of smooth muscle cell proliferation
5. P GO:0045956 positive regulation of calcium ion-dependent exocytosis
5. P GO:0003106 negative regulation of glomerular filtration by angiotensin
5. P GO:0005886 plasma membrane
5. P GO:0043001 Golgi to plasma membrane protein transport
5. P GO:0016175 superoxide-generating NAD(P)H oxidase activity
5. P GO:0005770 late endosome
5. P GO:0036475 neuron death in response to oxidative stress
5. P GO:0006624 vacuolar protein processing
5. P GO:0030307 positive regulation of cell growth
5. P GO:0008631 intrinsic apoptotic signaling pathway in response to oxidative stress
5. P GO:1904044 response to aldosterone
5. P GO:0055038 recycling endosome membrane
5. P GO:0002080 acrosomal membrane
5. P GO:0005768 endosome
5. P GO:0014823 response to activity
5. P GO:0071260 cellular response to mechanical stimulus
5. P GO:0070917 inositol phosphoceramide synthase regulator activity
5. P GO:0051279 regulation of release of sequestered calcium ion into cytosol
5. P GO:0030133 transport vesicle
5. P GO:0032874 positive regulation of stress-activated MAPK cascade
5. P GO:0030672 synaptic vesicle membrane
5. P GO:0030285 integral component of synaptic vesicle membrane
5. P GO:0006673 inositol phosphoceramide metabolic process
5. P GO:0002037 negative regulation of L-glutamate import across plasma membrane
5. P GO:0005929 cilium
5. P GO:0019098 reproductive behavior
5. P GO:0000139 Golgi membrane
5. P GO:0032940 secretion by cell
5. P GO:0071356 cellular response to tumor necrosis factor
5. P GO:0016021 integral component of membrane
5. P GO:0034067 protein localization to Golgi apparatus
5. P GO:0005737 cytoplasm
5. P GO:0071480 cellular response to gamma radiation
5. P GO:0006895 Golgi to endosome transport
5. P GO:1903428 positive regulation of reactive oxygen species biosynthetic process
5. P GO:0005789 endoplasmic reticulum membrane
5. P GO:0004945 angiotensin type II receptor activity
5. P GO:0005856 cytoskeleton
5. P GO:0099533 positive regulation of presynaptic cytosolic calcium concentration
5. P GO:0071407 cellular response to organic cyclic compound
5. P GO:0016020 membrane
5. P GO:0075512 clathrin-dependent endocytosis of virus by host cell
5. P GO:0030173 integral component of Golgi membrane
5. P GO:0045730 respiratory burst
5. P GO:0001819 positive regulation of cytokine production
5. P GO:0150008 bulk synaptic vesicle endocytosis
5. P GO:0030176 integral component of endoplasmic reticulum membrane
5. P GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
5. P GO:0051580 regulation of neurotransmitter uptake

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
5. P Q54T60 Transmembrane protein 50 homolog 9.40e-05 2.87e-02 NA NA
5. P Q9CXT7 Transmembrane protein 192 9.25e-07 2.20e-02 NA NA
5. P Q4R4R4 PRA1 family protein 3 7.38e-04 2.73e-07 NA NA
5. P P34362 Uncharacterized protein C48B4.8 2.22e-04 8.60e-05 NA NA
5. P P92536 Uncharacterized mitochondrial protein AtMg01020 9.31e-04 2.36e-03 NA NA
5. P Q9P7H7 Protein ilm1 2.57e-05 4.68e-05 NA NA
5. P Q9ES40 PRA1 family protein 3 8.48e-04 2.89e-07 NA NA
5. P O64228 Gene 34.1 protein NA 3.44e-09 NA NA
5. P P9WM31 Uncharacterized protein Rv1303 1.20e-04 1.77e-02 NA NA
5. P P75083 Uncharacterized protein MG028 homolog 7.21e-06 1.54e-03 NA NA
5. P Q6L4D2 Membrane protein PM19L 4.08e-05 4.64e-04 NA NA
5. P Q5RCG1 Transmembrane protein 192 3.11e-06 2.92e-03 NA NA
5. P A0MD34 Glycoprotein 5 NA 6.68e-05 NA NA
5. P Q9UBR5 Chemokine-like factor 1.45e-05 4.71e-02 NA NA
5. P Q56P28 PRA1 family protein 3 7.74e-04 1.67e-06 NA NA
5. P B4MXW6 Calcium channel flower 4.00e-03 1.15e-04 NA NA
5. P Q920C4 Membrane-spanning 4-domains subfamily A member 3 2.69e-05 8.42e-04 NA NA
5. P Q9JKV5 Secretory carrier-associated membrane protein 4 2.90e-05 4.57e-03 NA NA
5. P Q8IZ96 CKLF-like MARVEL transmembrane domain-containing protein 1 1.17e-04 4.35e-07 NA NA
5. P B4GRI8 Calcium channel flower 1.88e-03 2.30e-04 NA NA
5. P A4IIU3 Transmembrane protein 196 1.12e-05 9.13e-03 NA NA
5. P Q9Y826 Meiotic expression up-regulated protein 31 1.80e-05 2.32e-03 NA NA
5. P Q62737 Cytochrome b-245 light chain 4.33e-03 7.02e-04 NA NA
5. P Q55827 Uncharacterized protein sll0481 1.56e-05 9.63e-03 NA NA
5. P Q66JC0 Transmembrane protein 138 1.50e-05 1.56e-02 NA NA
5. P Q9WVK0 Type-1 angiotensin II receptor-associated protein 7.78e-04 1.48e-02 NA NA
5. P Q9NPI0 Transmembrane protein 138 1.13e-05 3.57e-06 NA NA
5. P Q9P6L4 Uncharacterized protein C688.12c 1.48e-04 1.48e-02 NA NA
5. P V6F2Z8 Magnetosome membrane protein 22 1.09e-04 3.62e-02 NA NA
5. P P34282 Uncharacterized protein C02F5.5 1.61e-04 7.40e-10 NA NA
5. P O31816 Uncharacterized membrane protein YndM 2.25e-05 1.48e-03 NA NA
5. P Q0II74 Transmembrane protein 253 3.93e-05 9.89e-03 NA NA
5. P P0ADJ9 Inner membrane protein YiaA 1.29e-05 1.22e-02 NA NA
5. P P0ADJ8 Inner membrane protein YiaA 9.01e-06 1.22e-02 NA NA
5. P Q2KHX3 PRA1 family protein 2 5.10e-03 1.36e-02 NA NA
5. P Q55E69 Protein SYS1 homolog 2.86e-05 3.44e-04 NA NA
5. P P0C7T8 Transmembrane protein 253 2.16e-06 2.38e-03 NA NA
5. P Q04569 Glycoprotein 5 NA 7.80e-04 NA NA
5. P O32202 Protein LiaI 7.22e-04 1.10e-04 NA NA
5. P Q295N5 Protein KRTCAP2 homolog 6.47e-05 2.22e-02 NA NA
5. P Q5F433 PRA1 family protein 3 6.67e-04 1.44e-06 NA NA
5. P Q9D7S1 Transmembrane protein 54 3.25e-05 5.48e-03 NA NA
5. P Q5R4X8 PRA1 family protein 3 9.22e-04 9.93e-07 NA NA
5. P O29727 Uncharacterized protein AF_0523 1.45e-05 2.40e-05 NA NA
5. P Q8N7C4 Transmembrane protein 217 2.02e-05 1.44e-03 NA NA
5. P P54946 Uncharacterized protein YxeG 1.82e-04 4.15e-07 NA NA
5. P Q750M8 Golgi apparatus membrane protein TVP18 1.13e-03 1.01e-02 NA NA
5. P Q5R5Z8 Secretory carrier-associated membrane protein 5 9.22e-05 2.70e-02 NA NA
5. P Q04767 Golgi apparatus membrane protein TVP18 1.21e-03 3.79e-04 NA NA
5. P O67860 Uncharacterized protein aq_2087 5.24e-06 4.61e-03 NA NA
5. P C1EI34 CASP-like protein 0U1 6.44e-04 1.50e-02 NA NA
5. P P17830 Fimbrial assembly protein, serogroups C1 and C2 (Fragment) 1.31e-04 4.10e-03 NA NA
5. P Q66KF2 Transmembrane protein 192 5.93e-05 3.47e-04 NA NA
5. P Q9PL34 Uncharacterized protein TC_0274 5.68e-04 3.47e-04 NA NA
5. P Q8R5J9 PRA1 family protein 3 2.73e-03 3.55e-07 NA NA
5. P B4LIH0 Calcium channel flower 1.33e-03 8.66e-04 NA NA
5. P B9GHX8 CASP-like protein 2A2 1.97e-04 4.49e-03 NA NA
5. P Q6GV27 Transmembrane protein 225 3.01e-04 1.81e-02 NA NA
5. P Q5E9M1 PRA1 family protein 3 7.66e-04 4.62e-06 NA NA
5. P P75213 Uncharacterized protein MG384.1 homolog 7.00e-07 9.19e-09 NA NA
5. P Q9Y3E0 Vesicle transport protein GOT1B 7.29e-05 7.30e-03 NA NA
5. P P0DI73 CASP-like protein 0U2 2.93e-05 1.08e-02 NA NA
5. P Q9D6G5 Transmembrane protein 138 1.04e-05 3.77e-05 NA NA
5. P B1WBM3 Transmembrane protein 138 1.31e-05 3.24e-04 NA NA
5. P O46521 Cytochrome b-245 light chain 4.14e-03 3.26e-03 NA NA
5. P Q54UB0 Transmembrane protein 208 homolog 1.54e-05 8.26e-04 NA NA
5. P Q8K071 Transmembrane protein 221 9.37e-06 9.98e-03 NA NA
5. P Q5EB63 Transmembrane protein 196 1.36e-05 3.75e-04 NA NA
5. P C5Y7C7 CASP-like protein 1U3 3.41e-04 8.97e-03 NA NA
5. P B4PD01 Calcium channel flower 1.56e-03 7.29e-04 NA NA
5. P P15897 Uncharacterized protein ORF6 NA 3.81e-02 NA NA
5. P Q58DF6 Secretory carrier-associated membrane protein 4 3.65e-04 1.28e-02 NA NA
5. P Q58514 Uncharacterized protein MJ1114 3.34e-06 6.96e-07 NA NA
5. P Q5EAL6 Transmembrane protein 192 7.69e-06 5.38e-03 NA NA
5. P P47485 Uncharacterized protein MG243 1.23e-04 3.07e-02 NA NA
5. P P47155 Protein ILM1 1.33e-04 1.07e-03 NA NA
5. P P47274 Uncharacterized protein MG028 1.60e-05 2.55e-06 NA NA
5. P P34363 Uncharacterized protein C48B4.9 4.06e-06 3.72e-04 NA NA
5. P O84009 Uncharacterized protein CT_006 5.98e-04 1.20e-07 NA NA
5. P Q5HYL7 Transmembrane protein 196 3.84e-06 1.41e-05 NA NA
5. P A5PJY4 Transmembrane protein 138 1.21e-05 9.04e-05 NA NA
5. P O14223 Golgi apparatus membrane protein tvp15 2.21e-03 4.45e-03 NA NA
5. P Q95T12 Calcium channel flower 1.70e-03 4.14e-04 NA NA
5. P O14193 SRP-independent targeting protein 2 homolog 5.24e-05 2.03e-04 NA NA
5. P P54942 Uncharacterized protein YxeC 1.54e-04 2.09e-04 NA NA
5. P B4J043 Calcium channel flower 1.24e-03 1.84e-03 NA NA
5. P B4HIJ8 Calcium channel flower 3.06e-03 1.22e-04 NA NA
5. P P52883 Uncharacterized protein F46C5.7 1.99e-07 1.43e-07 NA NA
5. P Q1E1E0 Golgi apparatus membrane protein TVP18 3.10e-03 3.18e-02 NA NA
5. P Q96B42 Transmembrane protein 18 9.19e-05 8.28e-03 NA NA
5. P B3NDM7 Calcium channel flower 3.59e-03 1.68e-04 NA NA
5. P Q61462 Cytochrome b-245 light chain 4.42e-03 3.34e-04 NA NA
5. P A7TS55 Golgi apparatus membrane protein TVP18 1.67e-03 6.63e-04 NA NA
5. P Q6P501 Lysosomal-associated transmembrane protein 4A 4.16e-05 4.07e-02 NA NA
5. P Q54GE8 Putative uncharacterized transmembrane protein DDB_G0290203 2.58e-04 8.89e-03 NA NA
5. P Q54NS7 PRA1 family protein 2 2.09e-03 1.41e-03 NA NA
5. P P41544 Protein SYS1 4.80e-05 1.96e-06 NA NA
5. P Q95MN4 Cytochrome b-245 light chain 4.88e-03 3.48e-03 NA NA
5. P P26165 2-vinyl bacteriochlorophyllide hydratase 6.08e-06 7.05e-03 NA NA
5. P Q2GSS4 Golgi apparatus membrane protein TVP18 4.38e-04 3.62e-02 NA NA
5. P Q54U35 Uncharacterized transmembrane protein DDB_G0281339 8.17e-05 4.86e-07 NA NA
5. P P75582 Uncharacterized protein MG149.1 homolog 1.27e-05 3.97e-02 NA NA
5. P Q5RCD5 Transmembrane protein 196 6.96e-06 5.49e-06 NA NA
5. P O13994 Inositol phosphorylceramide synthase regulatory subunit kei1 5.14e-05 1.32e-04 NA NA
5. P B4QLP9 Calcium channel flower 3.17e-03 2.17e-04 NA NA
5. P Q8INQ7 Protein KRTCAP2 homolog 6.19e-05 1.42e-02 NA NA
5. P Q5FWC3 Membrane-spanning 4-domains subfamily A member 13 7.73e-06 1.96e-02 NA NA
5. P P34364 Uncharacterized protein C48B4.10 1.09e-04 2.64e-03 NA NA
5. P Q9Y876 Secretory component protein psh3 2.45e-06 1.15e-13 NA NA
5. P P34395 Uncharacterized protein F10E9.1 3.87e-04 1.01e-04 NA NA
5. P Q02774 Secretory component protein SHR3 4.56e-06 1.61e-03 NA NA
5. P Q54L98 Protein KRTCAP2 homolog 1.64e-05 3.18e-08 NA NA
5. P Q28F21 Secretory carrier-associated membrane protein 5 7.78e-05 2.85e-02 NA NA
5. P P64802 Uncharacterized protein Mb1335 1.23e-04 1.77e-02 NA NA
5. P Q197D8 Transmembrane protein 022L NA 7.36e-04 NA NA
5. P B3M9W1 Calcium channel flower 1.98e-03 2.52e-04 NA NA
5. P A6ZMD0 Golgi apparatus membrane protein TVP18 1.11e-03 3.79e-04 NA NA
5. P Q6NYE7 Transmembrane protein 192 6.12e-06 2.95e-03 NA NA
5. P O26240 Uncharacterized protein MTH_137 2.63e-05 4.71e-02 NA NA
5. P Q74ZU2 Golgi apparatus membrane protein TVP15 1.32e-03 1.47e-03 NA NA
5. P P9WM30 Uncharacterized protein MT1343 8.07e-05 1.77e-02 NA NA
5. P P33250 ATP synthase protein I 3.93e-07 2.05e-05 NA NA
5. P Q9ZB71 Uncharacterized protein MG384.1 3.11e-06 1.70e-06 NA NA
5. P Q20263 Probable Golgi transport protein 1 4.06e-03 4.26e-04 NA NA
5. P Q32KQ5 Transmembrane protein 225 5.42e-05 2.09e-02 NA NA
5. P Q8IY95 Transmembrane protein 192 1.63e-06 3.20e-03 NA NA
5. P Q58007 Uncharacterized protein MJ0587 1.16e-06 7.64e-03 NA NA
5. P Q9PQY6 Uncharacterized protein UU158 1.52e-06 2.37e-05 NA NA
5. P Q9JIG8 PRA1 family protein 2 2.73e-03 1.14e-02 NA NA
5. P Q9CR60 Vesicle transport protein GOT1B 5.13e-04 5.19e-03 NA NA
5. P Q58975 Uncharacterized protein MJ1580 3.82e-06 1.36e-03 NA NA
5. P Q9ET20 Secretory carrier-associated membrane protein 4 4.28e-04 4.21e-02 NA NA
5. P A5DJS9 Altered inheritance of mitochondria protein 11 2.37e-03 4.91e-02 NA NA
5. P B4L0H1 Calcium channel flower 7.89e-04 2.23e-03 NA NA
5. P Q03860 Golgi apparatus membrane protein TVP15 1.40e-03 1.35e-02 NA NA
5. P Q642A2 Type-1 angiotensin II receptor-associated protein 5.31e-04 4.25e-03 NA NA
5. P P11022 Membrane protein P8A7 4.10e-05 9.55e-03 NA NA
5. P O65708 Protein MODIFYING WALL LIGNIN-2 5.69e-06 5.89e-03 NA NA
5. P A5DSM9 Golgi apparatus membrane protein TVP18 4.82e-04 1.20e-02 NA NA
5. P O75915 PRA1 family protein 3 7.67e-04 9.93e-07 NA NA
5. P Q9DAC0 CKLF-like MARVEL transmembrane domain-containing protein 2B 1.22e-06 1.35e-04 NA NA
5. P Q2YDE3 Vesicle transport protein GOT1B 8.36e-05 7.30e-03 NA NA
5. P P34360 Uncharacterized protein C48B4.6 1.17e-05 3.47e-10 NA NA
5. P Q54CL4 Protein transport protein got1 homolog 5.81e-04 2.06e-03 NA NA
5. P Q95L73 Cytochrome b-245 light chain 7.30e-03 1.07e-03 NA NA