Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54706.1

JCVISYN3A_0297

Translation initiation factor IF-2.
M. mycoides homolog: Q6MTQ0.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 88
Unique PROST Go: 0
Unique BLAST Go: 58
Unique Foldseek Go: 0

Total Homologs: 4372
Unique PROST Homologs: 4
Unique BLAST Homologs: 3157
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: infB; Translation initiation factor IF-2
Zhang et al. [4]: GO:0003924|GTPase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A5VJE0 (Translation initiation factor IF-2) with a FATCAT P-Value: 0 and RMSD of 2.41 angstrom. The sequence alignment identity is 40.3%.
Structural alignment shown in left. Query protein AVX54706.1 colored as red in alignment, homolog A5VJE0 colored as blue. Query protein AVX54706.1 is also shown in right top, homolog A5VJE0 showed in right bottom. They are colored based on secondary structures.

  AVX54706.1 ---------------------------------------------------------------------------------------------------- 0
      A5VJE0 MAKERIYELAKELKMPSKDLVNMANRQGMGVKSHMSSVTPDQAQQLRQLAKGGQKTTNNQHQPVKKNDGHNKQNNHQAQNHNQHHDHDKTQNERPQKKNN 100

  AVX54706.1 ----------------------------------MKKQVKNIKKQKAQNQTKNIKKQLKEEVN---TGLIDG----IFVYTEPLSVIEFATKI--NKPLT 57
      A5VJE0 SRSNNGTKDNNQHQNNGGRFGGSLNNDQGRNGKRFNK--KN-KKNKKHN--KN--KRLREVAHKQPTQRKDKPLPEVLEYTDGMNAQDLG-KILHRSP-A 191

  AVX54706.1 AILKHYFNQGLLLNQNTLLTEEQMGELCLEFGFDFKKETTV-TKENILQTLLETVDDE---KHLKERPPIVTIMGHVDHGKTTLLDSIKNSNVVASEAGG 153
      A5VJE0 EIVKKLFMLGVMINQNQSLDKDTIELLATDYGIEAKEKVQVDVSD--IDKMFE--DEQNNTEHQVTRPAVVTVMGHVDHGKTTLLDKLRHSHVTEHEAGG 287

  AVX54706.1 ITQAIGAYQITTKH-NKK-ITFIDTPGHEAFTEMRSRGANVTDIVVLIVAADDGVMPQTEEAIDHAKLANVPIIVFINKIDKPGADPNRVKT-ELMKYGL 250
      A5VJE0 ITQEIGAYQV---HYNDQLITFLDTPGHAAFTEMRARGANITDITVLVVAADDGVMPQTVEAIHHAQAAQTPIIVAVNKIDKPGANPDRV-TEELAKYNL 383

  AVX54706.1 VAEEFGGDIPFIEGSAIK--KINLDKLQDTIILISE-LENLKANPDKFASGVVLEAHLDKAKGPVASVLVQQGTLEIKDIMIAGTTFGSIKHIEDEFKHK 347
      A5VJE0 IPEDWGGDTIFVKISA-KFGK-NLDELLDMILLQAEMLE-LKANPDQNAAGSVVEARLDQGRGSVATVLVQQGTLHVGDPIVVGNTFGRVRTMTNENGRR 480

  AVX54706.1 VLKAEPSKPVVVYGLNQVPKAGDKFVVINDEKMAREISEAQLKKQQEEER-RTKQAFTLDAIKQHIDEGELKNITLIIKADTQGSVEALKNSLSKINISG 446
      A5VJE0 IKEATPSTPVEITGLNEVPEAGDRFVVFDDEKTARAAGEERAKRAMDKERQKTSH-VTLDNLFATMKKGQMKTLPIIIKADVQGSVEALSQSLQKIKVDG 579

  AVX54706.1 VKINIIRASVGAISLSDISLASTVRDGLVIVYGFNVRPDAIVRKKAEEDHIEIRLHNIIYKVIEELEDAAKGILDPEIKEVVLGQAQVRALFRHSAIGTI 546
      A5VJE0 VRVDIIHQAVGAINQSDVTLAE-ASNAVII--GFNVRPTAVAKTLADSNSIDIRLHRVIYDAIEEVEDAMKGMLEPVYKEETIGQVEVRQIYKASKVGTI 676

  AVX54706.1 -GGFYVLDGVIPRNAKIRVIRNGVVVYDGEINSLQHQKQDAKEIKAGFEGGLTIKNFNDIKEEDIFEAYKIEQ--IK 620
      A5VJE0 AGGM-VTSGKITRDAKVRLVRDGVVIYEGELGSLKRFKDDVKEVKQGYECGLTIENYNDIKEMDVIEAYKMKEVPVK 752

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0032790	ribosome disassembly
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0006413	translational initiation
1. PBF	GO:0003924	GTPase activity
1. PBF	GO:0003743	translation initiation factor activity
1. PBF	GO:0005634	nucleus
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0003746	translation elongation factor activity
1. PBF	GO:0005759	mitochondrial matrix
1. PBF	GO:0045727	positive regulation of translation
1. PBF	GO:0005525	GTP binding
3. BF	GO:0032543	mitochondrial translation
3. BF	GO:0043022	ribosome binding
3. BF	GO:0006412	translation
3. BF	GO:0000027	ribosomal large subunit assembly
3. BF	GO:0005829	cytosol
3. BF	GO:0005654	nucleoplasm
3. BF	GO:0000287	magnesium ion binding
3. BF	GO:0070125	mitochondrial translational elongation
3. BF	GO:0019843	rRNA binding
4. PB	GO:0061014	positive regulation of mRNA catabolic process
4. PB	GO:0008135	translation factor activity, RNA binding
4. PB	GO:0006414	translational elongation
4. PB	GO:0003747	translation release factor activity
4. PB	GO:0043024	ribosomal small subunit binding
4. PB	GO:0046039	GTP metabolic process
4. PB	GO:0070124	mitochondrial translational initiation
4. PB	GO:0000177	cytoplasmic exosome (RNase complex)
4. PB	GO:0002184	cytoplasmic translational termination
4. PB	GO:0018444	translation release factor complex
7. B	GO:0012507	ER to Golgi transport vesicle membrane
7. B	GO:0003723	RNA binding
7. B	GO:0070181	small ribosomal subunit rRNA binding
7. B	GO:0016539	intein-mediated protein splicing
7. B	GO:0014009	glial cell proliferation
7. B	GO:0009986	cell surface
7. B	GO:0009535	chloroplast thylakoid membrane
7. B	GO:0042254	ribosome biogenesis
7. B	GO:0006364	rRNA processing
7. B	GO:0003400	regulation of COPII vesicle coating
7. B	GO:0006998	nuclear envelope organization
7. B	GO:0004020	adenylylsulfate kinase activity
7. B	GO:0045903	positive regulation of translational fidelity
7. B	GO:1990904	ribonucleoprotein complex
7. B	GO:0015031	protein transport
7. B	GO:0030623	U5 snRNA binding
7. B	GO:0097177	mitochondrial ribosome binding
7. B	GO:0004781	sulfate adenylyltransferase (ATP) activity
7. B	GO:0005739	mitochondrion
7. B	GO:0035368	selenocysteine insertion sequence binding
7. B	GO:0000049	tRNA binding
7. B	GO:0005524	ATP binding
7. B	GO:0001731	formation of translation preinitiation complex
7. B	GO:0046872	metal ion binding
7. B	GO:0043231	intracellular membrane-bounded organelle
7. B	GO:0051301	cell division
7. B	GO:0000103	sulfate assimilation
7. B	GO:0020011	apicoplast
7. B	GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
7. B	GO:0046540	U4/U6 x U5 tri-snRNP complex
7. B	GO:0051881	regulation of mitochondrial membrane potential
7. B	GO:0016259	selenocysteine metabolic process
7. B	GO:0070814	hydrogen sulfide biosynthetic process
7. B	GO:0005743	mitochondrial inner membrane
7. B	GO:0008270	zinc ion binding
7. B	GO:0070863	positive regulation of protein exit from endoplasmic reticulum
7. B	GO:0042802	identical protein binding
7. B	GO:0005794	Golgi apparatus
7. B	GO:0006449	regulation of translational termination
7. B	GO:0051593	response to folic acid
7. B	GO:0097216	guanosine tetraphosphate binding
7. B	GO:0005576	extracellular region
7. B	GO:0005789	endoplasmic reticulum membrane
7. B	GO:0005730	nucleolus
7. B	GO:0006314	intron homing
7. B	GO:0005783	endoplasmic reticulum
7. B	GO:0005850	eukaryotic translation initiation factor 2 complex
7. B	GO:0016150	translation release factor activity, codon nonspecific
7. B	GO:0006790	sulfur compound metabolic process
7. B	GO:0016020	membrane
7. B	GO:2000767	positive regulation of cytoplasmic translation
7. B	GO:0006415	translational termination
7. B	GO:0042274	ribosomal small subunit biogenesis
7. B	GO:0001514	selenocysteine incorporation
7. B	GO:0016149	translation release factor activity, codon specific
7. B	GO:0006400	tRNA modification
7. B	GO:0071007	U2-type catalytic step 2 spliceosome
7. B	GO:0007049	cell cycle

Uniprot GO Annotations

GO	Description
GO:0006412	translation
GO:0006413	translational initiation
GO:0003924	GTPase activity
GO:0003743	translation initiation factor activity
GO:0005737	cytoplasm
GO:0000166	nucleotide binding
GO:0005525	GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q18BH4	Translation initiation factor IF-2	0.00e+00	4.83e-49	2.23e-170	0.8236
1. PBF	Q9PIZ1	Translation initiation factor IF-2	0.00e+00	1.19e-02	3.86e-151	0.8518
1. PBF	B1KWK7	Translation initiation factor IF-2	0.00e+00	1.42e-35	2.01e-178	0.8305
1. PBF	Q8EWU0	Translation initiation factor IF-2	0.00e+00	3.28e-65	1.48e-178	0.8832
1. PBF	Q8F7K1	Translation initiation factor IF-2	0.00e+00	4.92e-04	9.60e-150	0.8245
1. PBF	Q2FHG9	Translation initiation factor IF-2	0.00e+00	1.31e-27	0.0	0.8549
1. PBF	B8DG02	Translation initiation factor IF-2	0.00e+00	7.96e-11	0.0	0.8483
1. PBF	B9IVA1	Translation initiation factor IF-2	0.00e+00	3.97e-33	0.0	0.8648
1. PBF	Q8NWZ1	Translation initiation factor IF-2	0.00e+00	2.05e-27	0.0	0.8551
1. PBF	A6TRK7	Translation initiation factor IF-2	0.00e+00	7.67e-26	1.87e-176	0.8336
1. PBF	A5VJE0	Translation initiation factor IF-2	0.00e+00	4.48e-17	0.0	0.8329
1. PBF	A9BJ54	Translation initiation factor IF-2	0.00e+00	2.41e-38	4.34e-130	0.74
1. PBF	Q2VZV0	Translation initiation factor IF-2	0.00e+00	6.32e-03	1.88e-170	0.8259
1. PBF	Q72NX3	Translation initiation factor IF-2	0.00e+00	5.20e-03	1.29e-149	0.8297
1. PBF	A7GRE3	Translation initiation factor IF-2	0.00e+00	8.92e-32	0.0	0.8499
1. PBF	Q83GT8	Translation initiation factor IF-2	0.00e+00	1.14e-08	5.37e-157	0.8068
1. PBF	Q7NBZ4	Translation initiation factor IF-2	0.00e+00	6.51e-72	0.0	0.8782
1. PBF	Q8XJR8	Translation initiation factor IF-2	0.00e+00	5.52e-34	2.47e-179	0.8248
1. PBF	Q6MTQ0	Translation initiation factor IF-2	0.00e+00	3.82e-112	0.0	0.9778
1. PBF	B8CW72	Translation initiation factor IF-2	0.00e+00	1.42e-36	0.0	0.8047
1. PBF	B9LBJ2	Translation initiation factor IF-2	0.00e+00	3.10e-11	5.05e-158	0.8306
1. PBF	A7H1L5	Translation initiation factor IF-2	0.00e+00	6.44e-03	6.68e-151	0.8393
1. PBF	Q8R5Z1	Translation initiation factor IF-2	0.00e+00	1.37e-17	4.06e-174	0.8864
1. PBF	A5ISF3	Translation initiation factor IF-2	0.00e+00	1.76e-27	0.0	0.8567
1. PBF	B5ZBC9	Translation initiation factor IF-2	0.00e+00	1.99e-70	0.0	0.8974
1. PBF	C1CUQ9	Translation initiation factor IF-2	0.00e+00	4.95e-43	8.00e-130	0.7705
1. PBF	A9WGP6	Translation initiation factor IF-2	0.00e+00	3.10e-11	5.05e-158	0.8164
1. PBF	A0RQZ4	Translation initiation factor IF-2	0.00e+00	2.89e-04	3.53e-157	0.8367
1. PBF	B2A397	Translation initiation factor IF-2	0.00e+00	1.11e-41	4.25e-176	0.8392
1. PBF	P47388	Translation initiation factor IF-2	0.00e+00	1.99e-67	1.09e-172	0.9299
1. PBF	Q4A578	Translation initiation factor IF-2	0.00e+00	5.05e-69	4.74e-150	0.797
1. PBF	B9DPF5	Translation initiation factor IF-2	0.00e+00	8.12e-26	0.0	0.8632
1. PBF	B8E6N2	Translation initiation factor IF-2	0.00e+00	2.59e-02	9.27e-159	0.8348
1. PBF	P46198	Translation initiation factor IF-2, mitochondrial	0.00e+00	5.65e-24	5.77e-111	0.7836
1. PBF	C1EP35	Translation initiation factor IF-2	0.00e+00	6.86e-33	0.0	0.8708
1. PBF	A4SY78	Translation initiation factor IF-2	0.00e+00	1.48e-02	2.59e-158	0.832
1. PBF	A8MFA8	Translation initiation factor IF-2	0.00e+00	1.74e-21	1.28e-180	0.8143
1. PBF	A1VXL9	Translation initiation factor IF-2	0.00e+00	1.07e-02	6.74e-150	0.8619
1. PBF	Q04GN0	Translation initiation factor IF-2	0.00e+00	6.69e-03	0.0	0.8301
1. PBF	Q03QT5	Translation initiation factor IF-2	0.00e+00	2.45e-08	1.17e-179	0.8138
1. PBF	A8FJU1	Translation initiation factor IF-2	0.00e+00	1.93e-02	8.08e-151	0.8541
1. PBF	B0S1E5	Translation initiation factor IF-2	0.00e+00	4.00e-10	4.93e-168	0.8381
1. PBF	Q73FL0	Translation initiation factor IF-2	0.00e+00	1.37e-09	3.07e-142	0.8263
1. PBF	Q812X7	Translation initiation factor IF-2	0.00e+00	2.15e-33	0.0	0.8623
1. PBF	B7IUH1	Translation initiation factor IF-2	0.00e+00	5.44e-33	0.0	0.8761
1. PBF	P65134	Translation initiation factor IF-2	0.00e+00	1.76e-27	0.0	0.8516
1. PBF	B1HR05	Translation initiation factor IF-2	0.00e+00	6.02e-15	0.0	0.8483
1. PBF	A5I4J3	Translation initiation factor IF-2	0.00e+00	2.05e-35	9.42e-179	0.8306
1. PBF	A6WRG8	Translation initiation factor IF-2	0.00e+00	2.59e-02	9.27e-159	0.8324
1. PBF	A6VCK1	Translation initiation factor IF-2	0.00e+00	8.13e-06	2.99e-146	0.8054
1. PBF	Q04U31	Translation initiation factor IF-2	0.00e+00	3.38e-05	9.53e-150	0.8369
1. PBF	P65133	Translation initiation factor IF-2	0.00e+00	1.76e-27	0.0	0.8577
1. PBF	B1L7T1	Translation initiation factor IF-2	0.00e+00	4.85e-39	3.57e-148	0.7779
1. PBF	A6LSQ4	Translation initiation factor IF-2	0.00e+00	1.88e-31	0.0	0.8191
1. PBF	Q895J8	Translation initiation factor IF-2	0.00e+00	2.44e-35	6.15e-176	0.8543
1. PBF	C3P5L5	Translation initiation factor IF-2	0.00e+00	4.05e-33	0.0	0.8748
1. PBF	C1FS59	Translation initiation factor IF-2	0.00e+00	1.61e-35	1.18e-178	0.8347
1. PBF	Q1WUF4	Translation initiation factor IF-2	0.00e+00	2.70e-18	0.0	0.839
1. PBF	Q6B8S2	Translation initiation factor IF-2, chloroplastic	0.00e+00	2.23e-09	1.13e-117	0.7755
1. PBF	Q88VK7	Translation initiation factor IF-2	0.00e+00	9.09e-04	0.0	0.8075
1. PBF	C3L7B4	Translation initiation factor IF-2	0.00e+00	4.05e-33	0.0	0.8655
1. PBF	B9EBE9	Translation initiation factor IF-2	0.00e+00	5.16e-24	0.0	0.8609
1. PBF	Q6G0P2	Translation initiation factor IF-2	0.00e+00	3.96e-02	4.85e-151	0.8125
1. PBF	A6U188	Translation initiation factor IF-2	0.00e+00	1.76e-27	0.0	0.8542
1. PBF	A0RHI4	Translation initiation factor IF-2	0.00e+00	6.86e-33	0.0	0.873
1. PBF	Q2YXP7	Translation initiation factor IF-2	0.00e+00	1.76e-27	0.0	0.8575
1. PBF	Q03WH4	Translation initiation factor IF-2	0.00e+00	4.00e-02	1.12e-179	0.8217
1. PBF	Q88DV7	Translation initiation factor IF-2	0.00e+00	1.08e-05	8.92e-150	0.8169
1. PBF	A8Z3U9	Translation initiation factor IF-2	0.00e+00	1.31e-27	0.0	0.8577
1. PBF	C0QTL9	Translation initiation factor IF-2	0.00e+00	2.39e-02	1.44e-169	0.8106
1. PBF	A8F5A0	Translation initiation factor IF-2	0.00e+00	3.93e-40	4.55e-140	0.7776
1. PBF	Q5HGG2	Translation initiation factor IF-2	0.00e+00	1.31e-27	0.0	0.8548
1. PBF	B7HDT6	Translation initiation factor IF-2	0.00e+00	2.15e-33	0.0	0.8655
1. PBF	Q732Q9	Translation initiation factor IF-2	0.00e+00	4.31e-33	0.0	0.8586
1. PBF	Q71ZZ7	Translation initiation factor IF-2	0.00e+00	1.49e-10	0.0	0.868
1. PBF	O78489	Translation initiation factor IF-2, chloroplastic	0.00e+00	2.89e-13	1.82e-125	0.7575
1. PBF	B9KEV0	Translation initiation factor IF-2	0.00e+00	4.40e-02	1.11e-147	0.8591
1. PBF	C5BFB7	Translation initiation factor IF-2	0.00e+00	2.78e-02	1.75e-160	0.8218
1. PBF	Q5HX30	Translation initiation factor IF-2	0.00e+00	1.78e-02	2.74e-151	0.8772
1. PBF	Q4A7E2	Translation initiation factor IF-2	0.00e+00	4.70e-64	9.98e-156	0.8018
1. PBF	Q81WM3	Translation initiation factor IF-2	0.00e+00	4.05e-33	0.0	0.8677
1. PBF	A7ZC69	Translation initiation factor IF-2	0.00e+00	5.76e-03	5.89e-157	0.852
1. PBF	Q6HF02	Translation initiation factor IF-2	0.00e+00	6.86e-33	0.0	0.871
1. PBF	B7IF03	Translation initiation factor IF-2	0.00e+00	9.60e-34	2.62e-144	0.7584
1. PBF	C3L0B6	Translation initiation factor IF-2	0.00e+00	2.06e-34	2.64e-178	0.83
1. PBF	Q2GKQ2	Translation initiation factor IF-2	0.00e+00	1.35e-04	3.42e-126	0.82
1. PBF	Q87WQ5	Translation initiation factor IF-2	0.00e+00	4.53e-06	5.38e-148	0.819
1. PBF	B1AIV8	Translation initiation factor IF-2	0.00e+00	3.20e-71	0.0	0.8979
1. PBF	A1RGX5	Translation initiation factor IF-2	0.00e+00	2.99e-02	4.37e-157	0.8314
1. PBF	Q97I51	Translation initiation factor IF-2	0.00e+00	1.07e-30	7.26e-176	0.8319
1. PBF	Q98R05	Translation initiation factor IF-2	0.00e+00	1.61e-70	4.75e-161	0.8452
1. PBF	Q1GVI9	Translation initiation factor IF-2	0.00e+00	2.76e-02	8.20e-155	0.7985
1. PBF	Q04ZJ5	Translation initiation factor IF-2	0.00e+00	1.51e-04	9.65e-150	0.8315
1. PBF	Q8CST4	Translation initiation factor IF-2	0.00e+00	9.20e-23	0.0	0.8535
1. PBF	Q5GS99	Translation initiation factor IF-2	0.00e+00	8.58e-09	5.72e-141	0.8003
1. PBF	A8ZZ65	Translation initiation factor IF-2	0.00e+00	2.43e-02	4.81e-155	0.8192
1. PBF	P51257	Translation initiation factor IF-2, chloroplastic	0.00e+00	6.40e-12	2.59e-121	0.7737
1. PBF	P75590	Translation initiation factor IF-2	0.00e+00	3.78e-67	2.84e-174	0.872
1. PBF	Q49X54	Translation initiation factor IF-2	0.00e+00	1.53e-31	0.0	0.8519
1. PBF	A5N842	Translation initiation factor IF-2	0.00e+00	1.21e-30	0.0	0.8635
1. PBF	A6QGG8	Translation initiation factor IF-2	0.00e+00	1.31e-27	0.0	0.8549
1. PBF	Q72KE8	Translation initiation factor IF-2	0.00e+00	2.26e-38	4.87e-132	0.8432
1. PBF	Q9RTG5	Translation initiation factor IF-2	0.00e+00	1.10e-47	2.92e-129	0.7676
1. PBF	Q9WZN3	Translation initiation factor IF-2	0.00e+00	3.37e-39	3.14e-147	0.7621
1. PBF	Q5ZZV6	Translation initiation factor IF-2	0.00e+00	2.73e-64	1.15e-155	0.7988
1. PBF	Q9XEK9	Translation initiation factor IF-2, chloroplastic (Fragment)	0.00e+00	9.07e-03	1.94e-120	0.8405
1. PBF	A8EWD7	Translation initiation factor IF-2	0.00e+00	2.46e-02	1.02e-139	0.8376
1. PBF	O67825	Translation initiation factor IF-2	0.00e+00	7.30e-09	6.99e-166	0.8221
1. PBF	C5CDZ4	Translation initiation factor IF-2	0.00e+00	5.93e-38	7.08e-142	0.7841
1. PBF	A7X1Q1	Translation initiation factor IF-2	0.00e+00	1.76e-27	0.0	0.8585
1. PBF	B2G6V6	Translation initiation factor IF-2	0.00e+00	4.48e-17	0.0	0.8301
1. PBF	A0LXQ1	Translation initiation factor IF-2	0.00e+00	3.60e-02	1.36e-164	0.7914
1. PBF	A4SGG2	Translation initiation factor IF-2	0.00e+00	3.26e-02	6.32e-165	0.8112
1. PBF	Q6G9U4	Translation initiation factor IF-2	0.00e+00	2.05e-27	0.0	0.8595
1. PBF	Q5HPS2	Translation initiation factor IF-2	0.00e+00	9.20e-23	0.0	0.8502
1. PBF	Q83HG7	Translation initiation factor IF-2	0.00e+00	9.48e-09	4.77e-157	0.8062
1. PBF	Q57JH9	Translation initiation factor IF-2	0.00e+00	4.40e-02	2.44e-152	0.8333
1. PBF	Q9PQH1	Translation initiation factor IF-2	0.00e+00	3.20e-71	0.0	0.8967
1. PBF	A1U600	Translation initiation factor IF-2	0.00e+00	1.36e-05	1.71e-145	0.8511
1. PBF	B1XV89	Translation initiation factor IF-2	0.00e+00	7.07e-03	1.20e-153	0.8312
1. PBF	Q1LSK8	Translation initiation factor IF-2	0.00e+00	2.25e-02	1.12e-138	0.8414
1. PBF	Q4A9A2	Translation initiation factor IF-2	0.00e+00	2.73e-64	1.15e-155	0.793
1. PBF	Q6KID8	Translation initiation factor IF-2	0.00e+00	2.68e-71	0.0	0.8997
1. PBF	A3D7K6	Translation initiation factor IF-2	0.00e+00	2.59e-02	9.27e-159	0.8361
1. PBF	A9VT50	Translation initiation factor IF-2	0.00e+00	8.55e-32	0.0	0.8777
1. PBF	A5IJ09	Translation initiation factor IF-2	0.00e+00	1.30e-37	1.09e-148	0.7743
1. PBF	Q5PAJ5	Translation initiation factor IF-2	0.00e+00	1.16e-03	6.06e-125	0.7844
1. PBF	A6LP48	Translation initiation factor IF-2	0.00e+00	2.36e-36	7.30e-143	0.7616
1. PBF	P18311	Translation initiation factor IF-2	0.00e+00	1.02e-07	0.0	0.8391
1. PBF	Q6F1H1	Translation initiation factor IF-2	0.00e+00	1.97e-78	0.0	0.9666
1. PBF	Q2SSE6	Translation initiation factor IF-2	0.00e+00	2.43e-102	0.0	0.9648
1. PBF	A7FVZ3	Translation initiation factor IF-2	0.00e+00	2.05e-35	9.42e-179	0.8309
1. PBF	A7GG06	Translation initiation factor IF-2	0.00e+00	2.79e-34	3.22e-179	0.813
1. PBF	Q6GHG6	Translation initiation factor IF-2	0.00e+00	1.21e-27	0.0	0.8506
1. PBF	Q636L3	Translation initiation factor IF-2	0.00e+00	6.86e-33	0.0	0.8659
1. PBF	Q835U8	Translation initiation factor IF-2	0.00e+00	6.40e-08	0.0	0.836
1. PBF	B7HLE6	Translation initiation factor IF-2	0.00e+00	3.97e-33	0.0	0.8617
1. PBF	B2GBN7	Translation initiation factor IF-2	0.00e+00	2.28e-10	0.0	0.8361
1. PBF	B8GAE2	Translation initiation factor IF-2	0.00e+00	3.70e-10	1.21e-157	0.7943
1. PBF	A7HN01	Translation initiation factor IF-2	0.00e+00	2.03e-41	9.54e-143	0.7734
1. PBF	P48515	Translation initiation factor IF-2	0.00e+00	2.26e-38	4.87e-132	0.8415
3. BF	A7ZQ13	Elongation factor 4	9.43e-07	NA	1.14e-09	0.7786
3. BF	Q8DTF3	Elongation factor 4	2.55e-06	NA	3.00e-12	0.7395
3. BF	B0SUQ6	Elongation factor G	5.01e-06	NA	6.68e-09	0.5467
3. BF	Q1QX26	Elongation factor 4	2.28e-06	NA	1.90e-08	0.7487
3. BF	B2J955	Translation initiation factor IF-2	0.00e+00	NA	3.19e-161	0.8581
3. BF	Q0VSS1	Translation initiation factor IF-2	0.00e+00	NA	7.66e-150	0.8337
3. BF	C1CQ48	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8473
3. BF	C0RMH8	Elongation factor 4	1.09e-06	NA	2.35e-08	0.705
3. BF	C6DC02	Elongation factor 4	8.23e-07	NA	4.11e-12	0.7784
3. BF	Q1JFG4	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8447
3. BF	Q3J8D2	Elongation factor 4	2.43e-06	NA	1.56e-07	0.7863
3. BF	B5ZAB8	Elongation factor 4	3.66e-06	NA	1.48e-06	0.755
3. BF	B7N6F7	Elongation factor 4	9.37e-07	NA	1.14e-09	0.7793
3. BF	B2I601	Elongation factor 4	3.92e-06	NA	1.92e-08	0.7342
3. BF	P55972	Translation initiation factor IF-2	0.00e+00	NA	1.58e-144	0.841
3. BF	Q2A5X6	Elongation factor 4	2.15e-06	NA	1.91e-08	0.7484
3. BF	B1ILM7	Elongation factor 4	1.61e-06	NA	7.84e-11	0.7037
3. BF	Q7V8S4	Elongation factor 4	1.95e-06	NA	3.29e-10	0.7346
3. BF	A6TCI3	Elongation factor 4	9.24e-07	NA	8.45e-11	0.7784
3. BF	Q21H61	Translation initiation factor IF-2	0.00e+00	NA	3.28e-145	0.8133
3. BF	Q2GJV7	Elongation factor 4	2.94e-06	NA	3.44e-07	0.7563
3. BF	Q5B6J8	Elongation factor G, mitochondrial	1.63e-04	NA	2.16e-06	0.5069
3. BF	A5VR09	Elongation factor G	3.00e-05	NA	1.18e-09	0.5268
3. BF	B2UYA7	Elongation factor G	1.15e-05	NA	1.40e-08	0.5563
3. BF	Q8DPN5	Elongation factor 4	9.20e-06	NA	2.79e-11	0.7465
3. BF	Q97JJ6	Elongation factor 4	1.64e-06	NA	5.48e-09	0.6996
3. BF	P58002	Translation initiation factor IF-2	0.00e+00	NA	1.99e-179	0.8363
3. BF	A0K5V7	Elongation factor 4	1.59e-05	NA	4.66e-08	0.7587
3. BF	Q8Y742	Elongation factor 4	4.89e-06	NA	9.24e-11	0.7492
3. BF	Q2RQV7	Elongation factor G	3.13e-05	NA	5.19e-07	0.5479
3. BF	A4W3R7	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8465
3. BF	A8Z4C4	Elongation factor 4	2.17e-06	NA	2.11e-12	0.7337
3. BF	C0M8H9	Elongation factor 4	1.11e-05	NA	4.96e-11	0.7333
3. BF	Q88VN0	Elongation factor 4 1	6.88e-06	NA	5.68e-10	0.7718
3. BF	Q3KHM1	Elongation factor 4	1.34e-06	NA	4.59e-09	0.7373
3. BF	B1ZC10	Elongation factor 4	9.13e-07	NA	1.48e-08	0.7411
3. BF	A7GHI0	Elongation factor 4	1.51e-06	NA	7.84e-11	0.6984
3. BF	Q8XHS1	Elongation factor G	4.92e-06	NA	2.06e-08	0.5433
3. BF	B3PLG4	Elongation factor 4	9.09e-07	NA	4.76e-11	0.7654
3. BF	A6WYK4	Elongation factor 4	2.76e-06	NA	2.29e-08	0.7085
3. BF	B8H2Z7	Elongation factor 4	2.72e-06	NA	1.69e-09	0.722
3. BF	B5E266	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8465
3. BF	A1CHC3	Elongation factor G, mitochondrial	1.19e-03	NA	1.23e-06	0.4238
3. BF	Q11HP9	Elongation factor G	2.64e-05	NA	8.24e-09	0.5501
3. BF	C1AYS4	Elongation factor G	6.92e-05	NA	1.47e-09	0.5066
3. BF	Q5FFE7	Elongation factor G	2.86e-05	NA	1.37e-07	0.5495
3. BF	Q6G550	Elongation factor 4	1.10e-06	NA	7.57e-07	0.7024
3. BF	B8DIZ5	Elongation factor 4	2.36e-06	NA	1.20e-10	0.7451
3. BF	O83523	Elongation factor 4	3.28e-06	NA	5.55e-09	0.7648
3. BF	Q0C5X0	Elongation factor 4	1.38e-06	NA	1.11e-06	0.7471
3. BF	C4K153	Elongation factor 4	8.76e-06	NA	1.48e-05	0.7365
3. BF	Q97EH4	Elongation factor G	5.64e-06	NA	1.22e-08	0.563
3. BF	Q3JV86	Elongation factor G 1	6.47e-06	NA	1.59e-07	0.5357
3. BF	A0ALY9	Elongation factor G	2.45e-05	NA	3.99e-09	0.5656
3. BF	B7KJX0	Elongation factor 4	2.01e-06	NA	8.44e-12	0.7306
3. BF	A5UFI9	Elongation factor 4	5.38e-05	NA	1.14e-10	0.7596
3. BF	A6VLV6	Elongation factor 4	5.27e-05	NA	2.06e-10	0.7786
3. BF	Q67P86	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8408
3. BF	Q0SQE1	Elongation factor G	2.30e-05	NA	2.06e-08	0.5434
3. BF	C1D8X2	Translation initiation factor IF-2	0.00e+00	NA	1.44e-164	0.8134
3. BF	C0M8P7	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8441
3. BF	Q8K9Q9	Elongation factor 4	8.31e-07	NA	1.21e-07	0.767
3. BF	Q9PGR3	Translation initiation factor IF-2	0.00e+00	NA	4.17e-151	0.8209
3. BF	Q2YT42	Elongation factor 4	2.20e-06	NA	2.16e-12	0.7451
3. BF	C0PYG5	Elongation factor 4	9.45e-07	NA	7.40e-09	0.7789
3. BF	Q1MPS9	Elongation factor G	2.27e-05	NA	1.40e-07	0.3842
3. BF	A3PNL2	Translation initiation factor IF-2	0.00e+00	NA	1.37e-147	0.8112
3. BF	P0DB85	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8373
3. BF	Q1QR19	Elongation factor 4	2.79e-06	NA	9.30e-07	0.7087
3. BF	Q1J6V6	Elongation factor 4	1.98e-06	NA	1.42e-10	0.7326
3. BF	P74228	Elongation factor G 2	8.17e-06	NA	2.65e-08	0.538
3. BF	B3WER5	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8229
3. BF	Q1JH37	Elongation factor 4	1.03e-05	NA	1.36e-10	0.7326
3. BF	B2K2Q5	Translation initiation factor IF-2	0.00e+00	NA	6.38e-154	0.8321
3. BF	A3NBT1	Elongation factor 4	1.73e-05	NA	5.27e-09	0.7515
3. BF	Q890N8	Elongation factor G	4.02e-06	NA	6.28e-08	0.5411
3. BF	B1KI55	Elongation factor 4	1.26e-06	NA	5.26e-09	0.7776
3. BF	A9KNW4	Translation initiation factor IF-2	0.00e+00	NA	5.24e-164	0.8747
3. BF	Q2P4M4	Elongation factor 4	3.64e-06	NA	3.64e-08	0.7232
3. BF	A9MP36	Translation initiation factor IF-2	0.00e+00	NA	6.09e-153	0.8263
3. BF	Q5NQ27	Translation initiation factor IF-2	0.00e+00	NA	2.06e-158	0.8009
3. BF	A7I3V0	Translation initiation factor IF-2	0.00e+00	NA	4.36e-151	0.8227
3. BF	Q4L6T4	Elongation factor 4	7.17e-06	NA	6.76e-12	0.766
3. BF	B8FCY5	Translation initiation factor IF-2	0.00e+00	NA	9.15e-170	0.8224
3. BF	B3E7T2	Elongation factor G	2.29e-05	NA	5.82e-09	0.5559
3. BF	B2G6W5	Elongation factor 4	1.78e-06	NA	6.70e-09	0.7387
3. BF	B8I3E6	Elongation factor 4	1.92e-06	NA	7.01e-11	0.7288
3. BF	Q6MP77	Elongation factor G 2	9.70e-06	NA	6.84e-08	0.3862
3. BF	Q5XCD2	Elongation factor 4	7.45e-06	NA	1.39e-10	0.7475
3. BF	Q4A8T7	Elongation factor G	5.29e-05	NA	1.54e-09	0.5781
3. BF	Q9PI16	Elongation factor G	1.04e-05	NA	1.66e-07	0.5602
3. BF	Q1GRH5	Elongation factor 4	1.40e-05	NA	5.30e-06	0.7252
3. BF	B5QTV0	Elongation factor 4	9.09e-07	NA	8.14e-09	0.778
3. BF	A8GI27	Elongation factor 4	9.14e-07	NA	4.14e-11	0.78
3. BF	B3QY21	Elongation factor G	1.07e-04	NA	4.48e-07	0.3827
3. BF	A9MCW5	Elongation factor 4	1.38e-06	NA	2.41e-08	0.7052
3. BF	Q87XF8	Elongation factor 4	1.14e-06	NA	3.98e-09	0.7826
3. BF	Q8YDB8	Elongation factor 4	1.24e-06	NA	2.35e-08	0.699
3. BF	Q88MY7	Elongation factor 4	1.46e-06	NA	1.04e-09	0.7353
3. BF	Q8ZD74	Elongation factor 4	8.63e-07	NA	2.16e-10	0.7808
3. BF	Q66F60	Translation initiation factor IF-2	0.00e+00	NA	6.38e-154	0.8339
3. BF	B7M8I2	Elongation factor 4	1.25e-05	NA	5.90e-10	0.7798
3. BF	B0KCJ7	Elongation factor G	2.57e-05	NA	2.25e-08	0.5558
3. BF	Q9ZK24	Elongation factor G	2.69e-05	NA	4.34e-08	0.5418
3. BF	Q2NJ19	Elongation factor G	2.10e-05	NA	9.31e-10	0.5314
3. BF	A6RGX9	Translation factor GUF1, mitochondrial	3.13e-05	NA	2.35e-06	0.7328
3. BF	B5REN6	Translation initiation factor IF-2	0.00e+00	NA	2.74e-152	0.8244
3. BF	Q5HFH6	Elongation factor 4	2.20e-06	NA	2.11e-12	0.7332
3. BF	P0A1W5	Elongation factor 4	9.30e-07	NA	8.14e-09	0.7554
3. BF	Q7URR0	Translation initiation factor IF-2	0.00e+00	NA	4.65e-152	0.8171
3. BF	B1LP82	Elongation factor 4	9.53e-07	NA	1.14e-09	0.7799
3. BF	Q3K302	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8465
3. BF	Q3A4A7	Translation initiation factor IF-2	0.00e+00	NA	8.64e-169	0.8183
3. BF	B8DE32	Elongation factor 4	8.05e-06	NA	9.24e-11	0.7491
3. BF	B3QZT9	Elongation factor 4	3.49e-06	NA	9.40e-10	0.7644
3. BF	A9KKU4	Elongation factor 4	4.11e-06	NA	8.50e-11	0.7293
3. BF	Q9ZEU4	Elongation factor G	6.48e-05	NA	2.01e-09	0.5687
3. BF	B9KL88	Elongation factor G	2.96e-05	NA	6.24e-08	0.5402
3. BF	B1MZH4	Translation initiation factor IF-2	0.00e+00	NA	2.70e-180	0.8374
3. BF	B5E4T8	Elongation factor 4	1.46e-06	NA	2.76e-11	0.7549
3. BF	B0S1G2	Elongation factor 4	2.98e-06	NA	2.77e-09	0.7294
3. BF	Q1D9P5	Elongation factor G 1	2.66e-05	NA	6.62e-08	0.5614
3. BF	A2C4P1	Translation initiation factor IF-2	0.00e+00	NA	6.39e-154	0.8462
3. BF	B9IY86	Elongation factor 4	3.01e-06	NA	4.99e-12	0.7557
3. BF	B0B809	Elongation factor G	3.03e-05	NA	1.20e-07	0.5393
3. BF	Q5PNC0	Elongation factor 4	8.91e-07	NA	8.07e-09	0.7787
3. BF	Q1CC07	Translation initiation factor IF-2	0.00e+00	NA	3.43e-153	0.8329
3. BF	Q8P7U7	Translation initiation factor IF-2	0.00e+00	NA	6.55e-156	0.8228
3. BF	Q8DVP9	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8422
3. BF	Q3SH47	Elongation factor 4	4.08e-05	NA	1.74e-09	0.7825
3. BF	B0K5P0	Elongation factor G	1.87e-05	NA	2.25e-08	0.5571
3. BF	Q0TNS2	Elongation factor 4	5.55e-06	NA	3.04e-08	0.7304
3. BF	Q0AF67	Elongation factor 4	1.23e-06	NA	6.94e-10	0.7884
3. BF	Q250N5	Elongation factor G	5.89e-05	NA	9.43e-08	0.5491
3. BF	B4Q5D5	Elongation factor G, mitochondrial	2.23e-04	NA	1.73e-10	0.5206
3. BF	A3CQ18	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8472
3. BF	Q8KTB0	Elongation factor G	8.46e-05	NA	6.54e-09	0.5513
3. BF	Q6MD64	Translation initiation factor IF-2	0.00e+00	NA	1.91e-125	0.8111
3. BF	A1SSM6	Elongation factor 4	1.10e-06	NA	7.53e-11	0.7653
3. BF	C0ZIH5	Elongation factor G	6.91e-06	NA	2.77e-07	0.3813
3. BF	Q8E1H3	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8453
3. BF	B0SRL4	Elongation factor 4	1.07e-06	NA	3.37e-09	0.7442
3. BF	Q4QPM8	Elongation factor 4	5.33e-05	NA	1.14e-10	0.7786
3. BF	P69948	Elongation factor G	2.03e-05	NA	1.50e-08	0.5621
3. BF	Q8PMV3	Elongation factor 4	3.17e-06	NA	1.24e-08	0.7325
3. BF	Q1LTI1	Elongation factor 4	8.04e-07	NA	9.33e-11	0.7667
3. BF	C5BAI0	Elongation factor 4	3.79e-05	NA	1.81e-10	0.78
3. BF	Q5M008	Elongation factor 4	4.20e-06	NA	7.15e-12	0.6995
3. BF	A4WW80	Translation initiation factor IF-2	0.00e+00	NA	1.78e-147	0.8022
3. BF	B9MQH0	Elongation factor G	5.61e-06	NA	4.11e-07	0.5478
3. BF	Q0SRD8	Elongation factor 4	5.95e-06	NA	1.94e-08	0.7303
3. BF	Q6MTR6	Elongation factor 4	3.38e-06	NA	3.47e-13	0.7534
3. BF	B8ENL1	Elongation factor 4	2.34e-06	NA	3.34e-08	0.7442
3. BF	A0RIT7	Elongation factor 4	3.15e-06	NA	4.65e-12	0.7552
3. BF	Q99YG1	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8436
3. BF	B3QQI2	Translation initiation factor IF-2	0.00e+00	NA	1.08e-161	0.8114
3. BF	A7A0X4	Elongation factor G, mitochondrial	4.45e-05	NA	1.91e-09	0.5352
3. BF	Q1JKH1	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8435
3. BF	A8GRF6	Elongation factor 4	8.68e-06	NA	1.27e-05	0.7266
3. BF	A4IJI6	Elongation factor G	6.79e-06	NA	2.23e-09	0.5789
3. BF	B0KA85	Elongation factor 4	1.71e-06	NA	2.37e-09	0.7361
3. BF	Q7N1X3	Elongation factor 4	9.14e-07	NA	8.36e-11	0.7805
3. BF	A3DE44	Translation initiation factor IF-2	0.00e+00	NA	2.59e-164	0.8399
3. BF	Q16S14	Elongation factor G, mitochondrial	7.55e-04	NA	7.11e-12	0.5183
3. BF	Q5H1R5	Elongation factor 4	2.70e-06	NA	3.64e-08	0.7377
3. BF	Q72E76	Elongation factor 4	2.52e-06	NA	2.53e-10	0.731
3. BF	P0DC22	Elongation factor 4	6.64e-06	NA	9.46e-10	0.7027
3. BF	B8D0C1	Elongation factor G	2.03e-05	NA	4.26e-08	0.5415
3. BF	Q2W0F9	Elongation factor 4	2.19e-06	NA	7.08e-08	0.7335
3. BF	A6LLL0	Elongation factor G	2.49e-05	NA	4.88e-10	0.5389
3. BF	Q1D777	Elongation factor G 2	4.26e-05	NA	1.66e-09	0.5543
3. BF	Q73HR8	Elongation factor 4	1.27e-06	NA	1.72e-07	0.7629
3. BF	Q03KW7	Elongation factor 4	4.34e-06	NA	7.15e-12	0.7138
3. BF	A5WCD6	Elongation factor 4	1.17e-06	NA	3.46e-09	0.7357
3. BF	A7GT14	Elongation factor 4	6.58e-06	NA	2.53e-13	0.7428
3. BF	A4TKY0	Elongation factor 4	8.53e-07	NA	2.63e-10	0.7843
3. BF	A8A379	Elongation factor 4	9.45e-07	NA	1.14e-09	0.7788
3. BF	Q5HBH4	Elongation factor 4	1.52e-05	NA	4.57e-07	0.7679
3. BF	Q8K9C8	50S ribosomal subunit assembly factor BipA	2.12e-05	NA	3.10e-12	0.7141
3. BF	A0Q1R8	Elongation factor 4	5.90e-06	NA	2.74e-08	0.7107
3. BF	C3L5S2	Elongation factor 4	3.09e-06	NA	5.03e-12	0.7561
3. BF	A6TSM4	Elongation factor 4	1.97e-06	NA	2.27e-11	0.7049
3. BF	H9L427	50S ribosomal subunit assembly factor BipA	1.77e-05	NA	7.17e-13	0.6802
3. BF	Q7WD30	Elongation factor 4	1.49e-05	NA	1.39e-08	0.7659
3. BF	Q46GZ6	Elongation factor 4	2.14e-06	NA	3.82e-11	0.7515
3. BF	Q5WLR5	Elongation factor G	1.15e-05	NA	4.72e-10	0.3865
3. BF	Q89AC9	50S ribosomal subunit assembly factor BipA	6.65e-06	NA	2.89e-10	0.7072
3. BF	Q71ZJ1	Elongation factor 4	8.04e-06	NA	9.24e-11	0.749
3. BF	B2SRY0	Elongation factor 4	1.62e-06	NA	2.56e-08	0.759
3. BF	Q98N59	Elongation factor G	7.48e-05	NA	7.73e-07	0.5238
3. BF	B7MIQ4	Elongation factor 4	1.04e-06	NA	1.34e-09	0.7793
3. BF	P60790	Elongation factor 4	8.44e-06	NA	7.38e-09	0.7283
3. BF	Q97QK5	Elongation factor 4	8.80e-06	NA	2.76e-11	0.7465
3. BF	C1C5S8	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.845
3. BF	B3CLA3	Elongation factor G	5.35e-05	NA	5.67e-08	0.5473
3. BF	B3N6A5	Elongation factor G, mitochondrial	6.35e-04	NA	1.75e-10	0.5213
3. BF	B0TIV5	Elongation factor 4	1.33e-05	NA	2.16e-09	0.7637
3. BF	C1CCT8	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.848
3. BF	Q5FGX3	Translation initiation factor IF-2	0.00e+00	NA	8.49e-127	0.7914
3. BF	Q5LWL4	Translation initiation factor IF-2	0.00e+00	NA	2.03e-150	0.7963
3. BF	O25225	50S ribosomal subunit assembly factor BipA	3.02e-05	NA	3.01e-14	0.7249
3. BF	Q2JSB7	Translation initiation factor IF-2	0.00e+00	NA	5.90e-154	0.844
3. BF	P75544	Elongation factor G	2.72e-05	NA	7.97e-10	0.5701
3. BF	B0U3D5	Elongation factor 4	4.03e-06	NA	1.96e-08	0.7416
3. BF	Q9PPW7	Elongation factor G	6.63e-06	NA	1.85e-10	0.5605
3. BF	Q8EH83	Elongation factor 4	4.50e-05	NA	2.79e-12	0.7772
3. BF	O25122	Elongation factor 4	2.92e-06	NA	2.03e-05	0.7538
3. BF	B7NRM2	Elongation factor 4	9.27e-07	NA	1.14e-09	0.779
3. BF	A1W018	Elongation factor 4	2.74e-06	NA	2.40e-09	0.7736
3. BF	C5CC67	Elongation factor G	6.39e-05	NA	2.48e-09	0.5169
3. BF	Q1CUA6	Translation initiation factor IF-2	0.00e+00	NA	2.74e-145	0.8373
3. BF	B3R202	Elongation factor 4	3.39e-05	NA	1.45e-07	0.7456
3. BF	B5ZBD4	Elongation factor 4	2.25e-06	NA	1.39e-15	0.7335
3. BF	Q3IDL4	Elongation factor 4	9.87e-07	NA	3.69e-09	0.7328
3. BF	A9M5Q3	Elongation factor G	2.96e-05	NA	1.10e-09	0.5602
3. BF	Q2KDL5	Elongation factor 4	3.78e-06	NA	3.15e-08	0.7025
3. BF	B0SH18	Translation initiation factor IF-2	0.00e+00	NA	1.69e-146	0.7988
3. BF	A8H1C5	Elongation factor 4	1.42e-05	NA	2.16e-09	0.7636
3. BF	A5D2S0	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8153
3. BF	B1KZP1	Elongation factor 4	1.60e-06	NA	3.06e-10	0.6979
3. BF	A7HCF3	Elongation factor 4	1.87e-06	NA	1.08e-10	0.7202
3. BF	Q4FLL6	Elongation factor G	6.72e-06	NA	6.13e-08	0.5411
3. BF	C4ZYJ2	Elongation factor 4	1.79e-05	NA	1.14e-09	0.7793
3. BF	Q8XIS6	Elongation factor 4	7.32e-06	NA	1.94e-08	0.7304
3. BF	Q1GCH2	Translation initiation factor IF-2	0.00e+00	NA	1.62e-155	0.7945
3. BF	B6I5E3	Elongation factor 4	9.63e-07	NA	1.07e-09	0.7797
3. BF	A5GW13	Elongation factor G	1.14e-05	NA	4.18e-10	0.5458
3. BF	B5BAS8	Elongation factor 4	8.97e-07	NA	8.07e-09	0.7792
3. BF	Q9KD76	Elongation factor 4	1.12e-05	NA	1.55e-11	0.7325
3. BF	A2CBG9	Elongation factor 4	2.04e-06	NA	6.36e-10	0.7342
3. BF	B8I6E7	Translation initiation factor IF-2	0.00e+00	NA	4.60e-178	0.8379
3. BF	B1LFS0	Translation initiation factor IF-2	0.00e+00	NA	5.33e-153	0.8243
3. BF	Q83BK3	Elongation factor 4	1.19e-06	NA	7.11e-09	0.7554
3. BF	Q1GBM0	Elongation factor G	2.62e-05	NA	6.52e-09	0.5644
3. BF	B5RUN4	Ribosome-releasing factor 2, mitochondrial	3.70e-04	NA	2.95e-09	0.4713
3. BF	Q5PAX8	Elongation factor 4	1.49e-05	NA	2.98e-05	0.7617
3. BF	A5UBC2	Elongation factor 4	5.35e-05	NA	1.14e-10	0.7786
3. BF	Q318N4	Elongation factor G	1.07e-04	NA	4.76e-10	0.5495
3. BF	Q8K9H1	Translation initiation factor IF-2	0.00e+00	NA	6.28e-143	0.814
3. BF	Q48EV0	Elongation factor 4	1.11e-06	NA	1.00e-09	0.779
3. BF	A6QHC7	Elongation factor 4	2.20e-06	NA	2.11e-12	0.7124
3. BF	Q038N6	Elongation factor 4	9.85e-06	NA	2.73e-09	0.7742
3. BF	B4RVA8	Elongation factor 4	4.99e-05	NA	3.03e-09	0.7826
3. BF	Q3A6Q0	Elongation factor G 2	3.76e-05	NA	1.56e-08	0.5548
3. BF	Q98DV1	Elongation factor 4	9.42e-07	NA	1.49e-07	0.7242
3. BF	Q98BI8	Translation initiation factor IF-2	0.00e+00	NA	3.91e-159	0.8064
3. BF	Q92BN4	Elongation factor 4	1.07e-05	NA	1.59e-11	0.7529
3. BF	Q1JC06	Elongation factor 4	2.78e-06	NA	1.40e-10	0.7526
3. BF	A7H311	Elongation factor 4	2.66e-06	NA	2.29e-09	0.7581
3. BF	A9L5N4	Elongation factor 4	1.65e-06	NA	1.25e-11	0.7613
3. BF	A7GJ77	Elongation factor G	6.77e-06	NA	1.21e-09	0.5511
3. BF	O84444	Elongation factor G	8.06e-05	NA	1.24e-07	0.5522
3. BF	A4RZA6	Translation factor GUF1 homolog, chloroplastic	1.88e-06	NA	3.03e-12	0.7347
3. BF	B2I726	Translation initiation factor IF-2	0.00e+00	NA	1.18e-150	0.8165
3. BF	B1ZDQ8	Translation initiation factor IF-2	0.00e+00	NA	2.48e-147	0.8091
3. BF	Q72CI3	Elongation factor G	1.60e-05	NA	5.11e-08	0.5427
3. BF	C1FVU4	Elongation factor 4	1.45e-06	NA	9.29e-10	0.6983
3. BF	B9DNK4	Elongation factor 4	2.26e-06	NA	1.22e-10	0.7527
3. BF	A5V605	Elongation factor G	1.33e-04	NA	3.35e-06	0.5308
3. BF	A0QL36	Elongation factor G	5.05e-06	NA	2.41e-09	0.528
3. BF	Q49Y26	Elongation factor 4	1.61e-06	NA	5.03e-12	0.7459
3. BF	Q7VLI2	Translation initiation factor IF-2	0.00e+00	NA	3.93e-159	0.839
3. BF	A6L030	Translation initiation factor IF-2	0.00e+00	NA	8.01e-160	0.7794
3. BF	P0DB84	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8443
3. BF	P60789	Elongation factor 4	2.56e-06	NA	7.47e-09	0.7396
3. BF	Q824G0	Elongation factor G	3.72e-05	NA	1.10e-07	0.5239
3. BF	Q9ZF31	Translation initiation factor IF-2	0.00e+00	NA	3.44e-152	0.8272
3. BF	Q2GGA6	Elongation factor 4	1.51e-05	NA	1.08e-07	0.7472
3. BF	B7HPL8	Elongation factor 4	3.20e-06	NA	4.90e-12	0.7449
3. BF	A6TWI5	Elongation factor G	2.26e-05	NA	1.40e-08	0.3853
3. BF	A9WSW6	Elongation factor G	8.58e-06	NA	1.19e-08	0.4981
3. BF	B0U5X3	Elongation factor G	5.43e-05	NA	7.87e-08	0.5482
3. BF	Q15YP4	Elongation factor G 1	7.77e-06	NA	8.56e-07	0.5523
3. BF	B1AIW2	Elongation factor 4	2.20e-06	NA	5.93e-17	0.7353
3. BF	Q88XY8	Elongation factor G	5.19e-05	NA	4.22e-11	0.5522
3. BF	Q3J4P0	Elongation factor 4	1.07e-06	NA	6.34e-08	0.7412
3. BF	Q92QH2	Elongation factor G	2.60e-05	NA	2.65e-09	0.5337
3. BF	B3QZH4	Elongation factor G	4.91e-05	NA	1.89e-09	0.5682
3. BF	Q4AAQ6	Elongation factor G	9.20e-06	NA	1.54e-09	0.5467
3. BF	Q0AXN1	Elongation factor G 1	6.47e-05	NA	2.52e-09	0.5563
3. BF	Q1AU26	Elongation factor G	4.37e-05	NA	1.13e-05	0.5169
3. BF	A8F4Q8	Elongation factor G	8.38e-05	NA	3.16e-09	0.5547
3. BF	A1UBL0	Elongation factor G	6.07e-05	NA	2.41e-09	0.5228
3. BF	Q03FS3	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8193
3. BF	A4VUL8	Elongation factor 4	8.69e-06	NA	9.03e-11	0.6965
3. BF	B0RRB4	Translation initiation factor IF-2	0.00e+00	NA	4.95e-156	0.8201
3. BF	B4RSU5	Elongation factor G	9.05e-05	NA	1.03e-06	0.5431
3. BF	Q8FS85	Elongation factor G	6.33e-05	NA	7.70e-11	0.5324
3. BF	P0A3B4	50S ribosomal subunit assembly factor BipA	1.88e-05	NA	9.56e-13	0.7024
3. BF	Q8A2A1	Translation initiation factor IF-2	0.00e+00	NA	4.59e-156	0.8146
3. BF	B5XLC6	Elongation factor 4	1.10e-05	NA	1.70e-10	0.7018
3. BF	Q6G1F5	Elongation factor 4	2.42e-06	NA	8.25e-07	0.708
3. BF	B3Q991	Elongation factor 4	2.52e-06	NA	3.73e-07	0.7535
3. BF	A7Z0N4	Elongation factor G	1.09e-05	NA	2.79e-09	0.5508
3. BF	Q38W81	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8146
3. BF	Q2J2Y0	Elongation factor 4	2.29e-06	NA	9.70e-08	0.7548
3. BF	P37949	Elongation factor 4	3.20e-06	NA	5.29e-12	0.7354
3. BF	Q2IJ93	Elongation factor G 1	2.01e-05	NA	8.60e-08	0.5413
3. BF	B4GNT0	Ribosome-releasing factor 2, mitochondrial	8.99e-05	NA	0.003	0.3974
3. BF	B0DSK4	Elongation factor G, mitochondrial	1.47e-05	NA	5.72e-09	0.53
3. BF	A0PXU3	Elongation factor G	2.23e-05	NA	2.28e-08	0.5512
3. BF	Q8YP62	Elongation factor G	8.56e-05	NA	1.02e-08	0.5323
3. BF	Q057R2	Elongation factor 4	6.72e-07	NA	2.25e-07	0.7838
3. BF	Q0HG96	Elongation factor 4	1.39e-05	NA	3.13e-11	0.7653
3. BF	B5Z8J0	Elongation factor G	2.64e-05	NA	4.45e-08	0.5409
3. BF	Q7MHN6	Elongation factor 4	9.43e-07	NA	1.57e-10	0.7598
3. BF	A8F981	Elongation factor G	8.52e-06	NA	1.18e-09	0.563
3. BF	Q3A9R2	Elongation factor G	3.64e-05	NA	6.51e-09	0.391
3. BF	B2UAA3	Translation initiation factor IF-2	0.00e+00	NA	1.71e-162	0.8327
3. BF	A4Y4K2	Elongation factor 4	1.39e-05	NA	3.62e-12	0.7602
3. BF	B4JQM7	Elongation factor G, mitochondrial	5.54e-04	NA	9.70e-12	0.4987
3. BF	Q160Y3	Elongation factor G	1.18e-05	NA	2.80e-08	0.5036
3. BF	B2VI44	Elongation factor 4	9.08e-07	NA	1.18e-09	0.7787
3. BF	Q10W80	Elongation factor G 2	4.13e-05	NA	1.29e-05	0.5379
3. BF	Q2YJP8	Elongation factor 4	1.36e-06	NA	2.31e-08	0.6996
3. BF	A7X2Y7	Elongation factor 4	2.17e-06	NA	2.16e-12	0.7552
3. BF	Q0AWL9	Elongation factor 4	2.48e-06	NA	2.88e-08	0.726
3. BF	B7GKC4	Elongation factor 4	6.42e-06	NA	1.40e-14	0.7799
3. BF	A6Q1M7	Elongation factor G	2.57e-05	NA	5.57e-09	0.5447
3. BF	A6GWV8	Translation initiation factor IF-2	0.00e+00	NA	7.45e-162	0.8056
3. BF	A8GMT1	Elongation factor 4	9.46e-06	NA	1.60e-05	0.7205
3. BF	B0USR9	Elongation factor 4	1.20e-05	NA	6.71e-10	0.7776
3. BF	A0KGF0	Elongation factor 4	2.50e-05	NA	9.60e-12	0.7822
3. BF	A3PV95	Elongation factor G	6.71e-05	NA	2.41e-09	0.5229
3. BF	Q4A5S3	Elongation factor 4	3.70e-06	NA	5.42e-14	0.7402
3. BF	A5VJE9	Elongation factor 4	8.70e-06	NA	6.70e-09	0.7391
3. BF	Q87C09	Elongation factor 4	3.79e-06	NA	1.92e-08	0.7415
3. BF	Q5NEF8	Elongation factor 4	1.90e-06	NA	8.45e-09	0.7371
3. BF	B2A4D6	Elongation factor G	4.14e-06	NA	2.69e-07	0.5349
3. BF	B3PYC6	Elongation factor 4	3.84e-06	NA	5.20e-08	0.6991
3. BF	Q5NLP5	Elongation factor 4	3.21e-06	NA	1.29e-07	0.7348
3. BF	Q0VP16	Elongation factor 4	1.56e-05	NA	2.08e-07	0.7746
3. BF	Q7MA53	Elongation factor G	3.94e-05	NA	5.58e-08	0.5621
3. BF	B4TS16	Elongation factor 4	8.91e-07	NA	8.14e-09	0.7785
3. BF	B2HWQ2	Elongation factor 4	3.14e-05	NA	1.74e-05	0.7636
3. BF	Q31W47	Translation initiation factor IF-2	0.00e+00	NA	2.96e-153	0.8088
3. BF	Q3SWP9	Translation initiation factor IF-2	0.00e+00	NA	1.18e-149	0.8207
3. BF	C1CJ39	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8462
3. BF	Q1BDD4	Elongation factor G	6.47e-05	NA	2.41e-09	0.5318
3. BF	Q2J728	Translation initiation factor IF-2	0.00e+00	NA	5.22e-150	0.8037
3. BF	A3PBD8	Elongation factor 4	2.01e-06	NA	8.10e-09	0.7332
3. BF	Q2NS11	Elongation factor 4	9.11e-07	NA	6.77e-10	0.7768
3. BF	Q0K9B9	Translation initiation factor IF-2	0.00e+00	NA	9.08e-167	0.7887
3. BF	Q7W5J4	Elongation factor 4	6.70e-07	NA	1.39e-08	0.7733
3. BF	A9MGX5	Elongation factor 4	9.14e-07	NA	8.50e-09	0.7791
3. BF	Q9PQG7	Elongation factor 4	2.20e-06	NA	5.93e-17	0.735
3. BF	P0A1W4	Elongation factor 4	8.99e-07	NA	8.14e-09	0.7779
3. BF	A5N4P4	Elongation factor G	7.80e-06	NA	6.60e-08	0.5525
3. BF	Q03M88	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8424
3. BF	B7GYS7	Elongation factor 4	5.00e-06	NA	1.74e-05	0.7644
3. BF	Q1BXU3	Elongation factor 4	4.04e-06	NA	4.66e-08	0.7343
3. BF	B2RHM9	Translation initiation factor IF-2	0.00e+00	NA	1.09e-161	0.8195
3. BF	C4Z9E3	Elongation factor 4	5.15e-06	NA	9.31e-09	0.7086
3. BF	B7MYK1	Elongation factor 4	1.01e-06	NA	1.34e-09	0.7779
3. BF	D1ZET3	Translation factor GUF1, mitochondrial	4.93e-05	NA	5.07e-05	0.6989
3. BF	A4IR35	Elongation factor 4	2.83e-06	NA	9.26e-13	0.7375
3. BF	Q8DI43	Elongation factor G	7.65e-06	NA	3.15e-09	0.5342
3. BF	Q7UE01	Elongation factor 4 2	5.19e-06	NA	1.89e-12	0.7521
3. BF	P13551	Elongation factor G	7.02e-06	NA	7.31e-07	0.5787
3. BF	A4SCQ6	Elongation factor G	3.51e-05	NA	2.61e-08	0.5255
3. BF	Q1IV51	Elongation factor 4	2.71e-06	NA	2.19e-09	0.7659
3. BF	B5ZC32	Elongation factor G	6.65e-06	NA	1.83e-10	0.5455
3. BF	A4XBP9	Elongation factor G	2.46e-05	NA	1.58e-08	0.5317
3. BF	C0PZ54	Translation initiation factor IF-2	0.00e+00	NA	3.44e-152	0.8236
3. BF	A7MZB0	Elongation factor 4	9.14e-07	NA	1.36e-12	0.7792
3. BF	A5E866	Translation initiation factor IF-2	0.00e+00	NA	4.87e-153	0.8222
3. BF	Q3AMT5	Elongation factor G	1.13e-04	NA	6.33e-10	0.5506
3. BF	Q7NY13	Translation initiation factor IF-2	0.00e+00	NA	1.73e-159	0.811
3. BF	B9E6X5	Elongation factor 4	6.49e-06	NA	1.02e-12	0.7451
3. BF	B5FRC7	Elongation factor 4	8.93e-07	NA	8.14e-09	0.7778
3. BF	P74751	Elongation factor 4	2.01e-06	NA	1.70e-10	0.735
3. BF	A2BT84	Elongation factor G	1.08e-04	NA	4.14e-10	0.5479
3. BF	B8ZSC2	Elongation factor G	7.57e-06	NA	3.87e-09	0.5612
3. BF	Q39SN2	Elongation factor G 2	7.69e-05	NA	1.56e-07	0.5174
3. BF	A9BE39	Elongation factor 4	1.81e-06	NA	4.08e-10	0.7365
3. BF	Q02Z80	Elongation factor 4	8.05e-06	NA	1.50e-09	0.7361
3. BF	Q9PJV6	Elongation factor G	2.85e-05	NA	1.37e-07	0.5325
3. BF	Q0BP65	Elongation factor 4	1.53e-06	NA	1.91e-08	0.7372
3. BF	B8D953	Elongation factor 4	1.05e-06	NA	2.99e-08	0.7694
3. BF	A9N944	Elongation factor 4	1.15e-06	NA	7.11e-09	0.7306
3. BF	P75498	Elongation factor 4	1.23e-06	NA	7.73e-11	0.7458
3. BF	A8MLD7	Elongation factor G	1.51e-05	NA	1.69e-08	0.3861
3. BF	Q9X1Y4	Elongation factor G-like protein	7.20e-06	NA	4.26e-04	0.5792
3. BF	B1HMZ1	Elongation factor G	6.01e-06	NA	7.21e-10	0.5683
3. BF	A7FXL9	Elongation factor 4	1.70e-06	NA	1.28e-09	0.6987
3. BF	A8AVQ2	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8473
3. BF	Q2G550	Elongation factor 4	7.38e-06	NA	1.13e-06	0.7333
3. BF	C1C7G9	Elongation factor 4	5.15e-06	NA	2.76e-11	0.7149
3. BF	A9VP74	Elongation factor G	1.11e-05	NA	1.85e-09	0.5571
3. BF	B6JN34	Elongation factor G	2.57e-05	NA	4.42e-08	0.555
3. BF	Q6F9B9	Elongation factor 4	1.55e-06	NA	1.05e-05	0.7601
3. BF	Q1CUF5	Elongation factor 4	3.84e-06	NA	5.05e-07	0.7608
3. BF	Q47WP3	Elongation factor 4	9.50e-07	NA	6.82e-09	0.7568
3. BF	B1KSM8	Elongation factor G	1.38e-05	NA	4.75e-10	0.5389
3. BF	Q2GJ60	Elongation factor G	5.48e-05	NA	1.69e-07	0.5521
3. BF	B5F1G3	Elongation factor 4	9.54e-07	NA	8.14e-09	0.7801
3. BF	Q62LT1	Elongation factor 4	1.05e-05	NA	5.27e-09	0.7525
3. BF	Q8E3E7	Elongation factor G	5.30e-05	NA	6.80e-09	0.5523
3. BF	Q8Y421	Elongation factor G	2.49e-05	NA	3.89e-09	0.5508
3. BF	Q46IW3	Elongation factor G	1.09e-04	NA	1.26e-10	0.5456
3. BF	C0SHD5	Translation factor GUF1, mitochondrial	1.67e-05	NA	2.12e-06	0.7161
3. BF	Q87M30	Elongation factor G 2	6.81e-05	NA	8.30e-06	0.554
3. BF	Q6FZB9	Elongation factor G	2.62e-05	NA	2.26e-09	0.5358
3. BF	C5BRN3	Elongation factor 4	1.39e-05	NA	3.39e-09	0.7806
3. BF	B4F049	Elongation factor 4	1.10e-06	NA	1.35e-08	0.7795
3. BF	C0MDV7	Elongation factor 4	6.88e-06	NA	1.34e-11	0.7327
3. BF	B7N0V3	Translation initiation factor IF-2	0.00e+00	NA	3.47e-153	0.8266
3. BF	B3ELN8	Translation initiation factor IF-2	0.00e+00	NA	3.11e-160	0.8017
3. BF	A1S462	Translation initiation factor IF-2	0.00e+00	NA	2.46e-160	0.8273
3. BF	C0MDY5	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8412
3. BF	A4T1R3	Elongation factor G	6.47e-05	NA	1.34e-09	0.5224
3. BF	Q2KWY3	Elongation factor 4	1.06e-06	NA	1.44e-09	0.7764
3. BF	A3DF29	Elongation factor 4	1.83e-06	NA	1.16e-10	0.7257
3. BF	B4R8L3	Elongation factor G	2.56e-05	NA	3.47e-09	0.5394
3. BF	B0VE81	Translation initiation factor IF-2	0.00e+00	NA	1.21e-162	0.8367
3. BF	Q5HB61	Translation initiation factor IF-2	0.00e+00	NA	2.03e-126	0.7925
3. BF	A4YJE9	Translation initiation factor IF-2	0.00e+00	NA	2.13e-153	0.8173
3. BF	Q01SV7	Elongation factor 4	1.05e-06	NA	1.03e-08	0.7752
3. BF	P65273	Elongation factor 4	2.25e-06	NA	4.67e-11	0.7322
3. BF	A0LE19	Translation initiation factor IF-2	0.00e+00	NA	2.43e-169	0.828
3. BF	Q5XAH1	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8438
3. BF	Q038M5	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8222
3. BF	Q30XI4	Elongation factor 4	1.58e-05	NA	4.94e-11	0.7434
3. BF	Q5M5V5	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8455
3. BF	C3P8M5	Elongation factor 4	7.33e-06	NA	5.44e-12	0.756
3. BF	A7IEG8	Elongation factor 4	3.88e-06	NA	5.95e-06	0.7664
3. BF	Q92IQ1	Elongation factor 4	8.89e-06	NA	2.40e-06	0.723
3. BF	B4MZW9	Elongation factor G, mitochondrial	3.19e-04	NA	1.97e-10	0.5129
3. BF	Q67JU0	Elongation factor G	3.41e-06	NA	1.73e-08	0.3838
3. BF	B1YGU7	Elongation factor G	1.01e-05	NA	6.55e-10	0.5414
3. BF	B2I2M7	Translation initiation factor IF-2	0.00e+00	NA	1.21e-162	0.8327
3. BF	Q0HSI9	Elongation factor 4	4.51e-05	NA	3.13e-11	0.7803
3. BF	P65272	Elongation factor 4	2.21e-06	NA	2.16e-12	0.7664
3. BF	A5D3X6	Elongation factor 4	2.82e-06	NA	1.76e-10	0.7182
3. BF	Q9X764	Translation initiation factor IF-2	0.00e+00	NA	9.87e-179	0.8416
3. BF	P0A3B3	50S ribosomal subunit assembly factor BipA	3.22e-05	NA	9.56e-13	0.7055
3. BF	Q8NWA7	Elongation factor 4	2.24e-06	NA	2.20e-12	0.7229
3. BF	C4L433	Elongation factor 4	2.38e-06	NA	1.44e-12	0.7402
3. BF	A7Z6W5	Elongation factor 4	5.83e-06	NA	2.09e-11	0.7504
3. BF	A2QI77	Elongation factor G, mitochondrial	1.69e-03	NA	3.55e-06	0.4985
3. BF	A2CC86	Elongation factor G	1.37e-04	NA	6.69e-11	0.5493
3. BF	B9DVB7	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8461
3. BF	Q046C7	Elongation factor G	4.38e-05	NA	2.11e-09	0.5684
3. BF	B7I3R9	Translation initiation factor IF-2	0.00e+00	NA	1.21e-162	0.8321
3. BF	Q07KL5	Elongation factor G	2.57e-05	NA	4.41e-09	0.5694
3. BF	Q11PK5	Translation initiation factor IF-2	0.00e+00	NA	1.09e-162	0.8087
3. BF	B6I1P3	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	0.8096
3. BF	B1XK44	Elongation factor 4	5.90e-07	NA	1.29e-09	0.7307
3. BF	Q5WHG5	Elongation factor 4	6.60e-06	NA	3.61e-09	0.7487
3. BF	Q5HNW2	Elongation factor 4	6.82e-06	NA	1.76e-11	0.7444
3. BF	A9KF98	Elongation factor 4	1.20e-06	NA	1.70e-09	0.7344
3. BF	O87844	Elongation factor G 2	6.15e-05	NA	3.06e-07	0.5394
3. BF	B2WBM8	Elongation factor G, mitochondrial	1.44e-04	NA	9.15e-08	0.5087
3. BF	Q5YSC6	Translation initiation factor IF-2	0.00e+00	NA	1.87e-158	0.8167
3. BF	A1AE99	Elongation factor 4	9.63e-07	NA	1.34e-09	0.7799
3. BF	A9VHU6	Elongation factor 4	3.03e-06	NA	4.80e-13	0.7511
3. BF	B0RX30	Elongation factor 4	3.03e-06	NA	2.30e-08	0.7476
3. BF	A4XKA0	Elongation factor 4	4.61e-06	NA	1.70e-11	0.7234
3. BF	B9JVN4	Elongation factor G	4.66e-05	NA	5.13e-10	0.5319
3. BF	B7J9J8	Elongation factor 4	8.65e-07	NA	4.59e-10	0.7462
3. BF	C6E2Q0	Translation initiation factor IF-2	0.00e+00	NA	5.83e-178	0.8164
3. BF	Q0TER9	Elongation factor 4	8.30e-07	NA	1.14e-09	0.7792
3. BF	Q07V78	Translation initiation factor IF-2	0.00e+00	NA	2.72e-154	0.8141
3. BF	Q1I5V6	Elongation factor 4	1.18e-06	NA	5.41e-10	0.7538
3. BF	P59587	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	0.8247
3. BF	Q8NZU7	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8466
3. BF	Q8GCP5	Elongation factor 4	3.21e-06	NA	2.88e-09	0.7438
3. BF	Q67S76	Elongation factor 4	2.39e-06	NA	3.95e-09	0.7632
3. BF	Q0I4Z1	Elongation factor 4	9.53e-07	NA	6.71e-10	0.7754
3. BF	Q5M4M2	Elongation factor 4	4.05e-06	NA	6.73e-12	0.7
3. BF	Q92SU3	Elongation factor 4	4.22e-06	NA	3.55e-08	0.7136
3. BF	Q4UKS2	Elongation factor 4	1.01e-05	NA	6.77e-06	0.7151
3. BF	Q5E312	Elongation factor 4	9.44e-07	NA	8.57e-12	0.766
3. BF	B7UYX5	Elongation factor 4	1.32e-06	NA	7.39e-08	0.717
3. BF	B7J464	Elongation factor G	5.96e-05	NA	4.63e-08	0.529
3. BF	Q1J5B4	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8444
3. BF	Q68X95	Elongation factor 4	8.67e-06	NA	1.66e-05	0.7216
3. BF	A2R994	Ribosome-releasing factor 2, mitochondrial	1.72e-04	NA	1.85e-08	0.3825
3. BF	Q31HP5	Elongation factor 4	1.65e-06	NA	2.90e-07	0.7576
3. BF	B5XHV3	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8458
3. BF	B3R1E4	Translation initiation factor IF-2	0.00e+00	NA	3.91e-167	0.8246
3. BF	B5ZXQ5	Elongation factor 4	4.23e-06	NA	5.20e-08	0.7086
3. BF	Q493T7	Translation initiation factor IF-2	0.00e+00	NA	1.37e-148	0.8087
3. BF	P0A3K7	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8449
3. BF	B2V7L6	Elongation factor G	4.94e-05	NA	3.66e-06	0.3877
3. BF	P0A3B2	50S ribosomal subunit assembly factor BipA	3.21e-05	NA	9.56e-13	0.7147
3. BF	A8YVQ1	Elongation factor 4	8.93e-06	NA	1.15e-05	0.725
3. BF	Q1MIE4	Elongation factor G	3.95e-05	NA	3.99e-10	0.535
3. BF	B8IMT0	Elongation factor 4	9.53e-07	NA	3.17e-08	0.7522
3. BF	B0S0I4	Elongation factor G	4.12e-06	NA	2.34e-09	0.5439
3. BF	Q18CF4	Elongation factor G	5.97e-06	NA	8.48e-09	0.5461
3. BF	A0KZN4	Elongation factor 4	2.42e-05	NA	3.24e-11	0.7774
3. BF	B1IA80	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8441
3. BF	B0Y604	Elongation factor G, mitochondrial	1.27e-03	NA	1.95e-06	0.5012
3. BF	C4JWU3	Translation factor GUF1, mitochondrial	2.29e-05	NA	4.87e-07	0.7147
3. BF	A8AWG3	Elongation factor 4	8.84e-06	NA	4.26e-11	0.7152
3. BF	A9IW31	Elongation factor G	2.66e-05	NA	1.91e-09	0.5271
3. BF	Q0HXR5	Translation initiation factor IF-2	0.00e+00	NA	3.03e-157	0.7523
3. BF	A8LC59	Elongation factor G	2.03e-05	NA	2.64e-08	0.5295
3. BF	A7ZCJ3	Elongation factor 4	2.70e-06	NA	2.60e-11	0.7705
3. BF	A5ITB2	Elongation factor 4	2.20e-06	NA	2.16e-12	0.7452
3. BF	B1VAM2	Elongation factor G	2.65e-05	NA	9.24e-08	0.5478
3. BF	B7LUZ5	Elongation factor 4	8.39e-07	NA	1.14e-09	0.7803
3. BF	Q730L6	Elongation factor 4	6.52e-06	NA	4.57e-12	0.7596
3. BF	A4VIX2	Elongation factor 4	1.24e-06	NA	5.18e-08	0.7709
3. BF	B4T6Z8	Translation initiation factor IF-2	0.00e+00	NA	3.44e-152	0.8276
3. BF	B3QBY3	Elongation factor G	2.62e-05	NA	4.56e-09	0.5635
3. BF	A1VYJ8	Elongation factor G	2.99e-05	NA	1.65e-07	0.5611
3. BF	B8D867	Peptide chain release factor 3	1.18e-05	NA	3.26e-09	0.5596
3. BF	B0SQH4	Translation initiation factor IF-2	0.00e+00	NA	1.69e-146	0.7936
3. BF	B1MGH8	Elongation factor G	7.69e-05	NA	3.20e-09	0.5213
3. BF	Q0TMP3	Elongation factor G	2.25e-05	NA	2.08e-08	0.3869
3. BF	Q4FNH3	Elongation factor 4	7.59e-07	NA	1.62e-05	0.7781
3. BF	A2RM37	Translation initiation factor IF-2	0.00e+00	NA	8.39e-180	0.8458
3. BF	P57348	Elongation factor 4	1.20e-06	NA	5.11e-08	0.7659
3. BF	B1JYB1	Elongation factor 4	2.73e-06	NA	4.66e-08	0.7589
3. BF	Q2GGQ8	Translation initiation factor IF-2	0.00e+00	NA	2.40e-130	0.8028
3. BF	P55875	Translation initiation factor IF-2	0.00e+00	NA	2.27e-144	0.8189
3. BF	Q1MQF3	Elongation factor 4	8.52e-06	NA	4.24e-10	0.7335
3. BF	Q8PB55	Elongation factor 4	3.46e-06	NA	1.97e-08	0.7445
3. BF	Q8EX19	Elongation factor G	2.81e-05	NA	1.57e-10	0.5755
3. BF	A1B023	Elongation factor G	8.51e-05	NA	2.77e-07	0.5177
3. BF	A9III9	Elongation factor 4	9.89e-07	NA	4.24e-12	0.7618
3. BF	B3PWR8	Elongation factor G	5.58e-05	NA	3.08e-10	0.544
3. BF	B1YKS5	Elongation factor 4	4.03e-06	NA	2.54e-13	0.7642
3. BF	B8G1W3	Elongation factor G	5.91e-05	NA	1.05e-07	0.5495
3. BF	A6VAK9	Elongation factor 4	1.32e-06	NA	7.52e-08	0.7481
3. BF	Q9KPB0	Elongation factor 4	1.01e-06	NA	3.29e-12	0.7663
3. BF	B6JKS8	Elongation factor 4	1.40e-06	NA	2.23e-07	0.7597
3. BF	Q2JWR1	Elongation factor 4	1.73e-06	NA	6.43e-11	0.7353
3. BF	Q83JF9	Translation initiation factor IF-2	0.00e+00	NA	2.96e-153	0.8141
3. BF	Q14FW1	Elongation factor 4	1.90e-06	NA	8.45e-09	0.7481
3. BF	Q608M4	Elongation factor 4	8.99e-07	NA	9.69e-10	0.7544
3. BF	P0A3B1	50S ribosomal subunit assembly factor BipA	1.82e-05	NA	9.56e-13	0.7028
3. BF	Q03EB4	Elongation factor G	4.24e-05	NA	3.01e-09	0.5338
3. BF	B4SCE7	Translation initiation factor IF-2	0.00e+00	NA	1.12e-158	0.808
3. BF	A5FJF9	Translation initiation factor IF-2	0.00e+00	NA	2.67e-169	0.8063
3. BF	Q2HEK0	Elongation factor G, mitochondrial	9.35e-04	NA	1.18e-05	0.3821
3. BF	P60787	Elongation factor 4	9.20e-07	NA	1.14e-09	0.779
3. BF	B1LWS3	Elongation factor G	5.31e-05	NA	8.13e-10	0.5394
3. BF	A6QLJ3	Translation factor GUF1, mitochondrial	3.18e-05	NA	2.55e-11	0.7493
3. BF	A7MH13	Elongation factor 4	9.47e-07	NA	1.34e-11	0.7778
3. BF	Q7S0P6	Translation factor guf1, mitochondrial	7.19e-05	NA	4.09e-05	0.6351
3. BF	B2IME4	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.849
3. BF	Q1MMQ8	Elongation factor 4	3.94e-06	NA	2.65e-08	0.7095
3. BF	Q134S6	Elongation factor G	2.31e-05	NA	4.85e-09	0.5695
3. BF	Q1JAC1	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8447
3. BF	B1JRC5	Elongation factor 4	8.63e-07	NA	2.16e-10	0.781
3. BF	B9K883	Elongation factor G	8.34e-05	NA	4.58e-09	0.5248
3. BF	P44910	50S ribosomal subunit assembly factor BipA	2.39e-05	NA	1.20e-12	0.6696
3. BF	Q8DVV4	Elongation factor G	2.94e-05	NA	5.72e-09	0.3917
3. BF	Q21M87	Elongation factor G 2	2.90e-05	NA	2.43e-06	0.5387
3. BF	C1KZK7	Elongation factor G	2.80e-05	NA	3.89e-09	0.5656
3. BF	Q81LR7	Elongation factor 4	3.09e-06	NA	5.44e-12	0.7554
3. BF	B4NZM7	Elongation factor G, mitochondrial	5.32e-04	NA	1.82e-10	0.52
3. BF	B0TAD2	Elongation factor 4	1.50e-06	NA	6.82e-11	0.7458
3. BF	Q87LN7	Elongation factor 4	1.14e-06	NA	5.18e-11	0.7491
3. BF	Q21C31	Translation initiation factor IF-2	0.00e+00	NA	3.30e-155	0.8211
3. BF	B1XI09	Translation initiation factor IF-2	0.00e+00	NA	2.53e-160	0.8269
3. BF	A1AWP9	Elongation factor 4	1.22e-06	NA	1.42e-09	0.7793
3. BF	Q3A834	Elongation factor G 1	4.31e-05	NA	9.75e-08	0.5255
3. BF	B1IGF7	Elongation factor G	4.44e-06	NA	1.21e-09	0.5483
3. BF	A0L5X0	Elongation factor G	2.08e-05	NA	1.11e-08	0.3816
3. BF	B9L7K0	Elongation factor G	2.31e-05	NA	1.07e-08	0.3869
3. BF	B2IK59	Elongation factor G	1.03e-04	NA	9.25e-10	0.5375
3. BF	A5CWJ4	Elongation factor 4	7.89e-07	NA	1.60e-09	0.7673
3. BF	Q5FJP6	Elongation factor 4	1.11e-05	NA	9.79e-08	0.749
3. BF	Q38W39	Elongation factor 4	9.67e-06	NA	1.47e-10	0.7524
3. BF	Q487Z1	Elongation factor G 1	6.56e-05	NA	1.09e-05	0.5312
3. BF	B7UH09	Elongation factor 4	9.72e-07	NA	1.34e-09	0.7794
3. BF	B3CTE7	Elongation factor G	3.87e-05	NA	3.81e-07	0.3717
3. BF	Q4ZPD8	Elongation factor 4	1.29e-06	NA	4.78e-10	0.7379
3. BF	B7I580	Elongation factor 4	1.57e-06	NA	1.74e-05	0.7604
3. BF	Q5FHQ1	Elongation factor 4	1.06e-06	NA	4.86e-07	0.7633
3. BF	B7HCU5	Elongation factor 4	2.97e-06	NA	4.49e-12	0.7426
3. BF	Q9RV84	Elongation factor 4	2.46e-06	NA	2.80e-09	0.7109
3. BF	A1BDF1	Translation initiation factor IF-2	0.00e+00	NA	1.91e-168	0.8049
3. BF	P65271	Elongation factor 4	2.99e-06	NA	2.16e-12	0.7655
3. BF	B3CRQ1	Elongation factor 4	2.65e-06	NA	3.54e-07	0.7704
3. BF	Q0A797	Translation initiation factor IF-2	0.00e+00	NA	4.43e-164	0.7926
3. BF	Q73R08	Elongation factor G 1	1.34e-04	NA	4.08e-10	0.5599
3. BF	Q74L90	Elongation factor G	6.59e-05	NA	1.62e-09	0.5512
3. BF	B2SC25	Elongation factor 4	1.13e-06	NA	2.31e-08	0.699
3. BF	Q8KQB3	Elongation factor G	2.72e-05	NA	1.95e-09	0.5278
3. BF	Q8Z3H7	Translation initiation factor IF-2	0.00e+00	NA	5.33e-152	0.8374
3. BF	Q7NWC7	Elongation factor 4	1.18e-06	NA	1.72e-08	0.7565
3. BF	Q65VN2	Elongation factor 4	5.30e-05	NA	6.57e-12	0.765
3. BF	Q9PBA1	Elongation factor 4	3.61e-06	NA	2.04e-08	0.742
3. BF	Q01W89	Elongation factor G	3.92e-06	NA	2.40e-07	0.5332
3. BF	B2SVK3	Translation initiation factor IF-2	0.00e+00	NA	7.97e-155	0.8199
3. BF	Q6F0Z2	Elongation factor 4	3.79e-06	NA	1.72e-12	0.7153
3. BF	A8GW16	Elongation factor 4	8.57e-06	NA	1.24e-05	0.7204
3. BF	Q0T1T6	Elongation factor 4	9.14e-07	NA	1.14e-09	0.7796
3. BF	A5VVU4	Elongation factor 4	1.37e-06	NA	2.41e-08	0.6991
3. BF	Q7MI49	Elongation factor G 2	3.07e-05	NA	3.45e-06	0.5549
3. BF	Q97S57	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8467
3. BF	Q8R7V1	Elongation factor G	1.03e-05	NA	2.29e-08	0.5509
3. BF	Q04LW0	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8459
3. BF	B3EUG6	Translation initiation factor IF-2	0.00e+00	NA	5.42e-159	0.7821
3. BF	A4J080	Elongation factor 4	1.94e-06	NA	5.77e-09	0.7519
3. BF	Q3YS01	Translation initiation factor IF-2	0.00e+00	NA	2.95e-127	0.7987
3. BF	Q99ZV8	Elongation factor 4	1.06e-05	NA	1.66e-10	0.7328
3. BF	Q7NGX4	Elongation factor 4	1.84e-06	NA	1.76e-09	0.7311
3. BF	C4LBZ6	Elongation factor 4	9.29e-07	NA	1.51e-11	0.7784
3. BF	Q5YPG3	Elongation factor G	7.55e-05	NA	2.37e-09	0.5102
3. BF	Q02HR9	Elongation factor 4	1.08e-06	NA	7.39e-08	0.7608
3. BF	Q8KTB4	Elongation factor G	8.67e-05	NA	2.60e-08	0.5407
3. BF	B4SQS0	Translation initiation factor IF-2	0.00e+00	NA	6.95e-151	0.8134
3. BF	Q1GIV5	Elongation factor 4	3.69e-06	NA	8.23e-07	0.7621
3. BF	Q11BC8	Translation initiation factor IF-2	0.00e+00	NA	5.23e-167	0.8077
3. BF	C1FMV4	Elongation factor G	2.73e-05	NA	4.75e-10	0.5442
3. BF	B6JKX5	Translation initiation factor IF-2	0.00e+00	NA	3.40e-145	0.8124
3. BF	Q5HC12	Elongation factor G	9.16e-06	NA	1.37e-07	0.5494
3. BF	A9N732	Translation initiation factor IF-2	0.00e+00	NA	3.44e-152	0.8256
3. BF	A4XSC1	Elongation factor 4	1.21e-06	NA	9.25e-10	0.7996
3. BF	A8G3D2	Elongation factor 4	1.74e-06	NA	6.93e-09	0.733
3. BF	C4KZQ0	Elongation factor G	5.49e-05	NA	6.22e-10	0.5439
3. BF	B5Z143	Elongation factor 4	1.25e-05	NA	1.14e-09	0.7791
3. BF	B2SZV7	Elongation factor 4	1.02e-06	NA	1.15e-08	0.765
3. BF	P60786	Elongation factor 4	9.65e-07	NA	1.14e-09	0.7798
3. BF	B4SBG4	Elongation factor 4	4.22e-06	NA	8.35e-07	0.7226
3. BF	C5BPV9	Translation initiation factor IF-2	0.00e+00	NA	6.95e-147	0.8253
3. BF	Q10XM3	Translation initiation factor IF-2	0.00e+00	NA	2.08e-164	0.8789
3. BF	C0NZL9	Translation factor GUF1, mitochondrial	2.76e-05	NA	2.65e-06	0.7043
3. BF	B4T1G0	Elongation factor 4	8.91e-07	NA	8.14e-09	0.7789
3. BF	C1DQS0	Elongation factor 4	1.08e-06	NA	8.49e-08	0.7457
3. BF	B4SKW0	Elongation factor G	3.12e-05	NA	7.26e-08	0.5517
3. BF	A5N6L8	Elongation factor 4	4.60e-06	NA	9.77e-08	0.7301
3. BF	Q4JT40	Elongation factor G	5.33e-05	NA	2.65e-10	0.5305
3. BF	Q030K2	Translation initiation factor IF-2	0.00e+00	NA	7.95e-180	0.8353
3. BF	A5VB59	Elongation factor 4	1.02e-05	NA	1.67e-08	0.738
3. BF	Q3IJW9	Elongation factor G 2	9.67e-05	NA	7.92e-07	0.551
3. BF	Q17X87	Elongation factor 4	9.60e-07	NA	2.72e-06	0.7544
3. BF	C3L3H1	Elongation factor 4	1.50e-06	NA	2.74e-09	0.6977
3. BF	P57806	Elongation factor 4	1.60e-05	NA	4.44e-11	0.7632
3. BF	Q1IXW5	Elongation factor 4	2.20e-06	NA	2.50e-08	0.7205
3. BF	Q63S94	Elongation factor 4	1.61e-05	NA	5.27e-09	0.7534
3. BF	Q8UIQ2	Elongation factor 4	2.36e-06	NA	3.58e-08	0.7349
3. BF	Q4KHT3	Elongation factor 4	1.38e-06	NA	1.54e-09	0.7545
3. BF	C1ESL3	Elongation factor 4	6.77e-06	NA	4.65e-12	0.756
3. BF	A8M746	Translation initiation factor IF-2	0.00e+00	NA	4.96e-158	0.8094
3. BF	Q0AFJ3	Translation initiation factor IF-2	0.00e+00	NA	1.05e-152	0.8206
3. BF	Q29N77	Elongation factor G, mitochondrial	1.06e-03	NA	5.10e-12	0.5179
3. BF	Q6LST1	Elongation factor G 2	8.34e-05	NA	4.70e-06	0.5583
3. BF	B6QW35	Translation factor guf1, mitochondrial	3.23e-05	NA	4.54e-07	0.7271
3. BF	A7EVV9	Elongation factor G, mitochondrial	1.62e-04	NA	1.79e-06	0.5191
3. BF	Q1WUE6	Elongation factor 4	8.66e-06	NA	1.07e-10	0.7361
3. BF	B3MK91	Elongation factor G, mitochondrial	3.14e-04	NA	1.66e-10	0.5113
3. BF	Q89WA9	Translation initiation factor IF-2	0.00e+00	NA	2.89e-153	0.8172
3. BF	A8YXK3	Elongation factor G	4.24e-05	NA	1.79e-09	0.5442
3. BF	B0BWV5	Elongation factor 4	8.86e-06	NA	1.27e-05	0.7371
3. BF	Q89J81	Elongation factor G	2.30e-05	NA	1.22e-08	0.3963
3. BF	A2BYN5	Elongation factor G	1.35e-05	NA	3.80e-10	0.5502
3. BF	Q5LY21	Elongation factor G	2.39e-05	NA	4.42e-09	0.3869
3. BF	A2RD01	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8453
3. BF	B5EQB5	Elongation factor 4	8.15e-07	NA	4.59e-10	0.7458
3. BF	C1KVC6	Elongation factor 4	8.19e-06	NA	9.24e-11	0.749
3. BF	Q6LMS0	Elongation factor 4	9.36e-07	NA	2.75e-09	0.7814
3. BF	Q6C255	Translation factor GUF1, mitochondrial	1.34e-05	NA	5.11e-05	0.6908
3. BF	B6EKN1	Elongation factor 4	1.07e-06	NA	2.10e-11	0.7395
3. BF	Q3B1Z8	Translation initiation factor IF-2	0.00e+00	NA	5.74e-164	0.801
3. BF	C3K6G8	Elongation factor 4	1.34e-06	NA	1.29e-10	0.7302
3. BF	Q5LMR4	Elongation factor G	2.67e-05	NA	2.68e-09	0.5316
3. BF	B0BC74	Elongation factor G	2.89e-05	NA	1.25e-07	0.5578
3. BF	B8ZM93	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.845
3. BF	Q6NCN5	Translation initiation factor IF-2	0.00e+00	NA	5.97e-156	0.8178
3. BF	A1RMC9	Elongation factor 4	1.39e-05	NA	2.26e-12	0.7601
3. BF	Q5FUC2	Elongation factor 4	2.69e-06	NA	1.16e-08	0.7481
3. BF	B7IYH2	Elongation factor 4	2.85e-06	NA	4.49e-12	0.7622
3. BF	Q8FV17	Elongation factor 4	1.15e-06	NA	2.41e-08	0.7275
3. BF	Q6FUQ6	Elongation factor G, mitochondrial	5.15e-05	NA	2.29e-08	0.5223
3. BF	C4Z541	Elongation factor 4	1.60e-06	NA	2.06e-07	0.7191
3. BF	B9DSE0	Elongation factor 4	6.62e-06	NA	2.53e-10	0.753
3. BF	Q3YYU7	Elongation factor 4	9.50e-07	NA	4.07e-11	0.7796
3. BF	B7IHU3	Elongation factor G	2.64e-05	NA	1.42e-10	0.5515
3. BF	Q2LTN3	Elongation factor 4	1.17e-05	NA	7.58e-13	0.7349
3. BF	Q2SXT6	Elongation factor 4	1.66e-05	NA	4.43e-09	0.7529
3. BF	A2SDH0	Elongation factor 4	1.15e-06	NA	5.45e-09	0.7645
3. BF	A5F5G3	Elongation factor 4	9.35e-07	NA	3.29e-12	0.7657
3. BF	B9DYA6	Elongation factor G	5.95e-06	NA	6.60e-08	0.5512
3. BF	C1GGI6	Translation factor GUF1, mitochondrial	1.33e-05	NA	1.94e-06	0.7108
3. BF	A1K601	Elongation factor 4	1.27e-06	NA	2.80e-09	0.759
3. BF	A1U2V8	Elongation factor 4	1.72e-06	NA	6.90e-08	0.7718
3. BF	A7N9A4	Elongation factor 4	1.36e-06	NA	1.91e-08	0.7451
3. BF	Q492C9	Elongation factor 4	8.99e-07	NA	4.57e-11	0.7779
3. BF	Q831Z0	Elongation factor 4	3.47e-06	NA	2.18e-12	0.7317
3. BF	Q98QD8	Elongation factor G	2.76e-06	NA	1.05e-09	0.5674
3. BF	P28371	Elongation factor G 1	5.25e-05	NA	5.26e-06	0.5408
3. BF	Q2YM00	Elongation factor G	2.83e-05	NA	1.12e-09	0.5453
3. BF	Q0RDS4	Translation initiation factor IF-2	0.00e+00	NA	6.00e-149	0.8045
3. BF	C0R5S3	Elongation factor 4	1.03e-06	NA	1.72e-07	0.7473
3. BF	Q1MN39	Translation initiation factor IF-2	0.00e+00	NA	2.71e-149	0.8098
3. BF	B0TC53	Elongation factor G	1.08e-05	NA	9.67e-08	0.5482
3. BF	Q5M1B9	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8444
3. BF	A3D1V4	Elongation factor 4	3.37e-05	NA	2.70e-11	0.7596
3. BF	A9GWZ4	Elongation factor 4	1.91e-06	NA	5.66e-09	0.7538
3. BF	Q754I9	Ribosome-releasing factor 2, mitochondrial	9.79e-04	NA	2.07e-08	0.4436
3. BF	B2S3A4	Elongation factor 4	3.21e-06	NA	5.55e-09	0.7573
3. BF	Q6HDK2	Elongation factor 4	6.41e-06	NA	4.65e-12	0.7556
3. BF	A7ZS65	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	0.8158
3. BF	Q8YQJ1	Translation initiation factor IF-2	0.00e+00	NA	7.20e-159	0.8693
3. BF	Q6GGB6	Elongation factor 4	2.17e-06	NA	2.16e-12	0.744
3. BF	A8AQ58	Translation initiation factor IF-2	0.00e+00	NA	9.51e-152	0.8338
3. BF	A6ZQM4	Ribosome-releasing factor 2, mitochondrial	5.47e-04	NA	8.46e-07	0.3927
3. BF	A6LPQ8	Elongation factor G	4.06e-06	NA	9.09e-09	0.5719
3. BF	A4VXH3	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8441
3. BF	Q30Z38	Elongation factor G	2.29e-05	NA	4.05e-08	0.5319
3. BF	P57508	50S ribosomal subunit assembly factor BipA	4.17e-05	NA	8.61e-11	0.7117
3. BF	A5W8F4	Elongation factor 4	2.75e-05	NA	1.14e-09	0.7765
3. BF	B3PXE3	Translation initiation factor IF-2	0.00e+00	NA	2.06e-150	0.8117
3. BF	Q8D307	Elongation factor 4	5.39e-07	NA	6.17e-09	0.77
3. BF	C1D7L2	Elongation factor 4	1.29e-06	NA	2.37e-09	0.7656
3. BF	P70782	Elongation factor G	4.39e-05	NA	4.01e-11	0.5439
3. BF	B4S4S6	Translation initiation factor IF-2	0.00e+00	NA	2.77e-166	0.8095
3. BF	A8LM45	Elongation factor G	5.36e-05	NA	7.88e-09	0.532
3. BF	Q5LIN1	Translation initiation factor IF-2	0.00e+00	NA	1.16e-164	0.8126
3. BF	B8EBQ4	Elongation factor 4	1.41e-05	NA	1.25e-11	0.7573
3. BF	Q8YHP3	Elongation factor G	2.49e-05	NA	1.13e-09	0.5595
3. BF	A6WKQ5	Elongation factor 4	1.42e-05	NA	2.70e-11	0.7601
3. BF	B4TE17	Elongation factor 4	8.58e-07	NA	8.14e-09	0.7783
3. BF	P0A557	Elongation factor G	7.02e-05	NA	7.02e-08	0.513
3. BF	Q1R8G3	Elongation factor 4	9.90e-07	NA	1.34e-09	0.7796
3. BF	A6TEI7	Translation initiation factor IF-2	0.00e+00	NA	7.58e-153	0.8286
3. BF	A5U070	Elongation factor G	6.12e-05	NA	7.02e-08	0.536
3. BF	Q0ANP7	Elongation factor G	4.98e-05	NA	8.94e-10	0.539
3. BF	B2TIH2	Elongation factor G	3.91e-05	NA	1.47e-08	0.5558
3. BF	Q31XR8	Elongation factor 4	8.77e-07	NA	1.14e-09	0.7798
3. BF	A7FFT7	Elongation factor 4	8.90e-07	NA	2.16e-10	0.7836
3. BF	Q47EG0	Elongation factor 4	1.56e-05	NA	1.19e-08	0.7689
3. BF	Q16D38	Translation initiation factor IF-2	0.00e+00	NA	1.98e-155	0.807
3. BF	B8D7F7	Elongation factor 4	9.77e-07	NA	2.99e-08	0.7649
3. BF	A8EY28	Elongation factor 4	1.84e-06	NA	4.10e-06	0.735
3. BF	B2SEJ6	Elongation factor 4	2.04e-06	NA	8.63e-09	0.748
3. BF	B2FQC4	Elongation factor 4	2.14e-05	NA	8.59e-08	0.7367
3. BF	B0CK11	Translation initiation factor IF-2	0.00e+00	NA	8.89e-160	0.8035
3. BF	Q2JMD7	Translation initiation factor IF-2	0.00e+00	NA	1.77e-147	0.8512
3. BF	A4QV78	Translation factor GUF1, mitochondrial	8.31e-05	NA	3.23e-06	0.6937
3. BF	B4U741	Elongation factor G	5.23e-06	NA	1.71e-09	0.5492
3. BF	A7GZZ3	Translation initiation factor IF-2	0.00e+00	NA	1.18e-155	0.8203
3. BF	Q2Y873	Elongation factor 4	9.29e-07	NA	3.27e-11	0.7703
3. BF	B1WWD8	Elongation factor 4	1.97e-06	NA	1.20e-11	0.7347
3. BF	A2BV79	Elongation factor 4	1.83e-06	NA	2.17e-09	0.7061
3. BF	Q0SFF3	Elongation factor G	7.50e-06	NA	1.40e-09	0.5153
3. BF	B7VK81	Elongation factor 4	8.95e-07	NA	1.81e-09	0.767
3. BF	Q6D217	Elongation factor 4	7.68e-07	NA	6.29e-12	0.7797
3. BF	Q04Y01	Elongation factor G	7.04e-04	NA	1.51e-09	0.5328
3. BF	Q0AK69	Translation initiation factor IF-2	0.00e+00	NA	3.16e-136	0.7966
3. BF	Q63H93	Elongation factor G	9.46e-06	NA	1.95e-09	0.5557
3. BF	Q7VL73	Elongation factor 4	5.27e-05	NA	2.42e-09	0.7751
3. BF	Q5R104	Elongation factor 4	1.81e-05	NA	2.06e-07	0.7629
3. BF	P0A3K6	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8428
3. BF	Q9ZM46	Translation initiation factor IF-2	0.00e+00	NA	5.25e-144	0.8242
3. BF	Q8EWZ9	Elongation factor 4	3.72e-06	NA	1.40e-12	0.7363
3. BF	A5VCZ5	Translation initiation factor IF-2	0.00e+00	NA	2.44e-151	0.7958
3. BF	B0VTM2	Elongation factor 4	1.46e-06	NA	1.85e-05	0.7632
3. BF	Q182F4	Elongation factor 4	9.36e-07	NA	4.68e-10	0.7121
3. BF	Q2GD00	Elongation factor 4	8.14e-07	NA	3.75e-06	0.774
3. BF	A7H4P5	Elongation factor G	2.27e-05	NA	1.59e-07	0.5734
3. BF	A5FV21	Translation initiation factor IF-2	0.00e+00	NA	1.18e-168	0.8074
3. BF	Q3MDM4	Elongation factor G	1.05e-04	NA	9.60e-09	0.5378
3. BF	B2GBR9	Elongation factor 4	7.80e-06	NA	3.95e-09	0.7382
3. BF	A9ADE0	Elongation factor 4	9.63e-07	NA	1.26e-08	0.7612
3. BF	Q3MBZ7	Translation initiation factor IF-2	0.00e+00	NA	1.34e-159	0.8631
3. BF	Q0I3P5	Translation initiation factor IF-2	0.00e+00	NA	4.61e-158	0.8265
3. BF	B4U1E8	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8371
3. BF	A3QBS5	Elongation factor 4	2.45e-05	NA	1.06e-10	0.7812
3. BF	Q9ZHZ8	Elongation factor 4	3.67e-06	NA	2.39e-11	0.7605
3. BF	P0DC23	Elongation factor 4	1.99e-06	NA	9.46e-10	0.7323
3. BF	A3M7P5	Elongation factor 4	1.21e-06	NA	1.74e-05	0.7514
3. BF	A5CE57	Elongation factor 4	2.70e-06	NA	3.69e-07	0.7702
3. BF	Q634M2	Elongation factor 4	3.01e-06	NA	4.65e-12	0.7434
3. BF	A1ARG8	Elongation factor 4	2.05e-06	NA	4.06e-08	0.7587
3. BF	B2TYI0	Elongation factor 4	9.07e-07	NA	1.14e-09	0.7801
3. BF	C1CKU6	Elongation factor 4	5.22e-06	NA	2.76e-11	0.715
3. BF	A6SXR0	Elongation factor 4	1.19e-06	NA	1.74e-08	0.7568
3. BF	C6DZ67	Elongation factor 4	2.58e-06	NA	4.13e-10	0.7399
3. BF	B6JJT7	Elongation factor 4	8.31e-07	NA	4.79e-07	0.7821
3. BF	Q0CLP3	Elongation factor G, mitochondrial	9.46e-04	NA	9.23e-08	0.4901
3. BF	B7L0Q8	Elongation factor G	2.41e-04	NA	1.06e-09	0.5502
3. BF	Q48RU8	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8444
3. BF	B0VCT7	Elongation factor 4	1.25e-06	NA	1.74e-05	0.7435
3. BF	Q2FGD9	Elongation factor 4	2.23e-06	NA	2.11e-12	0.7443
3. BF	A4SRD4	Elongation factor 4	1.46e-05	NA	2.06e-11	0.7749
3. BF	B1XB43	Elongation factor 4	8.10e-07	NA	1.14e-09	0.7797
3. BF	Q3KLR3	Elongation factor G	2.61e-05	NA	1.24e-07	0.5342
3. BF	A6U257	Elongation factor 4	2.22e-06	NA	2.16e-12	0.7669
3. BF	Q9ZDQ1	Elongation factor 4	9.29e-06	NA	3.28e-05	0.715
3. BF	Q4USF4	Elongation factor 4	2.83e-06	NA	2.30e-08	0.7615
3. BF	Q8CP13	Elongation factor 4	4.45e-06	NA	1.76e-11	0.7673
3. BF	P43729	Elongation factor 4	5.45e-05	NA	1.13e-10	0.7758
3. BF	Q3AF13	Elongation factor 4	3.15e-06	NA	2.65e-09	0.7229
3. BF	A8L6F4	Translation initiation factor IF-2	0.00e+00	NA	1.77e-158	0.8046
3. BF	Q1CKE6	Elongation factor 4	1.64e-05	NA	2.16e-10	0.7839
3. BF	B8IS82	Elongation factor G	2.41e-04	NA	9.74e-10	0.542
3. BF	A5I7K9	Elongation factor G	3.34e-05	NA	1.27e-09	0.5448
3. BF	Q2SSF7	Elongation factor 4	3.00e-06	NA	2.03e-12	0.7539
3. BF	Q04KB7	Elongation factor 4	5.45e-06	NA	2.79e-11	0.7465
3. BF	B5EB36	Elongation factor 4	1.96e-06	NA	5.70e-10	0.7411
3. BF	Q07YZ4	Elongation factor 4	1.43e-05	NA	5.49e-09	0.7714
3. BF	B3EH94	Elongation factor G	3.11e-05	NA	7.21e-08	0.5302
3. BF	B1IC02	Elongation factor 4	5.44e-06	NA	3.26e-11	0.7151
3. BF	B9JDS6	Elongation factor G	4.92e-05	NA	1.33e-10	0.5314
3. BF	C1GX39	Translation factor GUF1, mitochondrial	1.79e-05	NA	4.89e-07	0.7181
3. BF	A5IYS0	Elongation factor 4	2.96e-06	NA	3.47e-12	0.7482
3. BF	B3EFB1	Translation initiation factor IF-2	0.00e+00	NA	4.49e-166	0.813
3. BF	B7LDG2	Elongation factor 4	9.05e-07	NA	1.14e-09	0.7797
3. BF	A4W0W0	Elongation factor 4	5.29e-06	NA	9.03e-11	0.7261
3. BF	Q8KFT1	Translation initiation factor IF-2	0.00e+00	NA	8.29e-160	0.8048
3. BF	Q64ZR4	Translation initiation factor IF-2	0.00e+00	NA	1.16e-164	0.8006
3. BF	B5ZYT2	Elongation factor G	5.17e-05	NA	5.72e-11	0.5334
3. BF	B0CH35	Elongation factor G	2.58e-05	NA	4.86e-09	0.5596
3. BF	P60793	Elongation factor 4	2.44e-06	NA	3.73e-07	0.7493
3. BF	B7JNV1	Elongation factor 4	6.53e-06	NA	4.90e-12	0.7598
3. BF	B8CQJ7	Elongation factor 4	1.34e-05	NA	3.79e-09	0.7639
3. BF	Q7WFL2	Elongation factor G 2	2.51e-05	NA	1.88e-07	0.5257
3. BF	Q8R602	Elongation factor G	9.91e-06	NA	2.59e-08	0.556
3. BF	Q8DQV2	Translation initiation factor IF-2	0.00e+00	NA	0.0	0.8444
3. BF	A2S9Z3	Elongation factor 4	1.32e-06	NA	5.27e-09	0.7567
3. BF	Q30TP3	Elongation factor G	1.68e-05	NA	6.45e-07	0.525
3. BF	Q57CQ5	Elongation factor G	2.83e-05	NA	1.12e-09	0.5492
3. BF	Q8NT19	Elongation factor G	5.53e-05	NA	3.81e-10	0.5331
3. BF	B5ELX6	Elongation factor G	6.57e-05	NA	4.63e-08	0.5352
3. BF	Q2P0X1	Translation initiation factor IF-2	0.00e+00	NA	9.26e-155	0.8225
3. BF	B4SRL3	Elongation factor 4	1.67e-05	NA	5.82e-08	0.7606
3. BF	Q044A7	Elongation factor 4	8.29e-06	NA	1.27e-08	0.7359
3. BF	Q17WQ8	Translation initiation factor IF-2	0.00e+00	NA	3.94e-145	0.8429
3. BF	Q7MXE4	Translation initiation factor IF-2	0.00e+00	NA	1.08e-161	0.8201
3. BF	Q9ZLZ3	50S ribosomal subunit assembly factor BipA	3.01e-05	NA	2.96e-14	0.6978
3. BF	A8FFD6	Elongation factor 4	3.12e-06	NA	1.30e-11	0.7552
3. BF	Q6G8Y3	Elongation factor 4	2.25e-06	NA	2.16e-12	0.7231
3. BF	A4SUV8	Elongation factor G	2.86e-05	NA	1.77e-06	0.5323
3. BF	A0LHL8	Translation initiation factor IF-2	0.00e+00	NA	1.16e-166	0.8312
3. BF	Q1JLY8	Elongation factor 4	6.65e-06	NA	1.52e-10	0.7325
3. BF	A2RL76	Elongation factor 4	4.57e-06	NA	1.59e-09	0.738
3. BF	Q89AM5	Elongation factor 4	7.91e-07	NA	3.28e-12	0.7461
3. BF	Q0BH06	Elongation factor 4	1.19e-06	NA	1.86e-07	0.7501
3. BF	A0LI00	Elongation factor 4	1.02e-06	NA	1.40e-07	0.7335
3. BF	A5ID24	Elongation factor 4	1.63e-06	NA	3.15e-08	0.7399
3. BF	Q037T6	Peptide chain release factor 3	3.11e-05	NA	4.25e-08	0.5671
3. BF	A4FPM8	Elongation factor G	1.13e-04	NA	7.14e-09	0.5153
3. BF	B1IVQ8	Elongation factor 4	9.40e-07	NA	1.14e-09	0.7797
3. BF	Q5FQM3	Translation initiation factor IF-2	0.00e+00	NA	2.64e-172	0.8107
3. BF	P65274	Elongation factor 4	7.13e-06	NA	4.67e-11	0.7136
3. BF	Q12KH9	Elongation factor 4	1.45e-05	NA	1.78e-08	0.7808
3. BF	B8HLK8	Elongation factor 4	1.75e-06	NA	1.24e-11	0.7275
3. BF	Q9I5G8	Elongation factor 4	1.29e-06	NA	7.39e-08	0.7414
3. BF	Q5L400	Elongation factor G	2.17e-05	NA	2.41e-09	0.5473
3. BF	B0S8S7	Elongation factor 4	1.12e-06	NA	3.37e-09	0.7442
3. BF	P09952	Elongation factor G	1.54e-05	NA	1.54e-08	0.5327
3. BF	Q892Q6	Elongation factor 4	3.24e-06	NA	2.60e-10	0.6943
3. BF	P72749	50S ribosomal subunit assembly factor BipA	1.96e-05	NA	3.53e-11	0.693
3. BF	A5EX85	Elongation factor G	3.32e-05	NA	3.67e-08	0.5414
3. BF	A7FZ72	Elongation factor G	3.33e-05	NA	1.27e-09	0.5528
3. BF	B2GIL1	Elongation factor G	9.60e-05	NA	4.20e-09	0.516
3. BF	Q3AQK7	Translation initiation factor IF-2	0.00e+00	NA	1.37e-162	0.8
3. BF	A0RQI0	Elongation factor G	3.78e-06	NA	1.00e-07	0.5516
3. BF	B0KV29	Elongation factor 4	9.26e-07	NA	4.16e-09	0.7819
3. BF	P60788	Elongation factor 4	9.23e-07	NA	1.14e-09	0.7804
3. BF	Q39Y09	Elongation factor G 1	4.93e-06	NA	2.42e-08	0.5404
4. PB	B2TJ55	Translation initiation factor IF-2	0.00e+00	3.80e-33	0.0	NA
4. PB	Q3UJK4	GTP-binding protein 2	4.15e-05	2.05e-04	0.011	NA
4. PB	Q8ZX20	Probable translation initiation factor IF-2	2.41e-11	1.19e-02	5.29e-25	NA
4. PB	Q14K20	Translation initiation factor IF-2	0.00e+00	5.56e-05	2.65e-163	NA
4. PB	B6IZ61	Translation initiation factor IF-2	0.00e+00	3.70e-07	4.33e-146	NA
4. PB	Q58DC5	GTP-binding protein 1	1.52e-04	3.28e-03	2.95e-04	NA
4. PB	A6VU29	Translation initiation factor IF-2	0.00e+00	1.05e-04	8.23e-144	NA
4. PB	Q0SM50	Translation initiation factor IF-2	0.00e+00	1.79e-07	1.41e-143	NA
4. PB	Q4FNM9	Translation initiation factor IF-2	0.00e+00	2.21e-15	8.23e-133	NA
4. PB	A5GF86	Translation initiation factor IF-2	0.00e+00	3.17e-04	0.0	NA
4. PB	Q2SML3	Translation initiation factor IF-2	0.00e+00	2.13e-03	1.02e-152	NA
4. PB	O59683	Translation initiation factor IF-2, mitochondrial	0.00e+00	4.08e-21	5.07e-98	NA
4. PB	A7NID1	Translation initiation factor IF-2	0.00e+00	6.40e-15	2.96e-174	NA
4. PB	A4WIK2	Probable translation initiation factor IF-2	6.41e-10	4.59e-04	9.61e-23	NA
4. PB	Q3KI84	Translation initiation factor IF-2	0.00e+00	2.59e-06	6.99e-145	NA
4. PB	Q3ZXU3	Translation initiation factor IF-2	0.00e+00	1.54e-62	7.76e-161	NA
4. PB	Q02FS8	Translation initiation factor IF-2	0.00e+00	1.10e-05	3.58e-146	NA
4. PB	Q92C29	Translation initiation factor IF-2	0.00e+00	5.62e-11	0.0	NA
4. PB	B0K9Q0	Translation initiation factor IF-2	0.00e+00	4.40e-28	0.0	NA
4. PB	Q7VHF6	Translation initiation factor IF-2	0.00e+00	8.12e-03	1.57e-156	NA
4. PB	B5FA79	Translation initiation factor IF-2	0.00e+00	3.66e-02	2.86e-158	NA
4. PB	F4K410	Putative elongation factor TypA-like SVR3, chloroplastic	1.09e-04	2.33e-05	4.38e-12	NA
4. PB	Q31GK5	Translation initiation factor IF-2	0.00e+00	1.66e-08	4.97e-132	NA
4. PB	A6UVG0	Probable translation initiation factor IF-2	5.87e-11	4.55e-04	3.08e-38	NA
4. PB	Q7NH85	Translation initiation factor IF-2	0.00e+00	1.11e-02	3.64e-155	NA
4. PB	Q7YZN9	Eukaryotic peptide chain release factor GTP-binding subunit	1.37e-04	3.50e-03	7.06e-04	NA
4. PB	A5FQR6	Translation initiation factor IF-2	0.00e+00	1.54e-62	7.76e-161	NA
4. PB	A5W987	Translation initiation factor IF-2	0.00e+00	1.02e-05	1.04e-149	NA
4. PB	Q6YR66	Translation initiation factor IF-2	0.00e+00	4.57e-64	2.41e-155	NA
4. PB	Q5XGS8	GTP-binding protein 1	1.66e-04	3.64e-03	3.47e-04	NA
4. PB	P46199	Translation initiation factor IF-2, mitochondrial	0.00e+00	3.20e-24	5.42e-108	NA
4. PB	A1AV99	Translation initiation factor IF-2	0.00e+00	1.07e-06	6.95e-145	NA
4. PB	A8MBV9	Probable translation initiation factor IF-2	3.91e-11	6.19e-04	2.31e-19	NA
4. PB	A8FYS0	Translation initiation factor IF-2	0.00e+00	2.02e-02	1.47e-159	NA
4. PB	Q5WFU2	Translation initiation factor IF-2	0.00e+00	2.19e-13	0.0	NA
4. PB	Q91YJ5	Translation initiation factor IF-2, mitochondrial	0.00e+00	3.88e-23	3.46e-114	NA
4. PB	Q0W8X2	Probable translation initiation factor IF-2	7.40e-12	2.92e-03	1.90e-35	NA
4. PB	A9KZX1	Translation initiation factor IF-2	0.00e+00	2.59e-02	9.27e-159	NA
4. PB	Q609C0	Translation initiation factor IF-2	0.00e+00	1.02e-02	6.36e-149	NA
4. PB	A0Q0Q7	Translation initiation factor IF-2	0.00e+00	8.37e-37	7.65e-178	NA
4. PB	Q68WI4	Translation initiation factor IF-2	0.00e+00	1.05e-02	8.28e-155	NA
4. PB	B0K1D6	Translation initiation factor IF-2	0.00e+00	4.57e-28	0.0	NA
4. PB	A6MVX8	Translation initiation factor IF-2, chloroplastic	0.00e+00	1.71e-13	2.89e-127	NA
4. PB	Q5FJN6	Translation initiation factor IF-2	0.00e+00	7.20e-03	0.0	NA
4. PB	Q0BK70	Translation initiation factor IF-2	0.00e+00	6.37e-05	1.96e-162	NA
4. PB	Q0TPR7	Translation initiation factor IF-2	0.00e+00	5.52e-34	2.47e-179	NA
4. PB	B8D7R4	Translation initiation factor IF-2	0.00e+00	9.76e-03	4.08e-143	NA
4. PB	Q5X1C3	Translation initiation factor IF-2	0.00e+00	4.31e-03	3.96e-151	NA
4. PB	Q9ZCZ8	Translation initiation factor IF-2	0.00e+00	9.94e-03	1.53e-155	NA
4. PB	P57458	Translation initiation factor IF-2	0.00e+00	6.50e-03	7.04e-143	NA
4. PB	O26359	Probable translation initiation factor IF-2	1.20e-12	6.50e-04	2.43e-35	NA
4. PB	A5K6I6	Translation factor GUF1 homolog, mitochondrial	2.40e-04	4.82e-03	1.34e-04	NA
4. PB	B7V1F6	Translation initiation factor IF-2	0.00e+00	1.37e-05	3.58e-146	NA
4. PB	C3K259	Translation initiation factor IF-2	0.00e+00	3.24e-06	9.27e-149	NA
4. PB	Q73NP6	Translation initiation factor IF-2	0.00e+00	2.82e-03	1.86e-169	NA
4. PB	Q9VRH6	Translation factor waclaw, mitochondrial	3.77e-05	2.99e-02	7.17e-10	NA
4. PB	P17889	Translation initiation factor IF-2	0.00e+00	3.52e-25	0.0	NA
4. PB	Q18905	GTP-binding protein cgp-1	7.27e-05	2.30e-03	0.008	NA
4. PB	A6VIS4	Probable translation initiation factor IF-2	5.51e-13	2.51e-04	3.01e-40	NA
4. PB	Q3J9B6	Translation initiation factor IF-2	0.00e+00	1.34e-05	6.55e-153	NA
4. PB	Q9HNQ2	Probable translation initiation factor IF-2	6.03e-12	1.58e-03	6.08e-39	NA
4. PB	Q1XDN0	Translation initiation factor IF-2, chloroplastic	0.00e+00	2.95e-09	5.50e-129	NA
4. PB	P25038	Translation initiation factor IF-2, mitochondrial	0.00e+00	4.47e-35	8.53e-100	NA
4. PB	B2V4G9	Translation initiation factor IF-2	0.00e+00	7.60e-34	7.51e-179	NA
4. PB	Q18FT0	Probable translation initiation factor IF-2	3.57e-10	2.64e-07	2.50e-37	NA
4. PB	P44323	Translation initiation factor IF-2	0.00e+00	1.27e-02	2.13e-154	NA
4. PB	Q4L5X1	Translation initiation factor IF-2	0.00e+00	5.98e-23	0.0	NA
4. PB	Q4ZNR2	Translation initiation factor IF-2	0.00e+00	4.14e-06	8.79e-149	NA
4. PB	B1J2A9	Translation initiation factor IF-2	0.00e+00	1.76e-05	2.75e-150	NA
4. PB	Q1QSZ0	Translation initiation factor IF-2	0.00e+00	2.94e-05	1.48e-155	NA
4. PB	B2SEW7	Translation initiation factor IF-2	0.00e+00	6.78e-05	1.21e-163	NA
4. PB	B1KRR0	Translation initiation factor IF-2	0.00e+00	3.24e-02	1.23e-158	NA
4. PB	A9A813	Probable translation initiation factor IF-2	4.83e-12	2.13e-04	1.37e-40	NA
4. PB	A0AIC6	Translation initiation factor IF-2	0.00e+00	7.06e-11	0.0	NA
4. PB	A4IMD7	Translation initiation factor IF-2	0.00e+00	4.48e-17	0.0	NA
4. PB	Q4UIN6	Translation factor GUF1 homolog, mitochondrial	1.19e-04	4.68e-02	1.32e-04	NA
4. PB	A6URS1	Probable translation initiation factor IF-2	1.28e-09	4.73e-04	9.61e-37	NA
4. PB	Q9Y9B3	Probable translation initiation factor IF-2	1.57e-11	3.68e-04	5.19e-39	NA
4. PB	O08582	GTP-binding protein 1	7.06e-05	2.58e-03	2.24e-04	NA
4. PB	P9WKK1	Translation initiation factor IF-2	0.00e+00	6.38e-03	9.52e-157	NA
4. PB	A8GSP4	Translation initiation factor IF-2	0.00e+00	2.29e-04	3.77e-154	NA
4. PB	B5YHT8	Translation initiation factor IF-2	0.00e+00	1.53e-17	0.0	NA
4. PB	P65132	Translation initiation factor IF-2	0.00e+00	6.38e-03	9.52e-157	NA
4. PB	Q5E7L5	Translation initiation factor IF-2	0.00e+00	2.61e-02	1.53e-156	NA
4. PB	B1II49	Translation initiation factor IF-2	0.00e+00	2.50e-34	1.99e-176	NA
4. PB	Q8EHL5	Translation initiation factor IF-2	0.00e+00	3.79e-02	2.66e-157	NA
4. PB	Q65JI1	Translation initiation factor IF-2	0.00e+00	5.06e-24	0.0	NA
4. PB	B6YWH3	Probable translation initiation factor IF-2	1.22e-12	5.60e-03	2.49e-38	NA
4. PB	B8D9G2	Translation initiation factor IF-2	0.00e+00	6.50e-03	7.04e-143	NA
4. PB	Q8RA37	Translation initiation factor IF-2	0.00e+00	3.02e-23	0.0	NA
4. PB	Q1IF43	Translation initiation factor IF-2	0.00e+00	2.09e-05	2.09e-148	NA
4. PB	A7Z4T4	Translation initiation factor IF-2	0.00e+00	3.73e-26	0.0	NA
4. PB	A9RFQ5	Translation factor GUF1 homolog, chloroplastic	8.30e-05	1.44e-03	6.23e-12	NA
4. PB	A3CSP4	Probable translation initiation factor IF-2	2.39e-11	7.00e-03	1.74e-37	NA
4. PB	Q7MI09	Translation initiation factor IF-2	0.00e+00	4.44e-02	2.69e-158	NA
4. PB	A0KNE3	Translation initiation factor IF-2	0.00e+00	3.71e-03	9.01e-164	NA
4. PB	P95691	Probable translation initiation factor IF-2	1.33e-10	2.26e-03	4.07e-31	NA
4. PB	C1DFK9	Translation initiation factor IF-2	0.00e+00	1.45e-05	5.82e-153	NA
4. PB	A5IHU7	Translation initiation factor IF-2	0.00e+00	3.50e-03	9.31e-152	NA
4. PB	Q8PU78	Probable translation initiation factor IF-2	2.76e-12	4.68e-04	3.31e-37	NA
4. PB	Q9HJ60	Probable translation initiation factor IF-2	3.31e-12	2.49e-03	2.36e-31	NA
4. PB	A1RUX2	Probable translation initiation factor IF-2	9.34e-10	2.81e-02	3.93e-21	NA
4. PB	Q65SK9	Translation initiation factor IF-2	0.00e+00	4.78e-03	2.88e-157	NA
4. PB	Q1IZ02	Translation initiation factor IF-2	0.00e+00	8.81e-47	2.27e-140	NA
4. PB	Q466D5	Probable translation initiation factor IF-2	4.92e-12	4.28e-04	4.74e-42	NA
4. PB	Q1G9P9	Translation initiation factor IF-2	0.00e+00	5.86e-05	1.76e-179	NA
4. PB	Q5WT36	Translation initiation factor IF-2	0.00e+00	4.78e-03	1.18e-151	NA
4. PB	Q4KIF6	Translation initiation factor IF-2	0.00e+00	5.82e-07	4.01e-147	NA
4. PB	B0KHX8	Translation initiation factor IF-2	0.00e+00	1.67e-06	1.47e-149	NA
4. PB	Q1AW55	Translation initiation factor IF-2	0.00e+00	5.32e-29	4.72e-163	NA
4. PB	B0R6U5	Probable translation initiation factor IF-2	5.78e-12	1.58e-03	6.08e-39	NA
4. PB	A4IW10	Translation initiation factor IF-2	0.00e+00	1.48e-04	1.04e-163	NA
4. PB	Q8TQL5	Probable translation initiation factor IF-2	4.41e-12	1.69e-03	2.58e-39	NA
4. PB	Q1RIX0	Translation initiation factor IF-2	0.00e+00	1.39e-05	2.20e-160	NA
4. PB	Q976A1	Probable translation initiation factor IF-2	1.09e-10	8.27e-03	9.26e-27	NA
4. PB	A0Q8F3	Translation initiation factor IF-2	0.00e+00	1.09e-04	9.44e-165	NA
4. PB	Q7U8L9	Translation initiation factor IF-2	0.00e+00	1.49e-53	2.68e-163	NA
4. PB	B7GG75	Translation initiation factor IF-2	0.00e+00	4.84e-20	0.0	NA
4. PB	A2STM8	Probable translation initiation factor IF-2	2.74e-11	4.21e-02	3.59e-38	NA
4. PB	B6ENE2	Translation initiation factor IF-2	0.00e+00	1.23e-02	1.50e-156	NA
4. PB	C6A1V3	Probable translation initiation factor IF-2	2.41e-11	1.84e-02	2.96e-38	NA
4. PB	Q0AYI8	Translation initiation factor IF-2	0.00e+00	1.47e-02	0.0	NA
4. PB	D2XV59	GTP-binding protein 1	1.50e-04	1.07e-03	2.20e-04	NA
4. PB	A8GNW1	Translation initiation factor IF-2	0.00e+00	6.97e-06	7.16e-154	NA
4. PB	A7NEI8	Translation initiation factor IF-2	0.00e+00	1.04e-04	1.96e-162	NA
4. PB	Q9BX10	GTP-binding protein 2	2.19e-04	7.53e-05	0.007	NA
4. PB	C1AFV3	Translation initiation factor IF-2	0.00e+00	6.38e-03	9.52e-157	NA
4. PB	Q6M0I6	Probable translation initiation factor IF-2	4.95e-12	4.20e-04	1.87e-39	NA
4. PB	P15170	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A	4.70e-05	1.53e-02	2.33e-04	NA
4. PB	Q6G4W7	Translation initiation factor IF-2	0.00e+00	2.61e-02	4.45e-153	NA
4. PB	Q5NIL7	Translation initiation factor IF-2	0.00e+00	5.56e-05	2.65e-163	NA
4. PB	Q9KA77	Translation initiation factor IF-2	0.00e+00	8.62e-20	0.0	NA
4. PB	A4SJR5	Translation initiation factor IF-2	0.00e+00	3.78e-03	5.55e-162	NA
4. PB	A8GW31	Translation initiation factor IF-2	0.00e+00	1.18e-05	4.73e-160	NA
4. PB	A4FZQ3	Probable translation initiation factor IF-2	4.61e-13	3.47e-04	3.90e-41	NA
4. PB	Q0C5Z5	Translation initiation factor IF-2	0.00e+00	3.01e-03	3.82e-142	NA
4. PB	Q2G2D0	Translation initiation factor IF-2	0.00e+00	1.31e-27	0.0	NA
4. PB	A5UZQ2	Translation initiation factor IF-2	0.00e+00	5.68e-17	1.04e-173	NA
4. PB	Q8EQU1	Translation initiation factor IF-2	0.00e+00	4.60e-33	0.0	NA
4. PB	Q5R8Q7	GTP-binding protein 1 (Fragment)	1.14e-04	4.00e-03	2.22e-04	NA
4. PB	A4XYE0	Translation initiation factor IF-2	0.00e+00	4.24e-06	2.70e-145	NA
4. PB	Q1GXD6	Translation initiation factor IF-2	0.00e+00	1.48e-02	8.15e-168	NA
4. PB	B9M1G0	Translation initiation factor IF-2	0.00e+00	5.87e-03	6.20e-179	NA
4. PB	A5UJM9	Probable translation initiation factor IF-2	4.27e-11	5.05e-03	2.27e-33	NA
4. PB	Q5ZRV4	Translation initiation factor IF-2	0.00e+00	2.39e-03	7.60e-152	NA
4. PB	A5CXX6	Translation initiation factor IF-2	0.00e+00	1.56e-06	1.03e-142	NA
4. PB	A2BJZ8	Probable translation initiation factor IF-2	5.02e-11	2.64e-04	2.20e-37	NA
4. PB	Q92HF5	Translation initiation factor IF-2	0.00e+00	7.77e-05	1.08e-156	NA
4. PB	A5U6J1	Translation initiation factor IF-2	0.00e+00	6.38e-03	9.52e-157	NA
4. PB	A0B8Q6	Probable translation initiation factor IF-2	8.45e-13	1.72e-04	1.55e-38	NA
4. PB	Q97BK4	Probable translation initiation factor IF-2	1.22e-11	2.33e-03	1.43e-31	NA
4. PB	A8EYF4	Translation initiation factor IF-2	0.00e+00	2.16e-03	6.00e-152	NA
4. PB	Q044B7	Translation initiation factor IF-2	0.00e+00	3.63e-02	0.0	NA
4. PB	Q15V72	Translation initiation factor IF-2	0.00e+00	8.40e-04	2.08e-157	NA
4. PB	B9LQL7	Probable translation initiation factor IF-2	1.35e-11	2.37e-03	2.78e-27	NA
4. PB	C1L2N1	Translation initiation factor IF-2	0.00e+00	1.49e-10	0.0	NA
4. PB	A8F223	Translation initiation factor IF-2	0.00e+00	2.56e-04	1.15e-154	NA
4. PB	Q049V5	Translation initiation factor IF-2	0.00e+00	1.37e-04	1.50e-179	NA
4. PB	Q17045	GTP-binding protein AGP-1	6.18e-05	7.70e-06	4.71e-04	NA
4. PB	Q48E77	Translation initiation factor IF-2	0.00e+00	9.58e-06	4.64e-148	NA
4. PB	A9N8V6	Translation initiation factor IF-2	0.00e+00	2.32e-07	1.95e-144	NA
4. PB	Q7RJ38	Translation factor GUF1 homolog, mitochondrial	4.24e-04	3.79e-02	5.90e-08	NA
4. PB	P04766	Translation initiation factor IF-2	0.00e+00	3.20e-17	0.0	NA
4. PB	Q8DBW0	Translation initiation factor IF-2	0.00e+00	4.36e-02	4.94e-159	NA
4. PB	Q3IMS5	Probable translation initiation factor IF-2	5.49e-12	4.11e-03	1.05e-27	NA
4. PB	A4YCQ5	Probable translation initiation factor IF-2	1.25e-10	7.68e-03	3.83e-26	NA
4. PB	Q3Z7U3	Translation initiation factor IF-2	0.00e+00	7.75e-65	3.09e-165	NA
4. PB	Q2NIQ6	Translation initiation factor IF-2	0.00e+00	2.10e-62	2.53e-153	NA
4. PB	O83861	Translation initiation factor IF-2	0.00e+00	3.47e-06	1.49e-164	NA
4. PB	A5UBT6	Translation initiation factor IF-2	0.00e+00	3.60e-02	2.82e-154	NA
4. PB	P9WKK0	Translation initiation factor IF-2	0.00e+00	6.38e-03	9.52e-157	NA
4. PB	Q2A1G8	Translation initiation factor IF-2	0.00e+00	5.33e-05	1.78e-162	NA
4. PB	O00178	GTP-binding protein 1	1.54e-04	2.46e-03	3.21e-04	NA
4. PB	B8GP02	Translation initiation factor IF-2	0.00e+00	6.24e-05	3.59e-160	NA
4. PB	Q30SS6	Translation initiation factor IF-2	0.00e+00	1.16e-02	6.22e-150	NA
4. PB	B6J6B1	Translation initiation factor IF-2	0.00e+00	1.92e-07	6.58e-146	NA
4. PB	Q47D94	Translation initiation factor IF-2	0.00e+00	4.97e-02	8.32e-163	NA
4. PB	B4RXT8	Translation initiation factor IF-2	0.00e+00	5.55e-04	2.23e-153	NA
4. PB	Q2NC10	Translation initiation factor IF-2	0.00e+00	3.35e-02	1.11e-143	NA
4. PB	A0LV27	Translation initiation factor IF-2	0.00e+00	3.40e-04	2.36e-172	NA
4. PB	A8A8D3	Probable translation initiation factor IF-2	1.74e-11	4.80e-05	2.12e-39	NA
4. PB	Q9HV55	Translation initiation factor IF-2	0.00e+00	1.37e-05	6.04e-146	NA
4. PB	A4Y9C0	Translation initiation factor IF-2	0.00e+00	2.99e-02	4.37e-157	NA
4. PB	A1ST45	Translation initiation factor IF-2	0.00e+00	4.21e-02	6.02e-149	NA
4. PB	A5CEN6	Translation initiation factor IF-2	0.00e+00	2.76e-02	8.20e-159	NA
4. PB	B0TWR3	Translation initiation factor IF-2	0.00e+00	9.17e-06	5.16e-162	NA
4. PB	O29490	Probable translation initiation factor IF-2	1.08e-12	1.32e-02	4.37e-39	NA
4. PB	A7AQ93	Translation factor GUF1 homolog, mitochondrial	1.31e-05	1.66e-03	3.92e-06	NA
4. PB	A6Q226	Translation initiation factor IF-2	0.00e+00	5.68e-05	3.20e-178	NA
4. PB	Q0SSD4	Translation initiation factor IF-2	0.00e+00	4.96e-34	2.52e-179	NA
4. PB	A9KBM1	Translation initiation factor IF-2	0.00e+00	1.83e-07	7.13e-145	NA
4. PB	B1YCQ7	Probable translation initiation factor IF-2	2.56e-11	3.19e-03	2.87e-22	NA
4. PB	Q2FU48	Probable translation initiation factor IF-2	3.87e-11	9.45e-04	2.58e-39	NA
4. PB	Q8Y7F6	Translation initiation factor IF-2	0.00e+00	4.35e-11	0.0	NA
4. PB	Q5L0I8	Translation initiation factor IF-2	0.00e+00	3.41e-11	0.0	NA
4. PB	B0BY61	Translation initiation factor IF-2	0.00e+00	2.29e-04	3.77e-154	NA
4. PB	Q8D2X6	Translation initiation factor IF-2	0.00e+00	4.85e-05	2.19e-130	NA
4. PB	Q7MYY7	Translation initiation factor IF-2	0.00e+00	2.61e-02	7.12e-154	NA
4. PB	B0TQA2	Translation initiation factor IF-2	0.00e+00	2.05e-02	1.98e-159	NA
4. PB	A4VPP0	Translation initiation factor IF-2	0.00e+00	1.08e-05	2.84e-144	NA
4. PB	A8YVQ7	Translation initiation factor IF-2	0.00e+00	6.38e-03	5.09e-180	NA
4. PB	A1KMI2	Translation initiation factor IF-2	0.00e+00	6.38e-03	9.52e-157	NA
4. PB	B8CKH3	Translation initiation factor IF-2	0.00e+00	3.04e-02	1.43e-159	NA
4. PB	Q4UL51	Translation initiation factor IF-2	0.00e+00	2.30e-05	1.51e-155	NA
4. PB	A3DMS0	Probable translation initiation factor IF-2	2.02e-11	6.63e-04	4.88e-36	NA
4. PB	Q8TV06	Probable translation initiation factor IF-2	3.02e-11	1.34e-02	1.18e-28	NA
4. PB	A3MTU7	Probable translation initiation factor IF-2	4.30e-11	2.31e-02	2.80e-22	NA
4. PB	A8FDD1	Translation initiation factor IF-2	0.00e+00	5.35e-28	0.0	NA
4. PB	C5D9C9	Translation initiation factor IF-2	0.00e+00	2.88e-18	0.0	NA
4. PB	Q3AB98	Translation initiation factor IF-2	0.00e+00	1.48e-04	0.0	NA
4. PB	Q83BS1	Translation initiation factor IF-2	0.00e+00	2.86e-07	2.15e-144	NA
5. P	Q9CAI1	Developmentally-regulated G-protein 2	1.64e-01	3.32e-02	NA	NA
5. P	Q980Q8	Probable translation initiation factor IF-2	1.82e-10	1.40e-03	NA	NA
5. P	Q58722	Uncharacterized GTP-binding protein MJ1326	1.34e-01	4.87e-03	NA	NA
5. P	Q9LQK0	Developmentally-regulated G-protein 1	1.74e-01	3.47e-02	NA	NA
7. B	Q47RV1	Translation initiation factor IF-2	0.00e+00	NA	1.10e-165	NA
7. B	Q8DI42	Elongation factor Tu	4.46e-07	NA	4.19e-10	NA
7. B	Q889X3	Elongation factor Tu	5.30e-07	NA	5.29e-09	NA
7. B	C4Z5N7	Translation initiation factor IF-2	0.00e+00	NA	3.31e-160	NA
7. B	B8ELG6	Elongation factor G	8.70e-05	NA	1.50e-09	NA
7. B	P57879	Peptide chain release factor 3	1.24e-05	NA	6.76e-06	NA
7. B	Q4UXA5	Peptide chain release factor 3	2.76e-05	NA	2.69e-05	NA
7. B	Q11AY3	Elongation factor 4	3.03e-06	NA	8.87e-07	NA
7. B	A2C0M8	Elongation factor 4	1.89e-06	NA	3.99e-11	NA
7. B	B7UGV7	GTPase Der	5.13e-03	NA	0.029	NA
7. B	Q5X6N0	Peptide chain release factor 3	1.07e-04	NA	7.15e-07	NA
7. B	P0DA83	Elongation factor Tu	3.86e-07	NA	1.81e-12	NA
7. B	A4FWE9	Elongation factor 1-alpha	4.27e-07	NA	0.014	NA
7. B	P68788	Elongation factor G	9.40e-06	NA	3.56e-08	NA
7. B	B1VGC2	Translation initiation factor IF-2	0.00e+00	NA	2.38e-140	NA
7. B	Q9KD52	GTPase Era	2.33e-03	NA	2.51e-04	NA
7. B	B5Z3B3	Sulfate adenylyltransferase subunit 1	5.70e-06	NA	3.95e-04	NA
7. B	P17197	Elongation factor 1-alpha	3.24e-06	NA	2.60e-07	NA
7. B	B2UUV6	Elongation factor G	4.39e-06	NA	4.65e-08	NA
7. B	Q6A9B2	Elongation factor 4	4.35e-06	NA	5.97e-08	NA
7. B	B4UDQ7	Elongation factor 4	2.82e-06	NA	1.05e-10	NA
7. B	Q823H7	Elongation factor 4	4.08e-06	NA	1.21e-08	NA
7. B	Q3ZJ24	Elongation factor Tu, chloroplastic	3.21e-07	NA	3.69e-11	NA
7. B	A9KD34	Elongation factor G	9.92e-06	NA	4.92e-08	NA
7. B	B1IGF6	Elongation factor Tu	4.04e-07	NA	1.90e-11	NA
7. B	B1W417	Elongation factor G	4.33e-05	NA	6.20e-08	NA
7. B	A5N7W7	GTPase Der	7.44e-04	NA	0.015	NA
7. B	Q7VA05	Elongation factor Tu	3.07e-07	NA	7.89e-10	NA
7. B	B0JIY7	Peptide chain release factor 3	6.09e-05	NA	3.68e-10	NA
7. B	Q2YSB4	Elongation factor G	9.41e-06	NA	3.56e-08	NA
7. B	B1LHE0	Elongation factor G	1.98e-05	NA	1.30e-07	NA
7. B	B7LEM0	Peptide chain release factor 3	1.12e-05	NA	1.26e-07	NA
7. B	A7I3T6	Elongation factor G	4.09e-05	NA	3.97e-07	NA
7. B	A4SHU2	Elongation factor Tu	4.47e-07	NA	3.40e-13	NA
7. B	A2CI56	Elongation factor Tu, chloroplastic	4.12e-07	NA	1.23e-10	NA
7. B	Q4DKF7	Translation factor GUF1 homolog 1, mitochondrial	1.07e-04	NA	1.30e-04	NA
7. B	Q0HLG1	Translation initiation factor IF-2	0.00e+00	NA	3.03e-157	NA
7. B	Q51238	Tetracycline resistance protein TetM	1.61e-05	NA	1.03e-10	NA
7. B	A1KGG4	Elongation factor G	6.70e-05	NA	7.02e-08	NA
7. B	Q664R7	Elongation factor Tu 2	5.26e-07	NA	9.03e-13	NA
7. B	B8D9U9	Elongation factor Tu	4.73e-07	NA	7.97e-13	NA
7. B	B9RHQ5	Translation factor GUF1 homolog, chloroplastic	1.06e-05	NA	1.70e-09	NA
7. B	C1F2I3	Elongation factor 4	3.04e-06	NA	4.11e-07	NA
7. B	A5PKR8	Elongation factor G, mitochondrial	1.79e-04	NA	7.27e-10	NA
7. B	C1D890	Sulfate adenylyltransferase subunit 1	9.47e-06	NA	0.001	NA
7. B	Q6AP74	Elongation factor G 2	1.58e-05	NA	7.27e-10	NA
7. B	A8IAT3	Elongation factor G	4.83e-05	NA	1.15e-10	NA
7. B	B5XK74	GTPase Era	8.73e-04	NA	6.99e-04	NA
7. B	A0Q125	GTPase Der	2.03e-03	NA	0.011	NA
7. B	A3GHT9	Elongation factor G, mitochondrial	5.93e-05	NA	3.09e-09	NA
7. B	C3P591	GTPase Der	8.81e-04	NA	0.016	NA
7. B	A1WSZ8	Peptide chain release factor 3	6.37e-05	NA	1.39e-06	NA
7. B	A1WHC3	Elongation factor Tu	3.55e-07	NA	4.62e-12	NA
7. B	Q21IH3	Elongation factor 4	1.04e-06	NA	1.10e-09	NA
7. B	A0PQC4	Translation initiation factor IF-2	0.00e+00	NA	7.37e-161	NA
7. B	A9A9U3	Elongation factor 1-alpha	6.46e-07	NA	0.017	NA
7. B	Q75CZ5	Elongation factor G, mitochondrial	7.84e-05	NA	2.86e-09	NA
7. B	Q0I0A7	Elongation factor Tu 2	4.65e-07	NA	1.36e-12	NA
7. B	Q6MDN0	Elongation factor Tu	3.05e-07	NA	2.38e-12	NA
7. B	Q83P06	Peptide chain release factor 3	1.14e-05	NA	1.18e-07	NA
7. B	B1IPV9	Elongation factor G	2.67e-05	NA	1.30e-07	NA
7. B	Q48UW6	GTPase Era	8.89e-04	NA	6.99e-04	NA
7. B	Q8FF59	GTPase Der	3.44e-03	NA	0.030	NA
7. B	A1R6W8	Elongation factor 4	3.77e-06	NA	2.28e-10	NA
7. B	C0QQM0	Elongation factor G	5.19e-05	NA	1.20e-05	NA
7. B	P69946	Elongation factor G	2.49e-05	NA	1.50e-08	NA
7. B	B6J4J8	GTPase Era	1.24e-03	NA	0.040	NA
7. B	Q8ETY4	Elongation factor Tu	5.46e-07	NA	5.03e-13	NA
7. B	C5DN84	Translation factor GUF1, mitochondrial	3.17e-06	NA	4.93e-05	NA
7. B	Q48TU0	Elongation factor 4	2.17e-06	NA	1.52e-10	NA
7. B	C5BSJ5	Sulfate adenylyltransferase subunit 1	9.57e-06	NA	1.07e-04	NA
7. B	A5G693	GTPase Era	1.74e-03	NA	0.003	NA
7. B	Q1IIT3	Translation initiation factor IF-2	0.00e+00	NA	1.96e-157	NA
7. B	B8FGS8	Peptide chain release factor 3	4.73e-05	NA	7.60e-08	NA
7. B	Q1BRT3	Elongation factor Tu	5.25e-07	NA	3.83e-11	NA
7. B	B3PLU0	Elongation factor 4	1.00e-06	NA	1.74e-12	NA
7. B	B4E7L1	Translation initiation factor IF-2	0.00e+00	NA	5.55e-168	NA
7. B	Q9PKU0	Translation initiation factor IF-2	0.00e+00	NA	1.43e-123	NA
7. B	A1AME1	Peptide chain release factor 3	6.44e-05	NA	7.38e-08	NA
7. B	Q3YSC2	Elongation factor 4	8.80e-07	NA	3.08e-05	NA
7. B	Q9ZF22	Translation initiation factor IF-2	0.00e+00	NA	1.48e-149	NA
7. B	Q6LXI1	Elongation factor 1-alpha	4.49e-07	NA	0.009	NA
7. B	A9M1D5	Translation initiation factor IF-2	0.00e+00	NA	1.37e-154	NA
7. B	A1TJ05	Elongation factor Tu	3.81e-07	NA	4.07e-11	NA
7. B	A4YBY5	Elongation factor Tu	4.41e-07	NA	4.29e-13	NA
7. B	P42439	Elongation factor Tu	3.70e-07	NA	2.04e-05	NA
7. B	P50371	Elongation factor Tu, chloroplastic	2.98e-07	NA	1.00e-11	NA
7. B	A0LLL8	Peptide chain release factor 3	3.98e-05	NA	1.98e-10	NA
7. B	Q2A1V8	Peptide chain release factor 3	2.86e-05	NA	8.10e-08	NA
7. B	A1WVC5	Elongation factor G	7.39e-05	NA	2.10e-08	NA
7. B	Q8XV10	Elongation factor G 1	2.19e-05	NA	2.97e-06	NA
7. B	C8ZDQ3	Translation factor GUF1, mitochondrial	1.28e-05	NA	3.90e-06	NA
7. B	B0RU85	Elongation factor G	4.46e-05	NA	1.12e-07	NA
7. B	Q875S0	Elongation factor 2	1.80e-03	NA	1.54e-05	NA
7. B	A0T0K6	Elongation factor Tu, chloroplastic	3.79e-07	NA	1.02e-07	NA
7. B	Q822I4	Elongation factor Tu	6.28e-06	NA	1.82e-11	NA
7. B	Q0K5Z9	Elongation factor Tu	3.80e-07	NA	5.49e-13	NA
7. B	Q8PC59	Elongation factor Tu-A	4.39e-07	NA	4.79e-09	NA
7. B	A9WH62	Elongation factor G	2.50e-05	NA	2.46e-06	NA
7. B	Q1C1T4	Elongation factor Tu 2	4.14e-07	NA	1.96e-13	NA
7. B	A4TRI3	Translation initiation factor IF-2	0.00e+00	NA	6.38e-154	NA
7. B	Q15YA7	Elongation factor G 2	2.85e-05	NA	2.01e-08	NA
7. B	C0Q0C2	Elongation factor G	1.94e-05	NA	7.70e-07	NA
7. B	A8GPF2	Elongation factor Tu	3.67e-07	NA	6.11e-12	NA
7. B	P0A3C1	GTPase Era	1.32e-03	NA	4.76e-07	NA
7. B	Q5PIW3	Elongation factor G	1.97e-05	NA	7.70e-07	NA
7. B	Q8TYP6	Elongation factor 1-alpha	1.33e-06	NA	1.11e-11	NA
7. B	Q6AJY4	Translation initiation factor IF-2	0.00e+00	NA	7.90e-156	NA
7. B	B1I766	GTPase Der	1.67e-03	NA	6.10e-06	NA
7. B	Q5JDL3	Translation initiation factor 2 subunit gamma	1.68e-05	NA	2.92e-11	NA
7. B	A4TCF8	Translation initiation factor IF-2	0.00e+00	NA	3.90e-156	NA
7. B	Q89AF5	Translation initiation factor IF-2	0.00e+00	NA	4.81e-141	NA
7. B	A6H1S4	Elongation factor 4	3.52e-06	NA	2.00e-06	NA
7. B	P50372	Elongation factor Tu, chloroplastic	2.90e-07	NA	2.61e-10	NA
7. B	Q1WU83	Elongation factor Tu	3.38e-07	NA	2.52e-12	NA
7. B	A4W2D1	Peptide chain release factor 3	1.19e-05	NA	1.18e-08	NA
7. B	Q2W2I8	Elongation factor G	2.61e-05	NA	1.41e-06	NA
7. B	A4VSN3	Elongation factor G	1.97e-05	NA	2.18e-09	NA
7. B	Q54XP6	Eukaryotic translation initiation factor 5B	1.91e-07	NA	9.03e-24	NA
7. B	B7GJ64	Elongation factor G	2.56e-05	NA	1.53e-09	NA
7. B	A9N2D8	Sulfate adenylyltransferase subunit 1	8.44e-05	NA	3.75e-05	NA
7. B	A2C4U5	Elongation factor Tu	3.36e-07	NA	1.63e-09	NA
7. B	B3E421	GTPase Der	3.17e-03	NA	0.002	NA
7. B	Q4QK37	Translation initiation factor IF-2	0.00e+00	NA	3.31e-155	NA
7. B	B9KHV3	Elongation factor G	2.23e-05	NA	2.37e-07	NA
7. B	C1KWN7	GTPase Der	7.01e-04	NA	0.014	NA
7. B	B3DQF0	Translation initiation factor IF-2	0.00e+00	NA	6.45e-161	NA
7. B	B2K3I2	Peptide chain release factor 3	1.03e-05	NA	7.50e-07	NA
7. B	A1KT27	Elongation factor 4	7.75e-07	NA	2.29e-10	NA
7. B	B8D7V3	Sulfate adenylyltransferase subunit 1	4.52e-04	NA	2.64e-04	NA
7. B	Q1CMZ7	Peptide chain release factor 3	1.11e-05	NA	7.37e-07	NA
7. B	Q9CDG1	Elongation factor G	3.33e-05	NA	3.70e-09	NA
7. B	A9B746	Elongation factor G	3.91e-05	NA	2.62e-07	NA
7. B	Q88T65	Elongation factor 4 2	1.05e-06	NA	2.99e-06	NA
7. B	Q8C3X4	Translation factor Guf1, mitochondrial	1.03e-04	NA	6.57e-12	NA
7. B	A7ZVR5	Peptide chain release factor 3	1.10e-05	NA	1.18e-07	NA
7. B	Q5PNI6	GTPase Der	4.92e-03	NA	0.018	NA
7. B	B7M7L5	GTPase Der	4.37e-03	NA	0.025	NA
7. B	C1CSB0	Elongation factor Tu	4.30e-07	NA	8.23e-11	NA
7. B	B5BEY8	Sulfate adenylyltransferase subunit 1	8.58e-05	NA	4.09e-05	NA
7. B	B2SF23	Peptide chain release factor 3	3.60e-05	NA	6.52e-08	NA
7. B	Q3J5S5	Elongation factor G	5.21e-05	NA	2.52e-08	NA
7. B	Q1LAN7	Elongation factor G 2	3.15e-05	NA	1.21e-08	NA
7. B	Q1ACI3	Elongation factor Tu, chloroplastic	2.37e-07	NA	4.88e-12	NA
7. B	Q2NW08	Peptide chain release factor 3	3.28e-05	NA	9.98e-07	NA
7. B	Q65ZX2	Translation initiation factor IF-2	0.00e+00	NA	8.41e-144	NA
7. B	Q1GAQ0	Elongation factor Tu	4.63e-07	NA	4.38e-13	NA
7. B	Q38BU9	Translation factor GUF1 homolog, mitochondrial	2.29e-04	NA	0.012	NA
7. B	A1JHT4	Probable GTP-binding protein EngB	4.36e-05	NA	0.034	NA
7. B	Q4QMT6	Elongation factor G	2.17e-05	NA	4.64e-08	NA
7. B	A5UYI1	Elongation factor Tu 2	6.27e-07	NA	1.40e-10	NA
7. B	Q8Y5W8	GTPase Der	7.76e-04	NA	0.014	NA
7. B	A1KB30	Elongation factor G	4.72e-05	NA	2.27e-06	NA
7. B	Q6MER8	Elongation factor G	2.45e-05	NA	1.32e-08	NA
7. B	Q492B2	Elongation factor Tu	4.36e-07	NA	4.87e-14	NA
7. B	C4YIT6	Translation factor GUF1, mitochondrial	2.42e-05	NA	8.92e-05	NA
7. B	O74945	Ribosome assembly protein 1	2.39e-02	NA	6.24e-09	NA
7. B	O58822	Probable translation initiation factor IF-2	4.55e-06	NA	5.54e-28	NA
7. B	A5F926	Translation initiation factor IF-2	0.00e+00	NA	2.12e-161	NA
7. B	B8AI54	Translation factor GUF1 homolog, chloroplastic	3.15e-06	NA	4.13e-11	NA
7. B	Q7U5L9	Elongation factor 4	1.95e-06	NA	1.87e-11	NA
7. B	A7GZW3	Elongation factor 4	6.29e-07	NA	4.91e-11	NA
7. B	B8F7Z4	Elongation factor G	2.53e-05	NA	1.37e-07	NA
7. B	Q0SN31	Elongation factor Tu	3.73e-07	NA	3.35e-10	NA
7. B	B9DTQ3	GTPase Der	1.42e-03	NA	4.45e-04	NA
7. B	D0NKK0	Translation factor GUF1 homolog, mitochondrial	4.77e-06	NA	2.73e-05	NA
7. B	Q889X4	Elongation factor G	4.13e-05	NA	5.19e-08	NA
7. B	P61878	Elongation factor 2	5.62e-05	NA	7.49e-11	NA
7. B	B0TX03	Elongation factor Tu	5.07e-07	NA	3.75e-12	NA
7. B	Q3MG20	Elongation factor 4	3.90e-07	NA	8.06e-11	NA
7. B	O33594	Elongation factor Tu	4.30e-07	NA	6.16e-10	NA
7. B	Q0JY21	Peptide chain release factor 3	1.86e-04	NA	3.77e-07	NA
7. B	Q6N4T4	Elongation factor G	2.90e-05	NA	4.56e-09	NA
7. B	P0CE48	Elongation factor Tu 2	6.46e-07	NA	1.17e-13	NA
7. B	Q9K0H6	Peptide chain release factor 3	1.44e-05	NA	3.08e-06	NA
7. B	A5WBS5	Translation initiation factor IF-2	0.00e+00	NA	7.02e-144	NA
7. B	C4KHE9	Elongation factor 2	4.96e-04	NA	2.49e-08	NA
7. B	B2JFK0	Elongation factor 4	1.28e-06	NA	3.94e-07	NA
7. B	Q04PT6	Elongation factor Tu	1.82e-07	NA	1.62e-14	NA
7. B	A1WVD6	Elongation factor Tu 2	5.24e-07	NA	1.84e-12	NA
7. B	P56893	Sulfate adenylyltransferase subunit 1	4.29e-05	NA	3.68e-04	NA
7. B	Q6LVC0	Elongation factor Tu 1	5.04e-07	NA	1.16e-12	NA
7. B	A8FKR7	Elongation factor G	2.84e-05	NA	1.66e-07	NA
7. B	A4VHL6	Elongation factor Tu 1	4.49e-07	NA	3.82e-09	NA
7. B	A9KLK7	GTPase Der	5.45e-03	NA	0.017	NA
7. B	Q7NVN5	Sulfate adenylyltransferase subunit 1	2.12e-05	NA	6.26e-04	NA
7. B	Q0HXQ8	Peptide chain release factor 3	3.86e-05	NA	2.26e-05	NA
7. B	B0U0Z1	Elongation factor G	1.26e-05	NA	1.26e-08	NA
7. B	A7ZPV4	GTPase Der	3.71e-03	NA	0.025	NA
7. B	Q2LQA3	Elongation factor Tu	5.38e-07	NA	2.21e-11	NA
7. B	Q6GI64	Peptide chain release factor 3	1.98e-05	NA	2.20e-09	NA
7. B	B5FTB7	Peptide chain release factor 3	1.10e-05	NA	1.28e-07	NA
7. B	Q8ZJS0	Probable GTP-binding protein EngB	5.00e-05	NA	0.006	NA
7. B	P32253	Ras-like protein rasC	2.83e-06	NA	0.005	NA
7. B	Q31SW4	Peptide chain release factor 3	1.06e-05	NA	1.18e-07	NA
7. B	Q5PK12	Peptide chain release factor 3	1.11e-05	NA	1.28e-07	NA
7. B	P0A559	Elongation factor Tu	4.89e-07	NA	2.16e-09	NA
7. B	A4IJI7	Elongation factor Tu	3.00e-07	NA	7.20e-15	NA
7. B	Q5FA25	Peptide chain release factor 3	2.69e-05	NA	3.39e-06	NA
7. B	A1BHJ8	Elongation factor 4	3.49e-06	NA	2.72e-06	NA
7. B	Q2LWU6	Translation initiation factor IF-2	0.00e+00	NA	1.41e-162	NA
7. B	Q49V58	Elongation factor Tu	3.59e-07	NA	2.00e-13	NA
7. B	Q6CZW6	Elongation factor Tu	5.62e-07	NA	5.42e-13	NA
7. B	Q07803	Elongation factor G, mitochondrial	1.80e-04	NA	2.75e-09	NA
7. B	B9DVS2	Elongation factor G	2.82e-05	NA	4.45e-09	NA
7. B	B0RQB0	Peptide chain release factor 3	5.91e-05	NA	2.69e-05	NA
7. B	P0DA84	Elongation factor G	2.44e-05	NA	1.50e-08	NA
7. B	A5IQA1	Elongation factor G	1.17e-05	NA	3.56e-08	NA
7. B	A3DMV6	Elongation factor 2	1.30e-04	NA	1.98e-10	NA
7. B	Q601W8	Elongation factor G	4.86e-05	NA	1.54e-09	NA
7. B	Q2RFP5	Elongation factor Tu	4.78e-07	NA	1.97e-13	NA
7. B	B3WAM2	Elongation factor G	6.62e-05	NA	6.55e-09	NA
7. B	Q9SI75	Elongation factor G, chloroplastic	1.05e-04	NA	1.10e-06	NA
7. B	Q1C237	Probable GTP-binding protein EngB	4.81e-05	NA	0.006	NA
7. B	Q5L6S5	Elongation factor G	1.40e-04	NA	2.50e-08	NA
7. B	O31297	Elongation factor Tu	4.67e-07	NA	7.97e-13	NA
7. B	Q48791	Tetracycline resistance protein TetS	2.82e-05	NA	2.48e-12	NA
7. B	Q16BA3	Elongation factor 4	3.38e-06	NA	6.32e-08	NA
7. B	P50063	Elongation factor Tu (Fragment)	2.99e-07	NA	0.012	NA
7. B	A8AWA0	Elongation factor Tu	4.43e-07	NA	5.00e-11	NA
7. B	A1A0T0	Elongation factor G	7.18e-05	NA	2.49e-09	NA
7. B	Q6FLG2	Ribosome-releasing factor 2, mitochondrial	3.82e-03	NA	8.65e-05	NA
7. B	Q2YAZ9	Elongation factor Tu	4.87e-07	NA	5.52e-12	NA
7. B	Q9FNM5	Translation factor GUF1 homolog, chloroplastic	4.82e-06	NA	8.43e-09	NA
7. B	Q3YV04	Elongation factor Tu 2	5.88e-07	NA	1.17e-13	NA
7. B	A7GZJ4	Elongation factor G	6.34e-05	NA	4.34e-08	NA
7. B	C3PKP1	Elongation factor G	2.12e-05	NA	1.83e-10	NA
7. B	Q8DD27	Elongation factor Tu 1	4.35e-07	NA	1.41e-12	NA
7. B	A5N4N1	Elongation factor Tu	3.46e-07	NA	2.55e-11	NA
7. B	B6J266	Elongation factor G	2.53e-05	NA	3.20e-08	NA
7. B	A4XI37	Elongation factor Tu	4.84e-07	NA	1.15e-12	NA
7. B	B2FN90	Translation initiation factor IF-2	0.00e+00	NA	5.74e-150	NA
7. B	Q6AL53	Elongation factor 4	1.18e-06	NA	1.06e-10	NA
7. B	A3PEZ7	Elongation factor Tu	3.50e-07	NA	6.21e-10	NA
7. B	P0A3A9	Elongation factor Tu	4.43e-07	NA	2.62e-14	NA
7. B	B9IZJ1	Elongation factor G	3.34e-05	NA	1.83e-09	NA
7. B	P59451	Elongation factor G	1.92e-05	NA	3.14e-08	NA
7. B	Q7W455	Elongation factor G 2	2.96e-05	NA	1.06e-07	NA
7. B	Q03LX0	Elongation factor Tu	4.21e-07	NA	1.96e-11	NA
7. B	P42474	Elongation factor Tu	3.35e-07	NA	1.12e-11	NA
7. B	Q92D33	Peptide chain release factor 3	4.45e-05	NA	2.05e-06	NA
7. B	A8F982	Elongation factor Tu	3.00e-07	NA	4.96e-12	NA
7. B	A4FUD3	116 kDa U5 small nuclear ribonucleoprotein component	1.84e-02	NA	3.03e-07	NA
7. B	B3PI96	Translation initiation factor IF-2	0.00e+00	NA	2.40e-157	NA
7. B	Q9CGI8	Elongation factor 4	6.76e-06	NA	4.00e-10	NA
7. B	Q8CJQ8	Translation initiation factor IF-2	0.00e+00	NA	9.75e-158	NA
7. B	Q5UYS2	Translation initiation factor 2 subunit gamma	8.19e-06	NA	5.81e-06	NA
7. B	A7GHG2	GTPase Era	9.57e-04	NA	5.17e-05	NA
7. B	P39677	Ribosome-releasing factor 2, mitochondrial	5.54e-05	NA	8.53e-07	NA
7. B	P0A1H3	Elongation factor G	2.56e-05	NA	7.70e-07	NA
7. B	Q1RHL9	Elongation factor Tu	5.11e-07	NA	1.97e-11	NA
7. B	A3Q980	Elongation factor Tu 2	5.03e-07	NA	6.68e-14	NA
7. B	A7TPD4	Translation factor GUF1, mitochondrial	4.55e-05	NA	1.45e-04	NA
7. B	P29691	Elongation factor 2	5.14e-03	NA	2.09e-04	NA
7. B	Q2K9N2	Elongation factor Tu 1	3.96e-07	NA	2.30e-10	NA
7. B	P64065	GTPase Der	1.59e-03	NA	3.51e-05	NA
7. B	C5CP58	Elongation factor G	1.63e-04	NA	7.57e-08	NA
7. B	Q46QA5	Peptide chain release factor 3	1.72e-04	NA	8.51e-07	NA
7. B	Q48UK5	Elongation factor Tu	4.14e-07	NA	1.81e-12	NA
7. B	A7GZK6	Elongation factor Tu	4.42e-07	NA	1.04e-10	NA
7. B	Q2YSB3	Elongation factor Tu	3.62e-07	NA	3.46e-12	NA
7. B	C0RJK4	Elongation factor G	3.07e-05	NA	1.13e-09	NA
7. B	Q482T9	Translation initiation factor IF-2	0.00e+00	NA	1.25e-163	NA
7. B	B7HHQ7	GTPase Der	8.90e-04	NA	0.016	NA
7. B	A6YG72	Elongation factor Tu, chloroplastic	4.15e-07	NA	7.02e-09	NA
7. B	Q83MZ5	Elongation factor 4	3.31e-06	NA	2.51e-06	NA
7. B	A0AHA7	Peptide chain release factor 3	3.06e-05	NA	1.86e-06	NA
7. B	Q318P8	Translation initiation factor IF-2	0.00e+00	NA	1.37e-157	NA
7. B	Q9SHI1	Translation initiation factor IF-2, chloroplastic	0.00e+00	NA	4.59e-139	NA
7. B	C3K2X8	Elongation factor Tu	4.93e-07	NA	1.29e-07	NA
7. B	P50380	Elongation factor Tu, chloroplastic (Fragment)	2.12e-07	NA	0.009	NA
7. B	Q83ES7	Elongation factor G	2.51e-05	NA	3.74e-08	NA
7. B	A0Q4I1	Elongation factor G	1.40e-06	NA	7.88e-09	NA
7. B	A0L5V8	Elongation factor Tu	5.51e-07	NA	1.97e-12	NA
7. B	Q877T5	Elongation factor Tu	3.84e-07	NA	3.46e-13	NA
7. B	Q6CUH2	Translation factor GUF1, mitochondrial	1.40e-05	NA	1.49e-04	NA
7. B	P57997	Translation initiation factor IF-2, chloroplastic	NA	NA	3.21e-129	NA
7. B	Q9Z8M1	Translation initiation factor IF-2	0.00e+00	NA	2.18e-119	NA
7. B	Q5AL45	Elongation factor G, mitochondrial	1.26e-04	NA	6.06e-09	NA
7. B	B5XJR1	Elongation factor G	2.40e-05	NA	1.58e-08	NA
7. B	B9LJC8	Elongation factor G	3.71e-05	NA	2.46e-06	NA
7. B	C1A6Q3	Elongation factor Tu	6.52e-07	NA	3.32e-09	NA
7. B	Q63H92	Elongation factor Tu	3.25e-07	NA	2.96e-14	NA
7. B	A5GVG4	Translation initiation factor IF-2	0.00e+00	NA	1.08e-154	NA
7. B	B8GTY2	Peptide chain release factor 3	4.54e-05	NA	2.13e-06	NA
7. B	B5F516	Peptide chain release factor 3	3.21e-05	NA	1.28e-07	NA
7. B	Q5F797	Translation initiation factor IF-2	0.00e+00	NA	2.77e-152	NA
7. B	P64030	Elongation factor Tu	4.30e-07	NA	8.23e-11	NA
7. B	A4JCQ9	Elongation factor 4	1.15e-06	NA	6.04e-08	NA
7. B	B7JGY9	GTPase Der	8.81e-04	NA	0.016	NA
7. B	A7NE28	Peptide chain release factor 3	2.75e-05	NA	8.10e-08	NA
7. B	A5I626	GTPase Era	8.13e-04	NA	3.31e-05	NA
7. B	Q4UWA2	Translation initiation factor IF-2	0.00e+00	NA	2.87e-156	NA
7. B	Q2JDK2	Elongation factor 4	3.59e-06	NA	1.67e-06	NA
7. B	C6C0G0	GTPase Der	1.75e-03	NA	0.002	NA
7. B	A0Q453	Elongation factor 4	1.98e-06	NA	7.42e-09	NA
7. B	Q7VQM3	Translation initiation factor IF-2	0.00e+00	NA	3.13e-137	NA
7. B	Q32B26	Elongation factor G	2.13e-05	NA	1.30e-07	NA
7. B	Q5M364	Peptide chain release factor 3	1.70e-05	NA	1.72e-06	NA
7. B	A6W5T4	Elongation factor G	3.41e-05	NA	4.88e-08	NA
7. B	Q0ANN1	Elongation factor Tu	4.34e-07	NA	1.91e-12	NA
7. B	Q5JFZ4	Elongation factor 1-alpha	3.11e-07	NA	5.15e-08	NA
7. B	C1FSU2	GTPase Der	1.31e-03	NA	4.24e-05	NA
7. B	P15112	Elongation factor 2	4.33e-04	NA	2.75e-07	NA
7. B	Q7TTF9	Elongation factor Tu	5.17e-07	NA	6.99e-14	NA
7. B	Q9Z0N1	Eukaryotic translation initiation factor 2 subunit 3, X-linked	7.63e-07	NA	0.022	NA
7. B	Q8KTB6	Elongation factor G	7.93e-05	NA	1.58e-08	NA
7. B	P99152	Elongation factor Tu	3.92e-07	NA	3.46e-12	NA
7. B	B7J241	Elongation factor Tu	3.75e-07	NA	5.81e-11	NA
7. B	B0WXB8	Translation factor GUF1 homolog, mitochondrial	2.51e-05	NA	8.72e-08	NA
7. B	Q3A4Q5	GTPase Der	1.97e-03	NA	0.003	NA
7. B	Q7VYR2	Translation initiation factor IF-2	0.00e+00	NA	9.53e-155	NA
7. B	Q3ILP4	Elongation factor Tu 1	4.40e-07	NA	1.35e-15	NA
7. B	Q980M3	GTPase HflX	1.21e-02	NA	0.001	NA
7. B	C0MBF0	GTPase Era	9.84e-04	NA	3.46e-04	NA
7. B	Q3A6R2	Elongation factor Tu 1	5.85e-07	NA	9.47e-13	NA
7. B	B2IPC3	GTPase Era	4.27e-03	NA	1.86e-04	NA
7. B	Q7UMZ0	Elongation factor Tu	7.03e-07	NA	1.47e-08	NA
7. B	O50274	Bifunctional enzyme CysN/CysC	2.35e-04	NA	5.53e-05	NA
7. B	B1VYN5	Translation initiation factor IF-2	0.00e+00	NA	6.99e-157	NA
7. B	Q53770	Tetracycline resistance protein TetM	1.53e-05	NA	1.01e-09	NA
7. B	Q5FFE6	Elongation factor Tu	7.11e-06	NA	1.94e-08	NA
7. B	C5CSF2	Elongation factor 4	1.04e-06	NA	2.77e-08	NA
7. B	A5CF23	Elongation factor G	2.64e-05	NA	5.06e-07	NA
7. B	C1AYS3	Elongation factor Tu	4.20e-07	NA	1.88e-10	NA
7. B	Q5WZL5	Elongation factor G	4.80e-06	NA	2.83e-06	NA
7. B	C0ZVT6	Elongation factor G	5.35e-05	NA	1.58e-09	NA
7. B	Q9KUZ7	Elongation factor G 1	3.20e-05	NA	1.20e-07	NA
7. B	A4XBP8	Elongation factor Tu	5.75e-07	NA	2.05e-08	NA
7. B	B6H460	Elongation factor G, mitochondrial	9.37e-04	NA	8.46e-07	NA
7. B	Q0TPJ9	GTPase Der	1.50e-03	NA	1.89e-04	NA
7. B	A7MGA3	Peptide chain release factor 3	1.02e-05	NA	1.31e-07	NA
7. B	B0BRI9	Peptide chain release factor 3	1.19e-05	NA	6.74e-06	NA
7. B	O59410	Translation initiation factor 2 subunit gamma	2.07e-05	NA	4.64e-07	NA
7. B	Q6AXM7	HBS1-like protein	2.61e-04	NA	0.007	NA
7. B	A6QNM2	Ribosome-releasing factor 2, mitochondrial	3.51e-04	NA	8.65e-08	NA
7. B	Q1DLM0	Elongation factor G, mitochondrial	1.31e-03	NA	9.62e-07	NA
7. B	B7IHU4	Elongation factor Tu	3.34e-07	NA	9.19e-13	NA
7. B	A6LHS1	Translation initiation factor IF-2	0.00e+00	NA	5.77e-157	NA
7. B	P0A6N2	Elongation factor Tu	5.45e-07	NA	1.17e-13	NA
7. B	Q06J54	Elongation factor Tu, chloroplastic	3.00e-07	NA	2.35e-10	NA
7. B	C6HPI9	Translation factor GUF1, mitochondrial	1.11e-05	NA	2.69e-06	NA
7. B	C3L3F3	GTPase Era	9.13e-04	NA	6.02e-05	NA
7. B	Q6FZC0	Elongation factor Tu 1	4.02e-07	NA	1.16e-11	NA
7. B	Q39I75	Elongation factor 4	1.07e-06	NA	2.85e-08	NA
7. B	P0DD96	Peptide chain release factor 3	4.91e-05	NA	3.64e-08	NA
7. B	A7NEC7	Elongation factor Tu	5.23e-07	NA	2.69e-13	NA
7. B	Q6ASC7	Elongation factor G 1	9.36e-05	NA	1.74e-07	NA
7. B	P50375	Elongation factor Tu, chloroplastic (Fragment)	5.64e-05	NA	0.001	NA
7. B	A5I644	Elongation factor 4	1.60e-06	NA	1.28e-09	NA
7. B	A9NEN3	Elongation factor G	2.29e-05	NA	3.03e-10	NA
7. B	B7KR78	Elongation factor 4	9.70e-07	NA	2.13e-08	NA
7. B	P53530	Elongation factor 4	3.85e-05	NA	7.72e-11	NA
7. B	Q74CT3	Translation initiation factor IF-2	0.00e+00	NA	1.06e-180	NA
7. B	A4WMR8	Elongation factor 2	3.65e-05	NA	9.98e-08	NA
7. B	B3RDA4	Peptide chain release factor 3	1.47e-04	NA	4.07e-07	NA
7. B	A9AAA4	Translation initiation factor 2 subunit gamma	6.29e-07	NA	5.95e-05	NA
7. B	A5F578	Sulfate adenylyltransferase subunit 1	1.10e-05	NA	1.39e-05	NA
7. B	Q8MQT8	GTP-binding protein Sar1	3.59e-03	NA	0.010	NA
7. B	B5BAY9	GTPase Der	5.15e-03	NA	0.018	NA
7. B	Q6GJC1	Elongation factor G	1.20e-05	NA	3.56e-08	NA
7. B	Q3JQ75	Elongation factor 4	1.33e-06	NA	5.27e-09	NA
7. B	Q6NJD6	Elongation factor G	7.52e-05	NA	3.82e-09	NA
7. B	Q0AUH7	Elongation factor G 2	5.63e-05	NA	1.16e-08	NA
7. B	B5E488	GTPase Era	NA	NA	1.43e-04	NA
7. B	B7UJ63	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	B3DT30	Elongation factor G	1.30e-04	NA	9.96e-09	NA
7. B	B1IQV3	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q3KMS4	Translation initiation factor IF-2	0.00e+00	NA	5.91e-127	NA
7. B	P18906	Elongation factor Tu	4.71e-07	NA	1.53e-12	NA
7. B	A6QEJ9	Elongation factor G	1.14e-05	NA	3.88e-08	NA
7. B	Q47RQ0	Elongation factor 4	3.57e-06	NA	5.37e-07	NA
7. B	A4YCV9	Elongation factor 2	3.32e-04	NA	2.46e-07	NA
7. B	Q28UW8	Elongation factor G	2.58e-05	NA	4.06e-08	NA
7. B	Q5YPG4	Elongation factor Tu	4.94e-07	NA	1.21e-08	NA
7. B	Q4QMW6	Elongation factor Tu 1	4.90e-07	NA	1.58e-13	NA
7. B	Q9ZF28	Translation initiation factor IF-2	0.00e+00	NA	1.48e-155	NA
7. B	Q5F3X4	116 kDa U5 small nuclear ribonucleoprotein component	1.45e-02	NA	1.16e-07	NA
7. B	Q07TF1	Elongation factor 4	2.29e-06	NA	6.38e-07	NA
7. B	B2FR00	Peptide chain release factor 3	1.96e-05	NA	5.07e-06	NA
7. B	A6U856	Elongation factor G	3.92e-05	NA	1.58e-10	NA
7. B	Q3ZXX3	Elongation factor Tu	5.55e-07	NA	2.27e-09	NA
7. B	Q93PU8	Elongation factor Tu (Fragment)	5.98e-04	NA	2.09e-04	NA
7. B	B7K834	Elongation factor Tu	4.18e-07	NA	2.39e-10	NA
7. B	Q9YC19	Elongation factor 2	1.33e-04	NA	2.31e-09	NA
7. B	Q2Y7W2	Translation initiation factor IF-2	0.00e+00	NA	2.62e-156	NA
7. B	Q8PI56	Peptide chain release factor 3	1.34e-05	NA	3.17e-05	NA
7. B	B7HQU1	Elongation factor G	2.85e-05	NA	1.83e-09	NA
7. B	B3DT29	Elongation factor Tu	3.78e-07	NA	3.79e-08	NA
7. B	A5IYA9	Elongation factor Tu	4.45e-07	NA	7.24e-13	NA
7. B	Q4FQG6	Elongation factor Tu	5.45e-07	NA	3.10e-06	NA
7. B	Q0CS42	Translation factor guf1, mitochondrial	3.77e-05	NA	2.02e-07	NA
7. B	B4UHG0	Translation initiation factor IF-2	0.00e+00	NA	4.81e-146	NA
7. B	P18668	Elongation factor Tu	3.43e-07	NA	5.76e-10	NA
7. B	Q8YEB3	Translation initiation factor IF-2	0.00e+00	NA	1.08e-159	NA
7. B	Q7MZN3	Peptide chain release factor 3	3.04e-05	NA	9.39e-07	NA
7. B	B2SSM9	Peptide chain release factor 3	4.84e-05	NA	2.93e-05	NA
7. B	O63930	Elongation factor Tu, chloroplastic (Fragment)	1.61e-06	NA	1.67e-06	NA
7. B	Q3IYN5	Translation initiation factor IF-2	0.00e+00	NA	3.53e-147	NA
7. B	Q1AU14	Elongation factor Tu	5.26e-07	NA	1.66e-14	NA
7. B	Q2SL35	Elongation factor 4	9.36e-07	NA	6.27e-10	NA
7. B	Q6FYA7	Elongation factor 2	5.24e-04	NA	3.34e-06	NA
7. B	A8M532	Elongation factor G	3.77e-05	NA	1.62e-08	NA
7. B	A7WYX4	Elongation factor G	7.62e-05	NA	3.56e-08	NA
7. B	B0K3Y4	Elongation factor 4	3.37e-06	NA	2.48e-09	NA
7. B	Q826Z7	Elongation factor Tu 2	5.24e-06	NA	2.61e-10	NA
7. B	A5DI11	Elongation factor 2	6.01e-03	NA	1.79e-05	NA
7. B	B1IVA7	Elongation factor Tu 2	5.99e-07	NA	1.17e-13	NA
7. B	Q11HA6	Elongation factor Tu	4.15e-07	NA	2.82e-12	NA
7. B	P70882	Tetracycline resistance protein TetQ	2.93e-05	NA	7.37e-07	NA
7. B	O59153	Elongation factor 1-alpha	3.65e-06	NA	3.23e-06	NA
7. B	Q8PC51	Elongation factor Tu-B	4.43e-07	NA	4.54e-09	NA
7. B	A4J0Z5	Elongation factor Tu	4.54e-07	NA	3.74e-12	NA
7. B	Q5FLA9	Peptide chain release factor 3	5.56e-05	NA	1.75e-08	NA
7. B	A5VJK4	GTPase Der	1.63e-03	NA	1.30e-04	NA
7. B	Q1GP97	Elongation factor Tu	4.79e-07	NA	3.95e-10	NA
7. B	Q6CPQ9	Elongation factor 2	6.19e-03	NA	2.04e-05	NA
7. B	B2GIL2	Elongation factor Tu	4.99e-07	NA	2.77e-06	NA
7. B	A5IMD9	GTPase Der	6.00e-03	NA	0.012	NA
7. B	Q21SF0	Elongation factor Tu 1	4.65e-07	NA	5.41e-14	NA
7. B	A9MRB6	Peptide chain release factor 3	3.22e-05	NA	1.26e-07	NA
7. B	P56292	Elongation factor Tu, chloroplastic	3.94e-07	NA	4.25e-12	NA
7. B	O93637	Elongation factor 2	3.04e-05	NA	3.85e-08	NA
7. B	Q4A9G1	Elongation factor Tu	4.57e-07	NA	1.97e-10	NA
7. B	B7N6Y1	Sulfate adenylyltransferase subunit 1	6.65e-06	NA	5.33e-05	NA
7. B	Q4WYV0	Translation factor guf1, mitochondrial	3.48e-05	NA	1.17e-06	NA
7. B	P0C0B9	GTPase Era	1.64e-03	NA	8.43e-04	NA
7. B	Q5LES3	Sulfate adenylyltransferase subunit 1	4.65e-04	NA	1.34e-05	NA
7. B	Q8ZMF5	Sulfate adenylyltransferase subunit 1	9.32e-05	NA	3.50e-05	NA
7. B	P26184	Elongation factor Tu	5.27e-07	NA	1.86e-11	NA
7. B	Q7WDS1	Peptide chain release factor 3	1.85e-04	NA	5.61e-08	NA
7. B	A3MK70	GTPase Der	2.70e-03	NA	0.024	NA
7. B	C5CLW3	Translation initiation factor IF-2	0.00e+00	NA	4.29e-162	NA
7. B	Q3J8R1	Elongation factor G	4.75e-05	NA	5.27e-08	NA
7. B	A5ELN0	Elongation factor G	2.64e-05	NA	7.72e-09	NA
7. B	P25039	Elongation factor G, mitochondrial	3.47e-05	NA	1.96e-09	NA
7. B	B2HSL2	Elongation factor G	1.32e-04	NA	2.49e-09	NA
7. B	A8G708	Elongation factor Tu	3.00e-07	NA	6.26e-10	NA
7. B	B0JSE0	Elongation factor Tu	3.61e-07	NA	3.19e-08	NA
7. B	Q7VRQ8	Elongation factor 4	1.66e-06	NA	1.59e-06	NA
7. B	B2G8K6	Peptide chain release factor 3	1.62e-04	NA	8.99e-09	NA
7. B	A5GIP1	Elongation factor G	1.04e-04	NA	2.76e-10	NA
7. B	Q5L890	Elongation factor Tu	3.65e-07	NA	2.81e-13	NA
7. B	A4IZT6	Elongation factor G	5.53e-05	NA	8.22e-09	NA
7. B	B7M1P1	Elongation factor G	2.54e-05	NA	1.30e-07	NA
7. B	Q74ZG2	Translation factor GUF1, mitochondrial	3.03e-05	NA	3.22e-04	NA
7. B	Q8ZZC1	Elongation factor 2	3.22e-05	NA	2.89e-08	NA
7. B	Q3AW54	Elongation factor G	1.06e-04	NA	1.16e-09	NA
7. B	Q9VM33	Elongation factor G, mitochondrial	7.95e-04	NA	1.69e-10	NA
7. B	Q88VS0	GTPase Era	1.34e-03	NA	0.011	NA
7. B	Q2JFH8	Elongation factor Tu	4.92e-07	NA	7.16e-10	NA
7. B	C1CPE5	Elongation factor G	5.27e-05	NA	2.00e-09	NA
7. B	Q1R6H0	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	B0U1Q8	Translation initiation factor IF-2	0.00e+00	NA	3.33e-151	NA
7. B	B0KBA1	Probable GTP-binding protein EngB	2.09e-05	NA	0.023	NA
7. B	B3E9R0	Elongation factor 4	2.22e-06	NA	2.97e-07	NA
7. B	C6E0Y6	GTPase Der	3.32e-03	NA	0.004	NA
7. B	Q9KU64	Peptide chain release factor 3	1.21e-05	NA	2.07e-06	NA
7. B	Q1QDP8	Peptide chain release factor 3	1.12e-05	NA	7.50e-05	NA
7. B	O67679	Probable GTP-binding protein EngB	2.24e-05	NA	0.005	NA
7. B	A7HBL7	Elongation factor Tu	4.29e-07	NA	3.38e-13	NA
7. B	Q33451	Elongation factor Tu, apicoplast	4.44e-07	NA	2.47e-10	NA
7. B	Q83NA0	Elongation factor G	2.98e-05	NA	2.58e-08	NA
7. B	A7MKJ6	Elongation factor G	2.42e-05	NA	8.04e-07	NA
7. B	O96719	Eukaryotic translation initiation factor 2 subunit gamma	4.31e-07	NA	0.028	NA
7. B	Q5N0A5	Translation initiation factor IF-2	0.00e+00	NA	5.64e-159	NA
7. B	A7MQE1	Translation initiation factor IF-2	0.00e+00	NA	1.33e-152	NA
7. B	P14634	Elongation factor Tu, plastid	3.87e-07	NA	2.85e-11	NA
7. B	A5D5I7	Elongation factor G	6.84e-05	NA	5.38e-08	NA
7. B	P60794	Elongation factor 4	3.22e-06	NA	6.74e-09	NA
7. B	P0A705	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q62GK3	Elongation factor Tu	4.48e-07	NA	3.06e-12	NA
7. B	B5FGJ9	Sulfate adenylyltransferase subunit 1	8.44e-06	NA	2.77e-05	NA
7. B	A0PXT1	Elongation factor Tu	3.36e-07	NA	8.94e-10	NA
7. B	B5F6T8	Translation initiation factor IF-2	0.00e+00	NA	3.44e-152	NA
7. B	P13552	Elongation factor Tu	4.65e-07	NA	6.43e-10	NA
7. B	Q04KV9	GTPase Era	1.38e-03	NA	1.86e-04	NA
7. B	Q12SW1	Elongation factor Tu	4.61e-07	NA	8.95e-13	NA
7. B	Q81VT3	Elongation factor G	1.29e-05	NA	1.95e-09	NA
7. B	A4FWW9	Translation initiation factor 2 subunit gamma	5.23e-07	NA	1.03e-05	NA
7. B	A4SRG8	Sulfate adenylyltransferase subunit 1	3.78e-05	NA	2.85e-04	NA
7. B	Q47JA5	Elongation factor Tu	4.81e-07	NA	1.24e-11	NA
7. B	A7H9F3	Translation initiation factor IF-2	0.00e+00	NA	1.81e-152	NA
7. B	A4WVL0	Elongation factor Tu	3.85e-07	NA	4.62e-11	NA
7. B	Q48D33	Elongation factor G	2.27e-05	NA	5.15e-08	NA
7. B	O33581	Sulfate adenylyltransferase subunit 1	3.59e-04	NA	8.20e-05	NA
7. B	A6W5T5	Elongation factor Tu	4.42e-07	NA	8.02e-09	NA
7. B	A9KW88	Elongation factor Tu 1	4.59e-07	NA	5.87e-13	NA
7. B	A3MRT8	Elongation factor Tu	4.71e-07	NA	3.06e-12	NA
7. B	B4RMZ3	Translation initiation factor IF-2	0.00e+00	NA	2.26e-152	NA
7. B	Q7U4D1	Elongation factor Tu	3.12e-07	NA	2.25e-08	NA
7. B	B8D9W5	Peptide chain release factor 3	3.21e-05	NA	3.20e-09	NA
7. B	Q1J5X1	Peptide chain release factor 3	1.70e-05	NA	3.64e-08	NA
7. B	Q2LUL6	Elongation factor G 2	1.13e-05	NA	1.12e-08	NA
7. B	Q21HQ0	Peptide chain release factor 3	1.16e-05	NA	1.31e-06	NA
7. B	B7L0X9	Sulfate adenylyltransferase subunit 1	1.16e-04	NA	0.006	NA
7. B	A0M3Z6	Elongation factor Tu	4.98e-07	NA	3.03e-10	NA
7. B	Q3A445	Elongation factor 4	3.17e-06	NA	2.62e-09	NA
7. B	A5USJ2	Elongation factor G	2.81e-05	NA	5.06e-06	NA
7. B	Q9JTB5	Translation initiation factor IF-2	0.00e+00	NA	1.21e-152	NA
7. B	O27132	Elongation factor 1-alpha	2.73e-06	NA	0.049	NA
7. B	Q0AF46	Elongation factor Tu 2	4.93e-07	NA	2.41e-08	NA
7. B	Q00937	Tetracycline resistance protein TetQ	2.24e-05	NA	5.79e-07	NA
7. B	A4XL70	Translation initiation factor IF-2	0.00e+00	NA	0.0	NA
7. B	Q1BDD3	Elongation factor Tu	4.70e-07	NA	1.55e-09	NA
7. B	A1V3N4	Translation initiation factor IF-2	0.00e+00	NA	4.13e-169	NA
7. B	A5V604	Elongation factor Tu	4.42e-07	NA	7.55e-12	NA
7. B	B5R2J0	Peptide chain release factor 3	3.29e-05	NA	1.28e-07	NA
7. B	A1AX82	Elongation factor Tu 2	4.27e-07	NA	5.87e-09	NA
7. B	A5GW14	Elongation factor Tu	3.10e-07	NA	1.05e-08	NA
7. B	B3EP64	Elongation factor G	3.49e-05	NA	2.96e-07	NA
7. B	B8HD11	Elongation factor Tu	5.21e-07	NA	2.07e-06	NA
7. B	B0SUQ7	Elongation factor Tu 1	4.90e-07	NA	3.70e-10	NA
7. B	Q1JD46	GTPase Era	8.21e-04	NA	6.99e-04	NA
7. B	B7L4L1	Elongation factor G	2.37e-05	NA	1.30e-07	NA
7. B	A9KFG7	Peptide chain release factor 3	1.54e-05	NA	4.88e-07	NA
7. B	Q1JMR3	Elongation factor Tu	5.09e-07	NA	1.81e-12	NA
7. B	B0V8Y3	Elongation factor G	1.32e-04	NA	4.39e-07	NA
7. B	Q0ICF2	Elongation factor 4	1.82e-06	NA	1.35e-11	NA
7. B	B4M416	Ribosome-releasing factor 2, mitochondrial	1.79e-03	NA	1.29e-04	NA
7. B	B9W892	Ribosome-releasing factor 2, mitochondrial	3.07e-04	NA	1.56e-09	NA
7. B	Q82SJ6	GTPase Era	1.04e-02	NA	0.007	NA
7. B	Q1JNH7	Elongation factor G	2.28e-05	NA	1.50e-08	NA
7. B	Q1QS64	Translation initiation factor IF-2	0.00e+00	NA	8.73e-152	NA
7. B	B3LT39	Elongation factor G, mitochondrial	7.09e-05	NA	1.91e-09	NA
7. B	Q8D240	Elongation factor Tu	4.71e-07	NA	8.44e-17	NA
7. B	C3LR06	Elongation factor 4	9.43e-07	NA	3.29e-12	NA
7. B	P21598	Tetracycline resistance protein TetM from transposon Tn916	1.18e-05	NA	1.07e-10	NA
7. B	B1I6E0	Elongation factor 4	2.47e-06	NA	8.90e-10	NA
7. B	Q8EPY0	GTPase Era	2.37e-03	NA	0.009	NA
7. B	B4JSI3	Ribosome-releasing factor 2, mitochondrial	4.96e-04	NA	6.55e-06	NA
7. B	Q0HLF4	Peptide chain release factor 3	2.44e-05	NA	2.26e-05	NA
7. B	A5EX84	Elongation factor Tu	4.55e-07	NA	9.66e-11	NA
7. B	Q7MV56	Elongation factor 4	1.02e-06	NA	3.67e-07	NA
7. B	A2S2L1	Translation initiation factor IF-2	0.00e+00	NA	4.13e-169	NA
7. B	B2GDX1	Elongation factor G	7.10e-05	NA	1.60e-08	NA
7. B	Q6D9Z5	Peptide chain release factor 3	1.08e-05	NA	2.33e-06	NA
7. B	A6THZ0	Peptide chain release factor 3	1.13e-05	NA	1.37e-07	NA
7. B	P72689	Translation initiation factor IF-2	0.00e+00	NA	9.30e-154	NA
7. B	Q1D513	Elongation factor G 3	1.38e-05	NA	3.81e-08	NA
7. B	A5U9R0	Elongation factor G	1.96e-05	NA	5.85e-08	NA
7. B	Q83JC3	Elongation factor G	2.50e-05	NA	1.39e-07	NA
7. B	A3NEI1	Elongation factor Tu	4.47e-07	NA	3.06e-12	NA
7. B	Q0K8N0	Elongation factor 4	1.04e-06	NA	7.74e-07	NA
7. B	Q8RGV7	GTPase Der	2.54e-03	NA	0.006	NA
7. B	A4QBH0	Elongation factor Tu	3.97e-07	NA	2.15e-05	NA
7. B	Q0SMG2	Elongation factor G 2	1.78e-05	NA	5.07e-08	NA
7. B	A9HF18	Translation initiation factor IF-2	0.00e+00	NA	7.28e-153	NA
7. B	Q20EU5	Elongation factor Tu, chloroplastic	3.67e-07	NA	3.30e-12	NA
7. B	Q8PC52	Elongation factor G	5.47e-05	NA	1.12e-07	NA
7. B	Q73NV3	Elongation factor G 2	4.20e-04	NA	2.78e-08	NA
7. B	B5RD51	Elongation factor 4	9.85e-07	NA	8.07e-09	NA
7. B	Q97JI5	GTPase Era	7.62e-03	NA	4.40e-05	NA
7. B	Q1C2U0	Elongation factor G	2.31e-05	NA	8.38e-07	NA
7. B	A8LLG2	Elongation factor Tu	4.34e-07	NA	1.55e-10	NA
7. B	Q9FE64	Elongation factor G, mitochondrial	1.90e-03	NA	3.59e-08	NA
7. B	C6A4R7	Elongation factor 1-alpha	2.97e-06	NA	3.23e-11	NA
7. B	A8MFA6	Elongation factor 4	3.17e-06	NA	2.74e-11	NA
7. B	Q5XD49	Elongation factor Tu	3.98e-07	NA	1.81e-12	NA
7. B	P42481	Elongation factor Tu	4.04e-07	NA	3.29e-13	NA
7. B	A7FNN9	Elongation factor G	2.05e-05	NA	8.38e-07	NA
7. B	Q8AAP9	Sulfate adenylyltransferase subunit 1	5.10e-04	NA	1.07e-05	NA
7. B	Q13X32	GTPase Der	2.54e-03	NA	0.003	NA
7. B	B0T2B5	Elongation factor Tu 2	4.41e-07	NA	4.34e-10	NA
7. B	B0B7N8	Elongation factor Tu	5.75e-07	NA	2.07e-11	NA
7. B	Q0SZX7	Elongation factor G	2.24e-05	NA	1.39e-07	NA
7. B	Q5LYK1	Peptide chain release factor 3	2.52e-05	NA	1.72e-06	NA
7. B	Q74A61	Elongation factor G 1	7.29e-05	NA	7.15e-11	NA
7. B	A7ZUJ2	Elongation factor Tu 2	5.02e-07	NA	8.59e-14	NA
7. B	P49411	Elongation factor Tu, mitochondrial	4.86e-06	NA	3.95e-08	NA
7. B	A4IW75	Peptide chain release factor 3	2.78e-05	NA	8.60e-08	NA
7. B	Q6FDS6	Elongation factor G	2.94e-05	NA	9.27e-07	NA
7. B	B8D6B2	Elongation factor 2	4.45e-05	NA	4.21e-08	NA
7. B	Q9W074	Protein HBS1	2.57e-04	NA	3.38e-04	NA
7. B	Q2K9L9	Elongation factor G	3.33e-05	NA	1.36e-09	NA
7. B	Q8CXD0	Elongation factor 4	1.04e-06	NA	1.10e-12	NA
7. B	O83464	Elongation factor G 2	1.71e-05	NA	1.10e-09	NA
7. B	B0R6Y7	Translation initiation factor 2 subunit gamma	4.42e-06	NA	2.44e-09	NA
7. B	Q3AFV0	GTPase HflX	5.95e-03	NA	0.013	NA
7. B	B1YP36	Translation initiation factor IF-2	0.00e+00	NA	1.68e-167	NA
7. B	B1XI63	Elongation factor Tu	4.16e-07	NA	4.18e-11	NA
7. B	Q72KV2	Elongation factor 4	1.09e-06	NA	7.96e-07	NA
7. B	B1V9C5	Elongation factor 4	3.66e-06	NA	4.56e-12	NA
7. B	B6K286	Elongation factor G, mitochondrial	3.91e-05	NA	2.74e-08	NA
7. B	Q5GRW9	Elongation factor 4	7.57e-07	NA	8.05e-08	NA
7. B	Q87F03	Peptide chain release factor 3	1.79e-05	NA	1.64e-05	NA
7. B	Q5XDW4	Elongation factor G	2.53e-05	NA	1.50e-08	NA
7. B	Q73H85	Elongation factor Tu 2	1.73e-07	NA	1.27e-12	NA
7. B	Q2JMX8	Elongation factor G	1.71e-05	NA	2.17e-06	NA
7. B	Q254H4	Translation initiation factor IF-2	0.00e+00	NA	3.46e-119	NA
7. B	A4XHX9	GTPase Der	6.50e-04	NA	0.014	NA
7. B	A8XT37	Translation factor GUF1 homolog, mitochondrial	6.78e-05	NA	3.50e-15	NA
7. B	Q8E0G1	Peptide chain release factor 3	1.15e-05	NA	2.98e-07	NA
7. B	Q57AA0	Translation initiation factor IF-2	0.00e+00	NA	8.89e-160	NA
7. B	A8GMA0	Elongation factor G	3.24e-05	NA	2.62e-08	NA
7. B	A3MJW4	Translation initiation factor IF-2	0.00e+00	NA	4.13e-169	NA
7. B	P50378	Elongation factor Tu, chloroplastic (Fragment)	2.16e-07	NA	4.49e-04	NA
7. B	Q47UU9	Elongation factor Tu	3.72e-07	NA	2.06e-12	NA
7. B	Q7N9B1	Elongation factor Tu 1	4.92e-07	NA	6.56e-14	NA
7. B	Q2G0N1	Elongation factor G	1.19e-05	NA	3.56e-08	NA
7. B	B5QW22	Sulfate adenylyltransferase subunit 1	1.01e-04	NA	4.28e-05	NA
7. B	A5UHC1	Elongation factor Tu	5.01e-07	NA	1.58e-13	NA
7. B	Q11UD0	Elongation factor 4	3.23e-06	NA	8.76e-08	NA
7. B	A5D1U6	GTPase Der	2.42e-03	NA	0.029	NA
7. B	B8DIL5	Peptide chain release factor 3	1.38e-05	NA	7.56e-07	NA
7. B	Q3K5Y5	Elongation factor G	7.52e-06	NA	5.10e-08	NA
7. B	B9M914	GTPase Der	1.33e-03	NA	0.008	NA
7. B	Q2K9L8	Elongation factor Tu 2	4.24e-07	NA	2.05e-10	NA
7. B	C9WPN6	Eukaryotic translation initiation factor 2 subunit 3, Y-linked	7.98e-07	NA	0.021	NA
7. B	A9R5A3	Translation initiation factor IF-2	0.00e+00	NA	8.99e-154	NA
7. B	Q5NHX0	Elongation factor G	2.46e-05	NA	8.22e-09	NA
7. B	Q99QM0	Elongation factor Tu	4.45e-07	NA	2.39e-11	NA
7. B	A8AD75	GTPase Der	3.01e-03	NA	0.036	NA
7. B	Q9Z9L7	Elongation factor G	5.71e-06	NA	1.34e-10	NA
7. B	A7HM55	Elongation factor G	7.93e-06	NA	1.84e-10	NA
7. B	B8DEE7	Peptide chain release factor 3	2.62e-05	NA	2.08e-06	NA
7. B	B9MQH1	Elongation factor Tu	5.08e-07	NA	9.96e-13	NA
7. B	P64062	GTPase Der	2.04e-03	NA	6.10e-06	NA
7. B	C5JRK2	Translation factor GUF1, mitochondrial	2.81e-05	NA	2.69e-06	NA
7. B	Q8P0C7	Peptide chain release factor 3	3.60e-05	NA	3.77e-08	NA
7. B	A3M1F6	Elongation factor Tu	4.42e-07	NA	7.01e-11	NA
7. B	B5XM60	Peptide chain release factor 3	3.12e-05	NA	3.97e-08	NA
7. B	O50293	Elongation factor Tu	3.79e-07	NA	2.67e-09	NA
7. B	B8DAY6	Elongation factor G	3.11e-05	NA	3.89e-09	NA
7. B	A8F2E9	Elongation factor Tu	4.56e-07	NA	4.34e-14	NA
7. B	A1V8A5	Elongation factor Tu	4.81e-07	NA	3.06e-12	NA
7. B	P72231	Elongation factor Tu	5.18e-07	NA	6.00e-11	NA
7. B	A3MM44	Elongation factor 4	1.05e-06	NA	5.27e-09	NA
7. B	Q12SW2	Elongation factor G 1	2.91e-05	NA	1.72e-08	NA
7. B	Q04SN9	Elongation factor 4	4.01e-06	NA	1.59e-08	NA
7. B	A7MKI5	Elongation factor Tu	5.04e-07	NA	1.69e-13	NA
7. B	B0KA54	GTPase Era	1.49e-03	NA	3.87e-06	NA
7. B	Q54HB2	Elongation factor Tu, mitochondrial	3.54e-05	NA	1.61e-10	NA
7. B	P73473	Peptide chain release factor 3	1.33e-04	NA	7.10e-09	NA
7. B	P64063	GTPase Der	2.04e-03	NA	6.10e-06	NA
7. B	A7NR65	Elongation factor Tu 1	6.01e-07	NA	1.14e-10	NA
7. B	B2TZI0	Sulfate adenylyltransferase subunit 1	7.04e-06	NA	3.68e-04	NA
7. B	Q981F7	Elongation factor Tu	3.79e-07	NA	2.93e-11	NA
7. B	P50373	Elongation factor Tu, chloroplastic	3.43e-07	NA	2.90e-07	NA
7. B	Q1CEL3	Translation initiation factor IF-2	0.00e+00	NA	6.38e-154	NA
7. B	A0T100	Elongation factor Tu, chloroplastic	3.53e-07	NA	1.02e-07	NA
7. B	Q088A4	Elongation factor G 2	3.93e-05	NA	1.05e-06	NA
7. B	Q15VB8	Sulfate adenylyltransferase subunit 1	2.82e-05	NA	7.00e-04	NA
7. B	Q72NF9	Elongation factor Tu	2.00e-07	NA	1.08e-14	NA
7. B	Q08810	Translation initiation factor IF-2, chloroplastic (Fragment)	2.34e-06	NA	4.09e-30	NA
7. B	Q67MT5	Peptide chain release factor 3	4.21e-05	NA	4.31e-08	NA
7. B	Q5P334	Elongation factor Tu	4.26e-07	NA	7.86e-10	NA
7. B	Q5U8S9	Elongation factor G	1.20e-05	NA	2.16e-09	NA
7. B	Q820H8	Elongation factor 4	1.29e-06	NA	5.59e-10	NA
7. B	B8G2P9	GTPase Der	7.86e-03	NA	0.003	NA
7. B	C4K4F9	Elongation factor G	3.26e-05	NA	2.11e-07	NA
7. B	P19457	Elongation factor Tu, chloroplastic	3.32e-07	NA	5.49e-10	NA
7. B	A5WGA8	GTPase Der	1.00e-02	NA	0.035	NA
7. B	Q6FF97	Elongation factor Tu	4.60e-07	NA	9.24e-11	NA
7. B	B9E8Q0	Elongation factor Tu	3.69e-07	NA	3.24e-12	NA
7. B	P47335	Elongation factor G	2.51e-05	NA	1.43e-09	NA
7. B	C5BQ44	Elongation factor Tu	6.53e-07	NA	1.40e-11	NA
7. B	Q3SKX1	Translation initiation factor IF-2	0.00e+00	NA	3.34e-171	NA
7. B	Q8KTB7	Elongation factor G	5.01e-05	NA	1.25e-08	NA
7. B	B8EIA7	Translation initiation factor IF-2	0.00e+00	NA	2.53e-164	NA
7. B	Q837X4	Peptide chain release factor 3	5.32e-05	NA	5.45e-07	NA
7. B	Q0RRS4	Elongation factor G	1.62e-05	NA	1.51e-08	NA
7. B	B7LWK4	Sulfate adenylyltransferase subunit 1	6.02e-06	NA	1.39e-06	NA
7. B	Q3K1U4	Elongation factor Tu	4.58e-07	NA	4.01e-12	NA
7. B	Q8E3T9	GTPase Der	1.35e-03	NA	2.27e-05	NA
7. B	Q02S69	Peptide chain release factor 3	4.15e-05	NA	1.11e-06	NA
7. B	P11131	Tetracycline resistance protein TetM from transposon Tn1545	2.47e-05	NA	2.80e-11	NA
7. B	Q3ATB2	Elongation factor 4	2.95e-06	NA	2.97e-06	NA
7. B	Q0P3M7	Elongation factor Tu, chloroplastic	3.42e-07	NA	1.56e-11	NA
7. B	A9HG78	Elongation factor 4	9.26e-07	NA	3.62e-09	NA
7. B	Q3B6G4	Elongation factor G	3.19e-05	NA	2.60e-07	NA
7. B	Q7VNX4	Peptide chain release factor 3	1.34e-05	NA	2.81e-06	NA
7. B	Q7V5M4	Translation initiation factor IF-2	0.00e+00	NA	4.60e-152	NA
7. B	A6VGE8	Translation initiation factor 2 subunit gamma	5.71e-07	NA	5.50e-05	NA
7. B	Q0SFF4	Elongation factor Tu	4.25e-07	NA	1.88e-10	NA
7. B	Q9Z9A7	Elongation factor Tu	4.80e-07	NA	3.00e-11	NA
7. B	P56865	Elongation factor 4	6.22e-07	NA	3.21e-08	NA
7. B	B5Z8K3	Elongation factor Tu	4.27e-07	NA	4.82e-12	NA
7. B	Q9PNR1	Elongation factor 4	3.37e-06	NA	2.40e-09	NA
7. B	C6DKK3	Translation initiation factor IF-2	0.00e+00	NA	1.01e-151	NA
7. B	A5GIP0	Elongation factor Tu	3.39e-07	NA	1.11e-08	NA
7. B	Q02WY9	Elongation factor Tu	4.07e-07	NA	1.57e-10	NA
7. B	C3N5S0	Elongation factor 2	1.19e-04	NA	2.49e-08	NA
7. B	Q2KHZ2	HBS1-like protein	1.17e-03	NA	0.001	NA
7. B	Q6LM69	Sulfate adenylyltransferase subunit 1	1.65e-05	NA	1.01e-06	NA
7. B	Q14JU2	Elongation factor Tu	5.61e-07	NA	2.79e-13	NA
7. B	Q6LXY6	Translation initiation factor 2 subunit gamma	6.08e-07	NA	2.38e-05	NA
7. B	Q8E443	GTPase Era	1.77e-03	NA	6.90e-04	NA
7. B	A3NA49	GTPase Der	6.76e-03	NA	0.024	NA
7. B	Q0BKB8	Elongation factor Tu	5.35e-07	NA	2.69e-13	NA
7. B	Q6F0J4	Elongation factor G	2.87e-05	NA	5.84e-10	NA
7. B	Q3JMR0	Elongation factor G 2	4.34e-05	NA	5.13e-07	NA
7. B	A9WFP3	Elongation factor Tu	5.40e-07	NA	4.48e-13	NA
7. B	A6RLH0	Elongation factor G, mitochondrial	3.51e-04	NA	1.90e-06	NA
7. B	P47384	Elongation factor 4	8.38e-07	NA	5.59e-10	NA
7. B	P43925	Elongation factor G	2.04e-05	NA	5.32e-08	NA
7. B	C4LAG3	Sulfate adenylyltransferase subunit 1	1.63e-05	NA	1.98e-04	NA
7. B	A3DE77	GTPase Der	4.20e-03	NA	6.70e-06	NA
7. B	Q14JV7	Peptide chain release factor 3	4.11e-05	NA	8.99e-08	NA
7. B	P58252	Elongation factor 2	1.16e-02	NA	6.35e-05	NA
7. B	C1N1Y2	Translation factor GUF1 homolog, chloroplastic	1.84e-05	NA	8.42e-10	NA
7. B	A5EWY9	Translation initiation factor IF-2	0.00e+00	NA	9.77e-156	NA
7. B	A8GQV7	Elongation factor G	6.26e-05	NA	1.72e-08	NA
7. B	A5IHR7	Elongation factor G	2.55e-05	NA	3.16e-06	NA
7. B	P33166	Elongation factor Tu	2.99e-07	NA	1.48e-12	NA
7. B	Q1WUZ8	Peptide chain release factor 3	2.05e-05	NA	3.92e-10	NA
7. B	B1IBC9	GTPase Era	2.79e-03	NA	1.83e-04	NA
7. B	B1IPW0	Elongation factor Tu 1	5.60e-07	NA	1.26e-13	NA
7. B	A9KWA0	Elongation factor Tu 2	4.80e-07	NA	4.74e-13	NA
7. B	B7N0X6	Elongation factor G	2.02e-05	NA	1.30e-07	NA
7. B	A5U9R1	Elongation factor Tu	4.91e-07	NA	1.58e-13	NA
7. B	A1R8V0	Elongation factor G	7.50e-05	NA	3.16e-09	NA
7. B	Q6CZW5	Elongation factor G	2.51e-05	NA	1.37e-06	NA
7. B	B4TTW5	Sulfate adenylyltransferase subunit 1	7.97e-05	NA	4.09e-05	NA
7. B	B0RU96	Elongation factor Tu 2	4.49e-07	NA	4.79e-09	NA
7. B	C1CF71	Elongation factor Tu	4.15e-07	NA	8.23e-11	NA
7. B	P09604	Elongation factor 2	4.37e-05	NA	5.48e-10	NA
7. B	B4U3U1	Elongation factor Tu	4.60e-07	NA	1.86e-12	NA
7. B	Q8A474	Elongation factor G	5.72e-05	NA	1.37e-07	NA
7. B	Q8ZIR0	Peptide chain release factor 3	1.17e-05	NA	7.37e-07	NA
7. B	Q09130	Eukaryotic translation initiation factor 2 subunit gamma	5.62e-07	NA	0.011	NA
7. B	P57873	Translation initiation factor IF-2	0.00e+00	NA	1.91e-157	NA
7. B	Q04FQ4	Elongation factor Tu	3.74e-07	NA	2.93e-14	NA
7. B	A5DN78	Elongation factor Tu, mitochondrial	3.71e-06	NA	3.28e-10	NA
7. B	B3WE80	GTPase Der	6.61e-04	NA	0.018	NA
7. B	A3N005	Translation initiation factor IF-2	0.00e+00	NA	3.51e-156	NA
7. B	A7MJ69	Sulfate adenylyltransferase subunit 1	6.16e-06	NA	1.78e-04	NA
7. B	C1C6U6	GTPase Era	1.36e-03	NA	1.86e-04	NA
7. B	Q8FEJ1	Sulfate adenylyltransferase subunit 1	5.92e-06	NA	4.38e-04	NA
7. B	A7HZI3	GTPase Der	1.64e-03	NA	0.018	NA
7. B	O67800	GTPase Era	9.58e-04	NA	1.64e-06	NA
7. B	Q4JV51	Translation initiation factor IF-2	0.00e+00	NA	8.34e-145	NA
7. B	A1RVX2	Elongation factor 2	3.53e-05	NA	2.52e-08	NA
7. B	A1B002	Elongation factor Tu	4.40e-07	NA	8.47e-11	NA
7. B	Q7VJ74	Elongation factor Tu	4.68e-07	NA	4.10e-11	NA
7. B	I1K0K6	Elongation factor G-2, chloroplastic	4.70e-05	NA	6.53e-07	NA
7. B	P0DA90	GTPase Der	1.55e-03	NA	3.19e-05	NA
7. B	Q8SQT7	Elongation factor 2	1.88e-03	NA	4.17e-04	NA
7. B	Q7Q1K8	Elongation factor G, mitochondrial	8.07e-04	NA	5.06e-12	NA
7. B	Q8ZAN8	Elongation factor Tu-B	4.21e-07	NA	1.96e-13	NA
7. B	B1XFI4	Peptide chain release factor 3	1.06e-05	NA	1.26e-07	NA
7. B	P42477	Elongation factor Tu	5.65e-07	NA	8.13e-12	NA
7. B	A6LSI6	GTPase Der	8.82e-04	NA	0.014	NA
7. B	P64024	Elongation factor Tu	4.10e-07	NA	7.09e-11	NA
7. B	A4TS36	Elongation factor Tu 2	4.36e-07	NA	1.96e-13	NA
7. B	Q04VH3	Elongation factor G	4.79e-04	NA	1.45e-09	NA
7. B	Q62GK2	Elongation factor G 2	5.38e-05	NA	5.13e-07	NA
7. B	C4L8X4	Translation initiation factor IF-2	0.00e+00	NA	1.21e-162	NA
7. B	Q8XGZ0	Elongation factor Tu	3.77e-07	NA	1.62e-12	NA
7. B	A6X0A2	Elongation factor Tu	4.10e-07	NA	2.72e-10	NA
7. B	C4LBU4	Elongation factor G	2.53e-05	NA	4.74e-07	NA
7. B	A0JX50	Elongation factor 4	3.68e-06	NA	1.24e-10	NA
7. B	B2GC35	GTPase Der	1.90e-03	NA	1.26e-04	NA
7. B	A9WW49	Elongation factor 4	1.11e-06	NA	2.41e-08	NA
7. B	Q3APH0	Elongation factor G	6.89e-05	NA	1.44e-07	NA
7. B	Q8KTA3	Elongation factor Tu	4.97e-07	NA	3.69e-14	NA
7. B	A9R462	Elongation factor G	2.18e-05	NA	8.38e-07	NA
7. B	Q2SU25	Elongation factor Tu	4.60e-07	NA	3.06e-12	NA
7. B	Q7WHG2	Translation initiation factor IF-2	0.00e+00	NA	2.99e-154	NA
7. B	B2SDY7	Elongation factor G	8.35e-06	NA	8.22e-09	NA
7. B	A5CW32	Elongation factor Tu	3.96e-07	NA	1.87e-08	NA
7. B	Q17VN9	Elongation factor G	2.49e-05	NA	4.12e-08	NA
7. B	Q2FZP4	Peptide chain release factor 3	2.02e-05	NA	2.29e-09	NA
7. B	Q1JDF1	GTPase Der	1.81e-03	NA	3.51e-05	NA
7. B	Q8KTB8	Elongation factor G	9.19e-05	NA	1.68e-08	NA
7. B	O29325	Elongation factor 1-alpha	3.95e-07	NA	4.82e-05	NA
7. B	Q03N64	tRNA modification GTPase MnmE	1.79e-02	NA	0.004	NA
7. B	Q4L527	Peptide chain release factor 3	2.07e-05	NA	4.68e-09	NA
7. B	B1I9N0	Peptide chain release factor 3	6.25e-05	NA	2.20e-07	NA
7. B	Q74GV6	Peptide chain release factor 3	8.07e-05	NA	4.90e-08	NA
7. B	A6TWI4	Elongation factor Tu 1	4.69e-07	NA	2.11e-06	NA
7. B	Q3K1F9	Elongation factor 4	7.25e-06	NA	4.67e-11	NA
7. B	C5D3F4	GTPase Der	9.31e-04	NA	0.001	NA
7. B	A1KRH0	Elongation factor G	2.97e-05	NA	5.04e-07	NA
7. B	A3MSN3	Elongation factor 2	3.18e-05	NA	2.47e-08	NA
7. B	B0BB83	Translation initiation factor IF-2	0.00e+00	NA	8.13e-127	NA
7. B	Q8E0H1	Elongation factor Tu	4.42e-07	NA	3.98e-12	NA
7. B	B5Z0Y0	GTPase Der	4.87e-03	NA	0.025	NA
7. B	A1A0A2	Translation initiation factor IF-2	0.00e+00	NA	5.79e-165	NA
7. B	Q1R0H7	Elongation factor Tu	5.06e-07	NA	1.90e-09	NA
7. B	A0LJ92	GTPase Der	4.94e-03	NA	8.74e-04	NA
7. B	A6U842	Elongation factor Tu	4.09e-07	NA	9.43e-12	NA
7. B	Q31H08	Peptide chain release factor 3	1.55e-04	NA	3.92e-07	NA
7. B	B1XCS7	Sulfate adenylyltransferase subunit 1	6.82e-06	NA	4.12e-04	NA
7. B	Q5LMR5	Elongation factor Tu	4.78e-07	NA	1.12e-10	NA
7. B	B2USI5	Elongation factor 4	3.06e-06	NA	1.99e-06	NA
7. B	B4U0V9	Elongation factor G	5.14e-05	NA	1.50e-08	NA
7. B	Q8R7T8	Elongation factor Tu-B	4.08e-07	NA	8.58e-12	NA
7. B	Q9KPM5	Elongation factor G 2	3.22e-05	NA	4.54e-06	NA
7. B	Q5HAY9	GTPase Era	6.56e-03	NA	0.015	NA
7. B	Q834T4	GTPase Der	1.35e-03	NA	8.06e-06	NA
7. B	P0DTT0	50S ribosomal subunit assembly factor BipA	1.80e-05	NA	9.56e-13	NA
7. B	B4SBU4	Elongation factor G	3.12e-05	NA	8.00e-08	NA
7. B	Q8Z470	Sulfate adenylyltransferase subunit 1	8.54e-05	NA	4.31e-05	NA
7. B	Q12QG7	Peptide chain release factor 3	1.13e-05	NA	7.68e-07	NA
7. B	Q49V57	Elongation factor G	8.61e-05	NA	2.11e-09	NA
7. B	Q5NG10	Sulfate adenylyltransferase subunit 1	8.06e-05	NA	0.001	NA
7. B	Q5GSU2	Elongation factor Tu 1	2.73e-07	NA	2.12e-12	NA
7. B	P60930	Elongation factor 4	2.52e-06	NA	1.29e-09	NA
7. B	A5WH45	Peptide chain release factor 3	8.70e-06	NA	1.06e-04	NA
7. B	C0PXB1	Sulfate adenylyltransferase subunit 1	1.03e-04	NA	4.18e-06	NA
7. B	A8PXR7	Elongation factor G, mitochondrial	1.07e-03	NA	2.02e-08	NA
7. B	P0DD97	Peptide chain release factor 3	1.25e-04	NA	3.64e-08	NA
7. B	Q5XDG3	GTPase Era	8.91e-04	NA	6.99e-04	NA
7. B	B6ENF7	Peptide chain release factor 3	1.15e-05	NA	1.28e-06	NA
7. B	Q7VNY0	Probable GTP-binding protein EngB	3.75e-05	NA	0.018	NA
7. B	A5IG41	Peptide chain release factor 3	1.03e-04	NA	6.56e-07	NA
7. B	B2THQ9	GTPase Der	9.08e-04	NA	3.69e-04	NA
7. B	B9GHA6	Translation factor GUF1 homolog, chloroplastic	3.15e-06	NA	8.32e-10	NA
7. B	P57966	Elongation factor Tu-B	4.60e-07	NA	4.90e-12	NA
7. B	C6BST2	Elongation factor 4	2.76e-06	NA	1.29e-09	NA
7. B	Q7MQ23	Probable GTP-binding protein EngB	5.05e-05	NA	0.017	NA
7. B	B8D851	Elongation factor Tu	4.77e-07	NA	7.97e-13	NA
7. B	Q46IW4	Elongation factor Tu	3.14e-07	NA	1.66e-09	NA
7. B	Q979T1	Elongation factor 1-alpha	2.85e-06	NA	0.003	NA
7. B	Q2N9A8	Elongation factor Tu	4.13e-07	NA	6.18e-10	NA
7. B	B9KIE5	Elongation factor 4	9.27e-07	NA	2.98e-05	NA
7. B	Q5F9P9	Elongation factor 4	1.12e-06	NA	2.23e-10	NA
7. B	B3QY22	Elongation factor Tu	4.29e-07	NA	1.93e-16	NA
7. B	A1W8Z4	Translation initiation factor IF-2	0.00e+00	NA	1.16e-160	NA
7. B	Q2SSW9	Elongation factor G	4.31e-06	NA	1.46e-09	NA
7. B	A6QB12	Sulfate adenylyltransferase subunit 1	5.43e-06	NA	1.03e-04	NA
7. B	Q1LSY5	Elongation factor G	2.19e-05	NA	2.05e-08	NA
7. B	Q9PGX4	Peptide chain release factor 3	2.74e-05	NA	1.66e-05	NA
7. B	B2IRW4	GTPase Der	2.06e-03	NA	6.10e-06	NA
7. B	Q253F1	Elongation factor G	3.09e-05	NA	2.85e-08	NA
7. B	Q1CS71	Elongation factor G	2.47e-05	NA	4.42e-08	NA
7. B	Q8VY57	ADP-ribosylation factor-like protein 8a	4.35e-06	NA	0.007	NA
7. B	C3LJ79	Elongation factor G	1.52e-05	NA	2.00e-09	NA
7. B	Q57H76	Elongation factor Tu	4.63e-07	NA	2.67e-13	NA
7. B	B1ZPC5	Elongation factor Tu	5.42e-07	NA	9.38e-10	NA
7. B	Q0I0A8	Elongation factor G 1	2.69e-05	NA	9.40e-09	NA
7. B	Q9ZF25	Translation initiation factor IF-2	0.00e+00	NA	8.08e-156	NA
7. B	C5M6K8	Translation factor GUF1, mitochondrial	2.86e-06	NA	0.002	NA
7. B	A1JKK1	Elongation factor 4	9.23e-07	NA	4.47e-10	NA
7. B	Q9VCX4	Ribosome-releasing factor 2, mitochondrial	2.03e-04	NA	0.001	NA
7. B	Q3KM40	Elongation factor Tu	5.42e-07	NA	2.12e-11	NA
7. B	P0A7I4	Peptide chain release factor RF3	1.05e-05	NA	1.26e-07	NA
7. B	A7FCP5	Probable GTP-binding protein EngB	4.07e-05	NA	0.006	NA
7. B	B4U6M2	Elongation factor 4	2.01e-06	NA	5.02e-12	NA
7. B	A1AG73	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	B2RLZ4	Elongation factor G	9.30e-06	NA	3.92e-08	NA
7. B	A1AGM7	Elongation factor G	2.52e-05	NA	1.30e-07	NA
7. B	B5XKI1	Elongation factor Tu	3.83e-07	NA	1.36e-12	NA
7. B	Q5M5X5	GTPase Der	1.07e-03	NA	0.002	NA
7. B	P95724	Elongation factor Tu	4.88e-07	NA	3.68e-11	NA
7. B	C1C881	Elongation factor Tu	4.35e-07	NA	8.23e-11	NA
7. B	A8G9G8	Peptide chain release factor 3	1.25e-05	NA	5.26e-07	NA
7. B	A1D5Z0	Translation factor guf1, mitochondrial	2.62e-05	NA	1.26e-06	NA
7. B	B7M076	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	A5EVN8	Peptide chain release factor 3	1.50e-04	NA	1.40e-08	NA
7. B	A0RBV9	GTPase Der	9.83e-04	NA	0.016	NA
7. B	Q6AEB5	Elongation factor 4	4.24e-06	NA	6.23e-10	NA
7. B	Q8KT99	Elongation factor Tu	4.44e-07	NA	1.20e-13	NA
7. B	Q2JSU8	tRNA modification GTPase MnmE	1.76e-02	NA	0.018	NA
7. B	Q0AUH8	Elongation factor Tu 1	5.36e-07	NA	2.27e-11	NA
7. B	Q0I7K2	Translation initiation factor IF-2	0.00e+00	NA	5.19e-155	NA
7. B	Q87M18	Peptide chain release factor 3	1.17e-05	NA	1.17e-06	NA
7. B	Q8FXT2	Translation initiation factor IF-2	0.00e+00	NA	1.19e-159	NA
7. B	B4RC55	Translation initiation factor IF-2	0.00e+00	NA	1.32e-146	NA
7. B	C3KVQ4	Elongation factor G	4.46e-06	NA	4.14e-10	NA
7. B	Q3Z7S9	Elongation factor Tu	4.56e-07	NA	1.92e-09	NA
7. B	A8H740	Translation initiation factor IF-2	0.00e+00	NA	1.93e-159	NA
7. B	Q74AX4	GTPase Der	2.76e-03	NA	0.016	NA
7. B	A0SXL6	Elongation factor 2	6.16e-03	NA	6.09e-05	NA
7. B	A4VYX6	Elongation factor G	2.23e-05	NA	2.18e-09	NA
7. B	B4RK41	Elongation factor 4	7.53e-07	NA	2.23e-10	NA
7. B	Q0BJ48	Elongation factor Tu	5.26e-07	NA	3.83e-11	NA
7. B	B0JQT7	Elongation factor 4	1.86e-06	NA	2.13e-10	NA
7. B	Q5NIF4	Peptide chain release factor 3	4.14e-05	NA	8.99e-08	NA
7. B	Q7SH14	Elongation factor G, mitochondrial	3.63e-04	NA	4.76e-07	NA
7. B	Q5WHD9	GTPase Era	1.48e-03	NA	0.001	NA
7. B	P0A706	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q6C9Y6	Elongation factor G, mitochondrial	1.24e-03	NA	7.41e-10	NA
7. B	C1C5H4	Peptide chain release factor 3	6.12e-05	NA	2.20e-07	NA
7. B	Q9XV52	Elongation factor G, mitochondrial	2.77e-04	NA	3.87e-07	NA
7. B	Q0SQC8	Elongation factor Tu	3.45e-07	NA	2.97e-10	NA
7. B	Q03JD8	Peptide chain release factor 3	9.81e-06	NA	1.66e-06	NA
7. B	A2SLF9	Elongation factor Tu	4.38e-07	NA	1.81e-09	NA
7. B	Q2IXR3	Elongation factor G	2.10e-05	NA	4.08e-09	NA
7. B	P38525	Elongation factor G	4.01e-05	NA	5.67e-09	NA
7. B	B0VLU2	Translation initiation factor IF-2	0.00e+00	NA	2.60e-162	NA
7. B	Q932I8	Tetracycline resistance protein TetM	2.37e-05	NA	8.88e-11	NA
7. B	A9MT06	Elongation factor G	2.52e-05	NA	7.70e-07	NA
7. B	A7ZQJ5	Sulfate adenylyltransferase subunit 1	8.73e-06	NA	7.54e-05	NA
7. B	Q1H4Q1	Elongation factor Tu 1	3.76e-07	NA	1.64e-11	NA
7. B	B7GNA3	Translation initiation factor IF-2	0.00e+00	NA	5.19e-161	NA
7. B	Q8EK81	Elongation factor Tu 1	5.36e-07	NA	1.07e-12	NA
7. B	O08810	116 kDa U5 small nuclear ribonucleoprotein component	1.46e-02	NA	3.25e-07	NA
7. B	B4RYQ8	Elongation factor Tu	4.75e-07	NA	2.25e-14	NA
7. B	A4SHV8	Elongation factor G	2.21e-05	NA	3.89e-07	NA
7. B	O50340	Elongation factor Tu	3.82e-07	NA	1.02e-12	NA
7. B	A8ZU05	GTPase Der	2.14e-03	NA	0.002	NA
7. B	Q54K69	Ras-related protein Rab-7B	4.90e-06	NA	0.015	NA
7. B	Q8F983	Elongation factor G	2.49e-04	NA	1.42e-09	NA
7. B	Q5P335	Elongation factor G	6.34e-05	NA	3.37e-06	NA
7. B	P32481	Eukaryotic translation initiation factor 2 subunit gamma	1.77e-04	NA	0.017	NA
7. B	Q1QD14	GTPase Der	3.34e-03	NA	0.003	NA
7. B	A1SNN6	Elongation factor G	3.93e-05	NA	1.55e-07	NA
7. B	Q2RFI8	tRNA modification GTPase MnmE	2.64e-02	NA	0.009	NA
7. B	Q1R5Y2	Elongation factor Tu 1	5.25e-07	NA	1.26e-13	NA
7. B	Q5LC85	Elongation factor 4	9.74e-07	NA	3.39e-07	NA
7. B	Q3IMM5	Translation initiation factor 2 subunit gamma	1.09e-05	NA	7.14e-09	NA
7. B	P41084	Elongation factor G	6.59e-05	NA	1.58e-08	NA
7. B	A4SUU7	Elongation factor Tu	4.16e-07	NA	7.75e-12	NA
7. B	Q2G8Y3	Elongation factor G	1.62e-05	NA	4.49e-06	NA
7. B	P60791	Elongation factor 4	7.08e-06	NA	5.30e-08	NA
7. B	O05197	Tetracycline resistance protein TetQ	2.63e-05	NA	6.95e-07	NA
7. B	A9A0N0	Elongation factor 4	3.76e-06	NA	3.66e-08	NA
7. B	Q96X45	Elongation factor 2	2.37e-03	NA	1.68e-06	NA
7. B	B2U978	Elongation factor 4	1.18e-06	NA	4.16e-07	NA
7. B	B1GZ80	Elongation factor G	1.15e-05	NA	4.72e-07	NA
7. B	P18667	Elongation factor G	7.39e-05	NA	9.94e-10	NA
7. B	P9WNN1	Elongation factor Tu	4.68e-07	NA	2.16e-09	NA
7. B	Q99V72	Peptide chain release factor 3	1.95e-05	NA	2.03e-09	NA
7. B	C1CSX0	GTPase Der	1.90e-03	NA	6.10e-06	NA
7. B	Q9PA90	Elongation factor G	4.70e-05	NA	8.43e-08	NA
7. B	Q086G5	Peptide chain release factor 3	1.25e-05	NA	1.89e-05	NA
7. B	A6Q6I6	Elongation factor G	8.48e-05	NA	6.36e-08	NA
7. B	Q9Z9L6	Elongation factor Tu	3.42e-07	NA	8.53e-15	NA
7. B	Q72VM5	Elongation factor G	2.77e-04	NA	1.42e-09	NA
7. B	Q73F99	Elongation factor G	9.64e-06	NA	1.93e-09	NA
7. B	A4TGY7	Elongation factor Tu 1	5.36e-07	NA	9.03e-13	NA
7. B	Q1JIM6	Elongation factor G	2.35e-05	NA	1.50e-08	NA
7. B	Q0IFX5	Translation factor GUF1 homolog, mitochondrial	3.12e-05	NA	3.33e-09	NA
7. B	Q2L2H1	Elongation factor G 1	5.77e-05	NA	7.55e-07	NA
7. B	B5Z6E6	Translation initiation factor IF-2	0.00e+00	NA	3.88e-145	NA
7. B	Q1JHV6	Elongation factor Tu	4.84e-07	NA	1.81e-12	NA
7. B	O31301	Elongation factor Tu (Fragment)	1.01e-05	NA	1.08e-11	NA
7. B	Q5N192	Peptide chain release factor 3	2.41e-04	NA	5.12e-11	NA
7. B	Q2N9A7	Elongation factor G	1.56e-04	NA	9.05e-06	NA
7. B	A4TSG6	Probable GTP-binding protein EngB	2.75e-05	NA	0.006	NA
7. B	C5BGM8	Elongation factor G	2.21e-05	NA	1.10e-07	NA
7. B	Q1G9R4	Elongation factor 4	8.05e-06	NA	5.82e-11	NA
7. B	Q1CN51	Probable GTP-binding protein EngB	5.29e-05	NA	0.006	NA
7. B	C4K8N5	Probable GTP-binding protein EngB	3.60e-05	NA	0.016	NA
7. B	Q63DM8	GTPase Der	9.48e-04	NA	0.016	NA
7. B	Q140U6	Translation initiation factor IF-2	0.00e+00	NA	1.95e-162	NA
7. B	Q160Y4	Elongation factor Tu	4.44e-07	NA	1.70e-10	NA
7. B	C0Q9Y7	Elongation factor Tu	4.70e-07	NA	1.65e-12	NA
7. B	C1CIF3	Elongation factor G	8.43e-05	NA	1.86e-09	NA
7. B	A8Z666	Elongation factor G	2.57e-05	NA	1.37e-06	NA
7. B	Q02T82	Elongation factor Tu	4.88e-07	NA	7.48e-10	NA
7. B	Q5E7K1	Peptide chain release factor 3	1.52e-05	NA	1.36e-06	NA
7. B	A9WPV8	Translation initiation factor IF-2	0.00e+00	NA	5.55e-164	NA
7. B	P65270	Elongation factor 4	1.63e-05	NA	2.09e-08	NA
7. B	A1B587	Translation initiation factor IF-2	0.00e+00	NA	1.02e-147	NA
7. B	A7FNN8	Elongation factor Tu 2	5.00e-07	NA	9.03e-13	NA
7. B	B3LQ11	Ribosome-releasing factor 2, mitochondrial	5.91e-05	NA	8.53e-07	NA
7. B	P0A3C4	GTPase Era	4.25e-03	NA	1.86e-04	NA
7. B	Q1DAM6	Translation initiation factor IF-2	0.00e+00	NA	2.80e-130	NA
7. B	A9MHG0	Elongation factor Tu	4.55e-07	NA	2.67e-13	NA
7. B	C5CGR6	Elongation factor Tu	4.50e-07	NA	1.46e-14	NA
7. B	Q57770	Elongation factor 1-alpha	4.81e-06	NA	0.004	NA
7. B	Q4WJS7	Small COPII coat GTPase sar1	1.21e-04	NA	0.001	NA
7. B	Q3IJ53	Translation initiation factor IF-2	0.00e+00	NA	1.24e-154	NA
7. B	Q3KMV7	Elongation factor 4	2.97e-06	NA	3.48e-07	NA
7. B	Q4ZNI9	Peptide chain release factor 3	3.51e-05	NA	1.26e-07	NA
7. B	Q8UH69	Sulfate adenylyltransferase subunit 1	4.46e-05	NA	2.24e-04	NA
7. B	Q5L8A7	Elongation factor G	6.51e-05	NA	1.38e-07	NA
7. B	Q5UZS7	Elongation factor 2	1.65e-04	NA	1.08e-10	NA
7. B	A5CUB6	Elongation factor Tu	4.99e-07	NA	5.95e-06	NA
7. B	Q5R4B3	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B	3.74e-05	NA	0.005	NA
7. B	Q979T3	Elongation factor 2	1.00e-04	NA	1.52e-09	NA
7. B	C3PMX3	Elongation factor 4	8.69e-06	NA	8.25e-06	NA
7. B	A6UTL4	Translation initiation factor 2 subunit gamma	4.88e-07	NA	3.85e-08	NA
7. B	Q0SP76	Elongation factor 4	3.08e-06	NA	1.75e-09	NA
7. B	Q60BD3	Elongation factor G 1	7.68e-05	NA	1.02e-05	NA
7. B	P9WNM5	Bifunctional enzyme CysN/CysC	2.37e-04	NA	0.028	NA
7. B	C1B313	Translation initiation factor IF-2	0.00e+00	NA	5.33e-153	NA
7. B	Q3K5X4	Elongation factor Tu	5.45e-07	NA	2.38e-08	NA
7. B	A5D5I8	Elongation factor Tu 2	5.36e-07	NA	3.83e-11	NA
7. B	Q85FT7	Elongation factor Tu, chloroplastic	3.39e-07	NA	5.24e-11	NA
7. B	Q6N4Q4	Elongation factor Tu	4.90e-07	NA	3.32e-13	NA
7. B	A2RGB0	GTPase Der	1.59e-03	NA	3.26e-04	NA
7. B	B3GZM0	Peptide chain release factor 3	1.23e-05	NA	5.87e-06	NA
7. B	B2T381	Translation initiation factor IF-2	0.00e+00	NA	2.53e-162	NA
7. B	P42473	Elongation factor Tu	3.82e-07	NA	2.19e-16	NA
7. B	P0DA96	GTPase Era	8.59e-04	NA	6.99e-04	NA
7. B	Q9C641	Elongation factor G-1, mitochondrial	3.08e-04	NA	4.80e-08	NA
7. B	A5I4V0	GTPase Der	8.59e-04	NA	1.56e-04	NA
7. B	Q9ZT91	Elongation factor Tu, mitochondrial	6.60e-06	NA	7.38e-10	NA
7. B	P43928	Peptide chain release factor 3	1.00e-05	NA	7.96e-06	NA
7. B	B1I8Z9	Elongation factor G	8.43e-05	NA	1.91e-09	NA
7. B	Q8NL22	Elongation factor Tu	4.45e-07	NA	8.66e-10	NA
7. B	A0KRL0	Elongation factor Tu	4.10e-07	NA	1.56e-12	NA
7. B	P0A6N0	Elongation factor G	2.09e-05	NA	1.30e-07	NA
7. B	Q823F2	Translation initiation factor IF-2	0.00e+00	NA	5.23e-119	NA
7. B	Q7V501	Elongation factor G	8.69e-05	NA	7.10e-11	NA
7. B	B4TKM1	Elongation factor G	2.50e-05	NA	7.70e-07	NA
7. B	C3LJ80	Elongation factor Tu	3.22e-07	NA	2.96e-14	NA
7. B	Q3IUM4	Elongation factor 2	4.18e-05	NA	1.49e-09	NA
7. B	P33165	Elongation factor Tu	4.47e-06	NA	2.81e-13	NA
7. B	Q89BJ8	Elongation factor 4	2.43e-06	NA	8.93e-07	NA
7. B	A2RI79	Peptide chain release factor 3	4.57e-05	NA	4.59e-08	NA
7. B	Q8I335	Translation factor GUF1 homolog, mitochondrial	8.63e-04	NA	4.68e-07	NA
7. B	A7FLY2	Sulfate adenylyltransferase subunit 1	1.55e-04	NA	4.16e-05	NA
7. B	A5GNJ0	Translation initiation factor IF-2	0.00e+00	NA	9.94e-155	NA
7. B	Q6NGN2	Translation initiation factor IF-2	0.00e+00	NA	2.43e-162	NA
7. B	Q2IIA6	Elongation factor 4	3.11e-06	NA	9.36e-10	NA
7. B	Q7W2F8	Elongation factor G 1	4.46e-05	NA	8.97e-07	NA
7. B	B3DSA9	Elongation factor 4	2.46e-06	NA	2.35e-09	NA
7. B	Q8EIJ7	Elongation factor G 2	7.19e-05	NA	3.24e-07	NA
7. B	A2BT70	Translation initiation factor IF-2	0.00e+00	NA	2.41e-154	NA
7. B	Q3ZZM6	Elongation factor G	2.03e-04	NA	1.93e-07	NA
7. B	Q5HU70	Elongation factor 4	2.78e-06	NA	2.32e-09	NA
7. B	B4U3G9	Elongation factor 4	2.26e-06	NA	1.93e-11	NA
7. B	Q9Y700	Elongation factor Tu, mitochondrial	2.86e-06	NA	8.65e-12	NA
7. B	O94429	Ribosome-releasing factor 2, mitochondrial	1.30e-04	NA	3.73e-08	NA
7. B	Q8Y750	GTPase Era	1.25e-03	NA	0.047	NA
7. B	Q6FR62	Translation factor GUF1, mitochondrial	4.78e-05	NA	4.69e-05	NA
7. B	Q3BWY7	Elongation factor G	2.14e-05	NA	8.22e-08	NA
7. B	A4G7S7	Translation initiation factor IF-2	0.00e+00	NA	1.58e-163	NA
7. B	B1IWF0	GTPase Der	4.46e-03	NA	0.025	NA
7. B	B1VY28	Elongation factor 4	5.17e-06	NA	1.34e-07	NA
7. B	C3MQ53	Elongation factor 2	1.23e-04	NA	2.49e-08	NA
7. B	P52978	Bifunctional enzyme NodQ	3.49e-03	NA	0.001	NA
7. B	B1WUP2	Peptide chain release factor 3	7.60e-05	NA	5.20e-10	NA
7. B	Q1IEF7	Peptide chain release factor 3	3.39e-05	NA	1.52e-07	NA
7. B	Q3YYB1	Sulfate adenylyltransferase subunit 1	5.62e-06	NA	4.12e-04	NA
7. B	A7IFX8	Elongation factor G	4.35e-06	NA	2.78e-10	NA
7. B	B9EAS8	Peptide chain release factor 3	1.79e-05	NA	1.31e-09	NA
7. B	B5R297	Elongation factor G	2.47e-05	NA	7.70e-07	NA
7. B	A4G6S1	Elongation factor 4	1.34e-05	NA	2.31e-07	NA
7. B	Q9ZM93	Elongation factor 4	3.47e-06	NA	1.09e-07	NA
7. B	A9QYI0	Probable GTP-binding protein EngB	3.77e-05	NA	0.008	NA
7. B	A5FIJ9	Elongation factor Tu	3.88e-07	NA	5.20e-11	NA
7. B	C1A6Q2	Elongation factor G	2.66e-05	NA	3.69e-06	NA
7. B	Q04J64	GTPase Der	2.24e-03	NA	6.10e-06	NA
7. B	B7I7S1	Elongation factor G	5.26e-05	NA	4.39e-07	NA
7. B	B8ZMH4	GTPase Der	2.18e-03	NA	6.10e-06	NA
7. B	Q7NGL0	Peptide chain release factor 3	8.89e-05	NA	4.43e-10	NA
7. B	Q1LKM8	Elongation factor 4	9.17e-07	NA	8.65e-07	NA
7. B	B2FQ42	Elongation factor G	2.77e-05	NA	1.95e-07	NA
7. B	Q1C557	Elongation factor 4	1.07e-06	NA	2.16e-10	NA
7. B	Q5NQ65	Elongation factor Tu	4.33e-07	NA	1.95e-12	NA
7. B	Q123F6	Elongation factor Tu	4.35e-07	NA	2.72e-12	NA
7. B	Q21M86	Elongation factor Tu	5.38e-07	NA	7.12e-11	NA
7. B	Q5KXT0	GTPase Der	8.10e-04	NA	0.012	NA
7. B	B7H115	Translation initiation factor IF-2	0.00e+00	NA	1.21e-162	NA
7. B	Q0I0B9	Elongation factor Tu 1	4.20e-07	NA	1.41e-12	NA
7. B	Q1D776	Elongation factor Tu 2	4.30e-07	NA	4.68e-14	NA
7. B	C5A6N7	Elongation factor 2	5.31e-05	NA	3.42e-10	NA
7. B	Q1IHG6	Elongation factor Tu	3.93e-07	NA	8.09e-13	NA
7. B	Q08046	Elongation factor 1-alpha (Fragment)	8.13e-06	NA	0.004	NA
7. B	Q0HRE9	Elongation factor G 2	7.12e-05	NA	2.85e-07	NA
7. B	A2RMT1	Elongation factor Tu	3.95e-07	NA	1.57e-10	NA
7. B	Q04M39	Peptide chain release factor 3	6.64e-05	NA	2.12e-07	NA
7. B	Q58657	Translation initiation factor 2 subunit gamma	4.29e-07	NA	7.54e-05	NA
7. B	B7JUP5	Elongation factor Tu	3.56e-07	NA	9.46e-10	NA
7. B	A1RXW9	Elongation factor 1-alpha	5.07e-06	NA	4.53e-08	NA
7. B	B1WQY4	Elongation factor Tu	3.79e-07	NA	1.34e-11	NA
7. B	A6VL11	Elongation factor G	1.92e-05	NA	6.54e-08	NA
7. B	B8JFY6	Translation initiation factor IF-2	0.00e+00	NA	4.26e-146	NA
7. B	A7IAP7	Probable translation initiation factor IF-2	3.72e-13	NA	1.07e-34	NA
7. B	Q927I6	Elongation factor Tu	5.05e-07	NA	4.21e-14	NA
7. B	Q8P6V6	Peptide chain release factor 3	6.33e-05	NA	2.69e-05	NA
7. B	A7GJ76	Elongation factor Tu	3.76e-07	NA	1.90e-11	NA
7. B	B1Z7C0	Sulfate adenylyltransferase subunit 1	3.26e-05	NA	0.002	NA
7. B	B4SSC0	Peptide chain release factor 3	1.96e-05	NA	8.30e-06	NA
7. B	A9ISD9	Elongation factor Tu	3.76e-07	NA	1.32e-12	NA
7. B	Q0HNV1	Elongation factor Tu 1	4.93e-07	NA	1.41e-12	NA
7. B	Q02652	Tetracycline resistance protein TetM	1.44e-05	NA	1.19e-07	NA
7. B	Q18EY5	Elongation factor 1-alpha	1.13e-06	NA	1.88e-07	NA
7. B	A1USC1	Elongation factor Tu 1	4.15e-07	NA	6.90e-11	NA
7. B	Q5JFZ3	Elongation factor 2	5.53e-05	NA	4.32e-10	NA
7. B	B7KIU2	Translation initiation factor IF-2	0.00e+00	NA	3.87e-149	NA
7. B	B9F2U5	Translation factor GUF1 homolog, chloroplastic	5.00e-06	NA	6.34e-11	NA
7. B	Q318N5	Elongation factor Tu	2.90e-07	NA	3.46e-10	NA
7. B	B9JB95	Sulfate adenylyltransferase subunit 1	4.99e-04	NA	5.70e-05	NA
7. B	A9BNJ8	Elongation factor 4	6.28e-07	NA	3.80e-07	NA
7. B	Q3SSW8	Elongation factor Tu	4.40e-07	NA	3.24e-14	NA
7. B	C5C0J4	Elongation factor G	7.01e-05	NA	1.19e-08	NA
7. B	B7JKB7	Elongation factor Tu	3.28e-07	NA	2.96e-14	NA
7. B	Q877L9	Elongation factor Tu	4.76e-07	NA	1.54e-07	NA
7. B	Q1H4N9	Elongation factor Tu 2	3.76e-07	NA	1.47e-11	NA
7. B	Q9TJQ8	Elongation factor Tu, plastid	3.72e-07	NA	8.81e-11	NA
7. B	Q2KHU8	Eukaryotic translation initiation factor 2 subunit 3	7.74e-07	NA	0.022	NA
7. B	B7NH42	Peptide chain release factor 3	1.10e-05	NA	1.26e-07	NA
7. B	Q5M1D9	GTPase Der	9.32e-04	NA	0.002	NA
7. B	Q748Y8	Elongation factor G 2	2.49e-05	NA	3.47e-08	NA
7. B	A6Q1L5	Elongation factor Tu	4.17e-07	NA	1.14e-12	NA
7. B	Q39DL2	Elongation factor G 2	3.62e-05	NA	2.55e-07	NA
7. B	P0C951	Small COPII coat GTPase SAR1	1.19e-04	NA	0.001	NA
7. B	Q7MH42	Elongation factor G 1	2.64e-05	NA	7.19e-08	NA
7. B	B2S682	Elongation factor G	4.32e-05	NA	1.12e-09	NA
7. B	Q8NXC0	Peptide chain release factor 3	1.96e-05	NA	2.20e-09	NA
7. B	B2J573	Peptide chain release factor 3	8.83e-05	NA	3.34e-11	NA
7. B	Q88QP8	Elongation factor Tu-A	5.91e-07	NA	7.09e-09	NA
7. B	Q925Y6	Elongation factor Tu	4.29e-07	NA	9.43e-12	NA
7. B	A0K3L0	Elongation factor Tu	5.06e-07	NA	3.83e-11	NA
7. B	B6J0P2	Peptide chain release factor 3	5.56e-05	NA	2.35e-07	NA
7. B	C3K5A9	Peptide chain release factor 3	3.51e-05	NA	5.02e-07	NA
7. B	Q4AAQ8	Elongation factor 4	3.54e-06	NA	2.10e-11	NA
7. B	Q5M2M6	Elongation factor G	2.15e-05	NA	4.42e-09	NA
7. B	C1CDW4	GTPase Era	1.40e-03	NA	1.71e-04	NA
7. B	Q8YP23	Peptide chain release factor 3	8.56e-05	NA	4.03e-11	NA
7. B	A2RFQ4	Elongation factor Tu	4.11e-07	NA	1.81e-12	NA
7. B	B0BUR2	Elongation factor Tu	4.51e-07	NA	2.74e-14	NA
7. B	Q8Y8C0	Peptide chain release factor 3	1.89e-05	NA	1.85e-06	NA
7. B	Q8RB72	Elongation factor 4	3.56e-06	NA	1.27e-10	NA
7. B	Q92J93	Elongation factor G	7.67e-05	NA	1.66e-08	NA
7. B	C1CR98	Elongation factor 4	8.85e-06	NA	2.79e-11	NA
7. B	Q63WJ7	Elongation factor G 1	5.39e-05	NA	1.59e-07	NA
7. B	A2BPP8	Elongation factor 4	2.20e-06	NA	7.43e-09	NA
7. B	B6JET0	Elongation factor G	3.69e-06	NA	2.24e-10	NA
7. B	Q14HG2	Sulfate adenylyltransferase subunit 1	5.01e-05	NA	0.001	NA
7. B	Q18CE4	Elongation factor Tu	3.47e-07	NA	3.46e-12	NA
7. B	Q6D9A5	Translation initiation factor IF-2	0.00e+00	NA	1.41e-151	NA
7. B	A0KTZ6	Translation initiation factor IF-2	0.00e+00	NA	1.85e-157	NA
7. B	Q13TG7	Elongation factor G 2	5.67e-05	NA	6.41e-07	NA
7. B	D2VRR7	Translation factor GUF1 homolog, mitochondrial	6.94e-05	NA	1.01e-09	NA
7. B	A1CXG4	Elongation factor G, mitochondrial	1.27e-03	NA	1.85e-06	NA
7. B	Q6GBU0	Elongation factor G	1.02e-04	NA	3.56e-08	NA
7. B	Q1R7U0	Sulfate adenylyltransferase subunit 1	6.22e-06	NA	4.38e-04	NA
7. B	A4VTQ7	Elongation factor Tu	4.30e-07	NA	1.27e-11	NA
7. B	Q83JC4	Elongation factor Tu	5.79e-07	NA	1.26e-13	NA
7. B	Q2S3R7	Elongation factor G	1.13e-04	NA	1.14e-08	NA
7. B	Q255F3	Elongation factor Tu	4.25e-07	NA	2.07e-11	NA
7. B	B8DW43	Translation initiation factor IF-2	0.00e+00	NA	4.09e-163	NA
7. B	A4IQA2	GTPase Der	8.01e-04	NA	0.012	NA
7. B	Q057A2	Elongation factor Tu	4.65e-07	NA	1.17e-13	NA
7. B	P42476	Elongation factor Tu	4.57e-07	NA	4.28e-10	NA
7. B	C5C9T1	Translation initiation factor IF-2	0.00e+00	NA	1.35e-165	NA
7. B	Q5NZS1	Translation initiation factor IF-2	0.00e+00	NA	1.04e-167	NA
7. B	A8GKK1	Elongation factor Tu 2	5.33e-07	NA	3.02e-13	NA
7. B	A3NXL8	Elongation factor 4	8.98e-07	NA	5.27e-09	NA
7. B	A9KRZ4	Elongation factor Tu	4.87e-07	NA	8.75e-12	NA
7. B	A1JS52	Elongation factor Tu 2	5.65e-07	NA	5.68e-14	NA
7. B	B9M4U5	Elongation factor 4	1.93e-06	NA	1.52e-09	NA
7. B	O24756	GTPase Era	1.26e-03	NA	2.96e-04	NA
7. B	Q8CQ82	Elongation factor G	8.55e-05	NA	5.12e-09	NA
7. B	Q6GAQ7	Peptide chain release factor 3	1.86e-05	NA	2.20e-09	NA
7. B	A4VX53	GTPase Der	1.87e-03	NA	4.72e-05	NA
7. B	Q05FI3	Elongation factor Tu	4.37e-06	NA	1.31e-09	NA
7. B	A8YUS2	Elongation factor Tu	3.74e-07	NA	1.84e-13	NA
7. B	A5UF34	Translation initiation factor IF-2	0.00e+00	NA	3.24e-155	NA
7. B	C4K3F0	Translation initiation factor IF-2	0.00e+00	NA	5.74e-146	NA
7. B	A6WDJ3	Elongation factor 4	4.46e-06	NA	6.01e-09	NA
7. B	C4Z0C8	GTPase Der	4.62e-03	NA	0.006	NA
7. B	B1ILK9	GTPase Era	8.64e-04	NA	5.60e-05	NA
7. B	Q5FFN4	GTPase Era	3.49e-03	NA	0.017	NA
7. B	A1JJT0	Sulfate adenylyltransferase subunit 1	2.01e-04	NA	4.38e-05	NA
7. B	Q7N9B2	Elongation factor G	2.74e-05	NA	2.39e-07	NA
7. B	P48864	Elongation factor Tu	4.01e-07	NA	2.93e-10	NA
7. B	Q1D5X5	GTPase Der	3.28e-03	NA	1.82e-04	NA
7. B	Q8EK70	Elongation factor Tu 2	4.49e-07	NA	1.07e-12	NA
7. B	A1VIP8	Elongation factor Tu	4.55e-07	NA	3.38e-12	NA
7. B	P81795	Eukaryotic translation initiation factor 2 subunit 3, X-linked	1.78e-06	NA	0.023	NA
7. B	B2V2K0	GTPase Era	6.33e-03	NA	0.001	NA
7. B	Q32CH9	Sulfate adenylyltransferase subunit 1	5.70e-06	NA	3.95e-04	NA
7. B	A6VKH7	Elongation factor Tu	4.84e-07	NA	9.36e-13	NA
7. B	F4IW10	Elongation factor G-2, mitochondrial	1.12e-04	NA	5.23e-08	NA
7. B	P57939	Elongation factor Tu-A	4.31e-07	NA	1.67e-13	NA
7. B	P50062	Elongation factor Tu	4.57e-07	NA	5.81e-11	NA
7. B	A7HWP7	Elongation factor Tu	4.63e-07	NA	1.47e-12	NA
7. B	Q5HAS0	Elongation factor Tu	3.96e-07	NA	1.94e-08	NA
7. B	Q5R6Y0	HBS1-like protein	1.14e-03	NA	0.009	NA
7. B	Q8KHX9	Elongation factor Tu	3.90e-07	NA	9.95e-12	NA
7. B	C3NED6	Elongation factor 2	1.24e-04	NA	2.49e-08	NA
7. B	B9KFF9	Elongation factor Tu	4.70e-07	NA	5.12e-11	NA
7. B	Q0W8G2	Elongation factor 1-alpha	3.48e-07	NA	1.02e-07	NA
7. B	Q9TLX6	Probable tRNA modification GTPase MnmE	1.40e-03	NA	0.030	NA
7. B	A2BYM0	Translation initiation factor IF-2	0.00e+00	NA	1.23e-155	NA
7. B	Q58735	Uncharacterized protein MJ1339	4.44e-08	NA	1.76e-11	NA
7. B	Q6L200	Elongation factor 2	1.24e-04	NA	9.38e-09	NA
7. B	A0M6M2	Elongation factor 4	1.08e-06	NA	3.76e-06	NA
7. B	Q2NJ20	Elongation factor Tu	4.80e-07	NA	8.77e-12	NA
7. B	A1KV51	Translation initiation factor IF-2	0.00e+00	NA	6.74e-154	NA
7. B	C1CRT1	GTPase Era	4.38e-03	NA	1.86e-04	NA
7. B	P56002	Elongation factor G	2.52e-05	NA	4.53e-08	NA
7. B	Q2A1M0	Elongation factor Tu	5.24e-07	NA	2.69e-13	NA
7. B	A1UBL1	Elongation factor Tu	4.64e-07	NA	1.55e-09	NA
7. B	B1JLY0	Translation initiation factor IF-2	0.00e+00	NA	6.38e-154	NA
7. B	Q7M7X5	Translation initiation factor IF-2	0.00e+00	NA	6.23e-160	NA
7. B	B5F8F8	Elongation factor G	1.98e-05	NA	7.70e-07	NA
7. B	C4ZT56	Peptide chain release factor 3	1.08e-05	NA	1.26e-07	NA
7. B	O13869	Translation factor guf1, mitochondrial	3.87e-06	NA	6.46e-06	NA
7. B	A3PV96	Elongation factor Tu	5.41e-07	NA	1.55e-09	NA
7. B	Q05FI2	Elongation factor G	1.73e-04	NA	2.41e-11	NA
7. B	A1R516	Translation initiation factor IF-2	0.00e+00	NA	2.15e-162	NA
7. B	B0K708	GTPase Era	1.47e-03	NA	3.87e-06	NA
7. B	Q9JHW4	Selenocysteine-specific elongation factor	5.26e-05	NA	2.07e-05	NA
7. B	A2STF0	Elongation factor 1-alpha	5.26e-07	NA	0.001	NA
7. B	Q8KAG9	Elongation factor G	3.31e-05	NA	1.47e-07	NA
7. B	Q4MYA4	Elongation factor Tu, apicoplast	4.32e-06	NA	9.21e-09	NA
7. B	A7HWQ8	Elongation factor G	3.01e-05	NA	1.51e-08	NA
7. B	Q8K935	Peptide chain release factor 3	1.23e-05	NA	4.47e-09	NA
7. B	B8MS24	Translation factor guf1, mitochondrial	2.23e-05	NA	5.32e-07	NA
7. B	Q65QG6	Elongation factor Tu	4.79e-07	NA	4.49e-13	NA
7. B	Q831T9	GTPase Era	4.35e-03	NA	0.039	NA
7. B	B4TJ06	Translation initiation factor IF-2	0.00e+00	NA	3.44e-152	NA
7. B	C0ZYA5	Translation initiation factor IF-2	0.00e+00	NA	6.20e-154	NA
7. B	Q7M7F1	Elongation factor Tu	4.28e-07	NA	7.09e-07	NA
7. B	A0ALY8	Elongation factor Tu	4.78e-07	NA	1.86e-13	NA
7. B	A6GYU7	Elongation factor Tu	4.14e-07	NA	4.51e-11	NA
7. B	B4TXE8	Elongation factor G	2.43e-05	NA	7.70e-07	NA
7. B	Q2SVG8	Translation initiation factor IF-2	0.00e+00	NA	2.75e-168	NA
7. B	Q5PEH2	Sulfate adenylyltransferase subunit 1	8.00e-05	NA	4.09e-05	NA
7. B	Q1D6M1	Elongation factor 4	1.18e-06	NA	3.37e-10	NA
7. B	B4T4G3	Peptide chain release factor 3	1.09e-05	NA	1.28e-07	NA
7. B	B3EH93	Elongation factor Tu	4.36e-07	NA	5.71e-15	NA
7. B	P42479	Elongation factor Tu	3.75e-07	NA	1.87e-14	NA
7. B	Q211E5	Elongation factor G	2.35e-05	NA	6.44e-09	NA
7. B	B5RCY8	GTPase Der	4.53e-03	NA	0.017	NA
7. B	P0DA91	GTPase Der	1.63e-03	NA	3.19e-05	NA
7. B	Q39H30	Translation initiation factor IF-2	0.00e+00	NA	6.89e-166	NA
7. B	P20174	Tetracycline resistance protein TetO	2.08e-05	NA	5.23e-11	NA
7. B	B1K0M0	Translation initiation factor IF-2	0.00e+00	NA	7.41e-168	NA
7. B	Q5AAV3	Ribosome-releasing factor 2, mitochondrial	1.49e-03	NA	2.05e-09	NA
7. B	C3L9F4	GTPase Der	1.79e-03	NA	0.016	NA
7. B	A5I7K8	Elongation factor Tu	3.97e-07	NA	1.90e-11	NA
7. B	P28996	Elongation factor 2	7.26e-04	NA	1.34e-05	NA
7. B	Q8P1W4	Elongation factor Tu	3.74e-07	NA	1.36e-12	NA
7. B	B7VJH7	Translation initiation factor IF-2	0.00e+00	NA	4.55e-156	NA
7. B	Q8KCH0	Elongation factor 4	3.58e-06	NA	6.17e-07	NA
7. B	Q1IX70	Elongation factor Tu	5.72e-07	NA	6.10e-08	NA
7. B	A9BHA8	Elongation factor G	3.08e-05	NA	8.71e-07	NA
7. B	Q7Q3I6	Ribosome-releasing factor 2, mitochondrial	2.25e-04	NA	4.20e-06	NA
7. B	Q126K0	Elongation factor 4	8.25e-07	NA	3.50e-08	NA
7. B	P23112	Elongation factor 2	2.21e-04	NA	7.70e-08	NA
7. B	Q6HPR0	Elongation factor Tu	3.36e-07	NA	2.96e-14	NA
7. B	A7WYX6	Elongation factor Tu	3.74e-07	NA	3.46e-12	NA
7. B	Q88FI4	Elongation factor G 2	4.04e-05	NA	1.31e-09	NA
7. B	B1YE08	Elongation factor 2	3.69e-05	NA	3.61e-08	NA
7. B	A8A779	Elongation factor Tu 2	5.96e-07	NA	1.17e-13	NA
7. B	A6MW28	Elongation factor Tu, chloroplastic	2.59e-07	NA	1.31e-12	NA
7. B	A1KL96	Elongation factor 4	1.72e-05	NA	2.09e-08	NA
7. B	C5D3R4	Elongation factor G	3.01e-05	NA	1.67e-09	NA
7. B	Q5UXU6	Probable translation initiation factor IF-2	6.94e-11	NA	2.52e-40	NA
7. B	A8A3N0	Sulfate adenylyltransferase subunit 1	5.83e-06	NA	3.91e-04	NA
7. B	Q0BUQ2	Elongation factor Tu	4.29e-07	NA	1.12e-12	NA
7. B	Q1GAP7	Probable GTP-binding protein EngB	9.05e-06	NA	0.031	NA
7. B	Q1JIH4	GTPase Der	2.09e-03	NA	3.06e-05	NA
7. B	C1ET37	Elongation factor Tu	3.08e-07	NA	2.96e-14	NA
7. B	A4VZZ3	Elongation factor Tu	4.35e-07	NA	1.27e-11	NA
7. B	Q6MJ00	Elongation factor Tu	3.75e-07	NA	2.36e-09	NA
7. B	Q8DR09	Peptide chain release factor 3	6.65e-05	NA	2.12e-07	NA
7. B	A6VGV5	Elongation factor 2	8.45e-05	NA	2.66e-09	NA
7. B	B2JKT4	Translation initiation factor IF-2	0.00e+00	NA	4.71e-162	NA
7. B	Q8UJ51	Translation initiation factor IF-2	0.00e+00	NA	1.73e-155	NA
7. B	Q4FTW3	GTPase Der	3.77e-03	NA	0.015	NA
7. B	Q93Y31	ADP-ribosylation factor-like protein 8b	3.93e-06	NA	0.027	NA
7. B	Q7VRN9	Elongation factor G	4.42e-05	NA	2.00e-07	NA
7. B	Q65W89	Elongation factor G	1.96e-05	NA	1.04e-07	NA
7. B	B8HG54	Translation initiation factor IF-2	0.00e+00	NA	1.14e-162	NA
7. B	Q0ATE3	Elongation factor 4	2.99e-06	NA	1.97e-07	NA
7. B	B3QPU3	Elongation factor 4	3.71e-06	NA	1.00e-06	NA
7. B	B8GIQ3	Elongation factor 1-alpha	4.43e-06	NA	5.74e-08	NA
7. B	B0TC54	Elongation factor Tu	4.98e-07	NA	2.76e-11	NA
7. B	A0L631	Elongation factor 4	2.80e-06	NA	3.50e-10	NA
7. B	A1S204	Elongation factor Tu	4.86e-07	NA	6.27e-14	NA
7. B	Q2S6X1	Elongation factor G 2	6.71e-05	NA	1.06e-07	NA
7. B	Q63Q08	Elongation factor G 2	4.35e-05	NA	5.13e-07	NA
7. B	A4G9U0	Elongation factor Tu	4.61e-07	NA	3.26e-12	NA
7. B	Q5NQ66	Elongation factor G	1.74e-05	NA	1.08e-06	NA
7. B	P46280	Elongation factor Tu, chloroplastic	5.69e-06	NA	2.32e-11	NA
7. B	Q11Q98	Elongation factor Tu	4.10e-07	NA	1.10e-10	NA
7. B	Q5HRK5	Elongation factor G	7.70e-05	NA	5.12e-09	NA
7. B	B6IUG3	Elongation factor 4	2.94e-06	NA	9.67e-08	NA
7. B	A7A1H2	Translation factor GUF1, mitochondrial	1.35e-05	NA	3.90e-06	NA
7. B	Q3YX73	Translation initiation factor IF-2	0.00e+00	NA	3.95e-153	NA
7. B	A8LQ56	Translation initiation factor IF-2	0.00e+00	NA	1.17e-154	NA
7. B	P42471	Elongation factor Tu	5.23e-07	NA	2.10e-08	NA
7. B	B5E6U5	Elongation factor G	6.19e-05	NA	2.02e-09	NA
7. B	B4EWB0	Peptide chain release factor 3	2.86e-05	NA	6.58e-07	NA
7. B	A7Z0N5	Elongation factor Tu	3.34e-07	NA	6.86e-13	NA
7. B	A9BCK1	Elongation factor G	1.14e-05	NA	4.84e-10	NA
7. B	Q1BWS7	Translation initiation factor IF-2	0.00e+00	NA	5.61e-168	NA
7. B	A3QGT8	Peptide chain release factor 3	3.12e-05	NA	1.04e-05	NA
7. B	Q6AG49	Translation initiation factor IF-2	0.00e+00	NA	1.52e-161	NA
7. B	B3EE17	Elongation factor 4	3.73e-06	NA	4.13e-08	NA
7. B	B7HL14	GTPase Der	8.91e-04	NA	0.016	NA
7. B	Q327M2	Peptide chain release factor 3	1.02e-05	NA	1.26e-07	NA
7. B	A9BHA7	Elongation factor Tu	3.80e-07	NA	1.15e-13	NA
7. B	A1KB29	Elongation factor Tu	4.42e-07	NA	4.05e-09	NA
7. B	Q2KV83	Elongation factor G 2	3.12e-05	NA	1.89e-07	NA
7. B	Q7VRP0	Elongation factor Tu	4.55e-07	NA	5.53e-14	NA
7. B	B7VJG2	Peptide chain release factor 3	1.22e-05	NA	1.15e-06	NA
7. B	Q1WVA0	Elongation factor G	1.96e-05	NA	3.19e-09	NA
7. B	P49462	Elongation factor Tu, chloroplastic	3.20e-07	NA	1.58e-06	NA
7. B	Q667U9	Elongation factor 4	1.04e-06	NA	2.16e-10	NA
7. B	Q4URC5	Elongation factor Tu 2	4.16e-07	NA	4.79e-09	NA
7. B	A7TQJ9	Ribosome-releasing factor 2, mitochondrial	3.43e-05	NA	4.01e-07	NA
7. B	Q2JFH9	Elongation factor G	2.76e-05	NA	1.18e-08	NA
7. B	P17196	Elongation factor 1-alpha	1.15e-06	NA	0.049	NA
7. B	Q7MYE8	Elongation factor Tu 2	4.20e-07	NA	8.00e-14	NA
7. B	Q6YQV9	Elongation factor G	6.45e-05	NA	4.64e-09	NA
7. B	A7I3U7	Elongation factor Tu	4.54e-07	NA	4.36e-11	NA
7. B	Q82BZ3	Elongation factor 4	4.96e-06	NA	4.21e-07	NA
7. B	Q43364	Elongation factor TuB, chloroplastic	7.41e-06	NA	1.90e-09	NA
7. B	Q5L659	Elongation factor 4	3.82e-06	NA	1.66e-08	NA
7. B	A8WTI8	Elongation factor G, mitochondrial	4.03e-04	NA	2.32e-07	NA
7. B	A4SVW0	Elongation factor 4	1.02e-06	NA	8.52e-09	NA
7. B	Q03PV4	Elongation factor G	3.52e-05	NA	1.76e-08	NA
7. B	P60339	Elongation factor Tu-B	5.29e-07	NA	1.12e-12	NA
7. B	Q57G48	Peptide chain release factor 3	1.10e-05	NA	1.28e-07	NA
7. B	Q5PBH2	Elongation factor G	5.31e-06	NA	2.29e-07	NA
7. B	A8AD16	Elongation factor 4	5.60e-05	NA	6.39e-09	NA
7. B	Q1BRU5	Elongation factor G 2	3.95e-05	NA	8.97e-07	NA
7. B	B1LQ72	Sulfate adenylyltransferase subunit 1	7.03e-06	NA	4.12e-04	NA
7. B	A1APR9	GTPase Der	7.48e-03	NA	0.002	NA
7. B	A5DTX8	Ribosome-releasing factor 2, mitochondrial	1.08e-03	NA	2.95e-09	NA
7. B	C5A5P4	Elongation factor 1-alpha	2.61e-06	NA	1.58e-07	NA
7. B	O07631	50S ribosomal subunit assembly factor BipA	6.15e-05	NA	7.48e-11	NA
7. B	Q2GFN5	Elongation factor G	2.23e-05	NA	4.64e-08	NA
7. B	A1BJ37	Elongation factor G	3.30e-05	NA	7.13e-07	NA
7. B	A2S7F9	Elongation factor Tu	4.50e-07	NA	3.06e-12	NA
7. B	Q15W54	Peptide chain release factor 3	1.17e-05	NA	1.81e-06	NA
7. B	Q8AA33	Elongation factor 4	9.69e-07	NA	1.36e-07	NA
7. B	Q03MB1	GTPase Der	1.03e-03	NA	4.73e-04	NA
7. B	B6QHL4	Elongation factor G, mitochondrial	9.31e-04	NA	2.97e-06	NA
7. B	P9WNM7	Elongation factor G	4.54e-05	NA	7.02e-08	NA
7. B	P43926	Elongation factor Tu	5.09e-07	NA	1.58e-13	NA
7. B	Q4A7K0	Elongation factor Tu	4.57e-07	NA	1.99e-10	NA
7. B	A1R8U9	Elongation factor Tu	4.93e-07	NA	5.58e-06	NA
7. B	Q5X443	Elongation factor 4	1.71e-06	NA	3.15e-08	NA
7. B	Q7MPF2	Sulfate adenylyltransferase subunit 1	9.69e-06	NA	4.72e-05	NA
7. B	Q9HM89	Elongation factor 1-alpha	4.34e-06	NA	1.98e-07	NA
7. B	A8EZL8	Elongation factor Tu	4.68e-07	NA	4.30e-14	NA
7. B	P18905	Elongation factor Tu, chloroplastic	4.60e-07	NA	1.28e-05	NA
7. B	B8MR69	Ribosome-releasing factor 2, mitochondrial	9.89e-04	NA	4.92e-07	NA
7. B	Q2RMS0	Translation initiation factor IF-2	0.00e+00	NA	3.27e-167	NA
7. B	Q1CU14	GTPase Era	4.46e-03	NA	0.024	NA
7. B	Q48D34	Elongation factor Tu	5.16e-07	NA	8.17e-09	NA
7. B	B2U2U7	Elongation factor G	2.11e-05	NA	1.30e-07	NA
7. B	Q6AP73	Elongation factor Tu 2	4.37e-07	NA	7.68e-14	NA
7. B	Q2RQV8	Elongation factor Tu 1	4.40e-07	NA	6.24e-11	NA
7. B	A4S3R2	Translation factor GUF1 homolog, mitochondrial	1.17e-04	NA	1.39e-08	NA
7. B	B0G189	Translation factor GUF1 homolog, mitochondrial	8.98e-06	NA	1.75e-06	NA
7. B	Q04B37	Elongation factor Tu	4.17e-07	NA	4.38e-13	NA
7. B	A1QZR2	Elongation factor Tu	3.59e-07	NA	2.76e-10	NA
7. B	P68790	Elongation factor G	1.20e-05	NA	3.56e-08	NA
7. B	A9M3J8	Elongation factor 4	1.14e-06	NA	2.25e-10	NA
7. B	Q2FI57	Peptide chain release factor 3	2.11e-05	NA	2.29e-09	NA
7. B	Q63US9	GTPase Der	2.78e-03	NA	0.024	NA
7. B	Q2LTB9	Elongation factor G 1	1.61e-05	NA	2.09e-08	NA
7. B	A5FRY7	Elongation factor G	1.51e-04	NA	1.93e-07	NA
7. B	B8N9M2	Elongation factor G, mitochondrial	6.77e-03	NA	3.28e-06	NA
7. B	C0QVZ4	Elongation factor Tu	1.23e-06	NA	6.15e-13	NA
7. B	Q1WTQ4	GTPase Der	8.54e-04	NA	5.68e-04	NA
7. B	Q67JU1	Elongation factor Tu	3.46e-07	NA	2.81e-11	NA
7. B	Q21IS6	Sulfate adenylyltransferase subunit 1	7.68e-06	NA	2.51e-06	NA
7. B	A6UPK8	Translation initiation factor 2 subunit gamma	8.87e-07	NA	9.84e-06	NA
7. B	Q5SHN5	Elongation factor G	7.30e-06	NA	7.31e-07	NA
7. B	A9KFA1	GTPase Era	1.20e-03	NA	0.040	NA
7. B	A5VLK8	Elongation factor G	2.45e-05	NA	2.22e-09	NA
7. B	Q2G0N0	Elongation factor Tu	3.90e-07	NA	3.46e-12	NA
7. B	Q9JX07	Elongation factor G	2.56e-05	NA	5.04e-07	NA
7. B	Q47LJ0	Elongation factor G	1.24e-05	NA	5.52e-10	NA
7. B	B5FJM0	Elongation factor G	2.39e-05	NA	7.70e-07	NA
7. B	B5XSX4	Translation initiation factor IF-2	0.00e+00	NA	1.25e-152	NA
7. B	Q66FQ9	Elongation factor Tu 1	5.03e-07	NA	1.96e-13	NA
7. B	P33169	Elongation factor Tu	4.51e-07	NA	4.29e-13	NA
7. B	P0A1H5	Elongation factor Tu	4.64e-07	NA	2.67e-13	NA
7. B	Q5L627	Translation initiation factor IF-2	0.00e+00	NA	2.05e-121	NA
7. B	Q0TCC0	Elongation factor Tu 1	5.79e-07	NA	1.26e-13	NA
7. B	B9E8Q1	Elongation factor G	1.25e-05	NA	8.53e-11	NA
7. B	Q5ZMS3	Eukaryotic translation initiation factor 2 subunit 3	1.75e-06	NA	0.022	NA
7. B	Q04N79	Elongation factor Tu	4.84e-07	NA	8.23e-11	NA
7. B	Q5GSU1	Elongation factor G	2.72e-05	NA	6.58e-07	NA
7. B	Q39FR3	GTPase Der	5.57e-03	NA	0.023	NA
7. B	P23835	Tetracycline resistance protein TetO	2.06e-05	NA	2.07e-11	NA
7. B	C1C8U6	GTPase Der	2.19e-03	NA	6.10e-06	NA
7. B	B8HVR8	Elongation factor G	2.56e-05	NA	7.04e-08	NA
7. B	Q3BVV9	Elongation factor 4	1.42e-06	NA	1.02e-08	NA
7. B	A8FEL8	GTPase Der	8.37e-04	NA	0.042	NA
7. B	Q7NAT2	Elongation factor 4	2.75e-06	NA	2.35e-16	NA
7. B	B0R8C3	Elongation factor 1-alpha	1.84e-06	NA	1.98e-07	NA
7. B	Q3Z864	Elongation factor 4	1.03e-06	NA	3.88e-10	NA
7. B	A8Z0C4	Peptide chain release factor 3	2.19e-05	NA	2.29e-09	NA
7. B	B1I1I5	Elongation factor G	2.00e-05	NA	3.68e-08	NA
7. B	A9NAM1	Elongation factor G	3.02e-05	NA	3.74e-08	NA
7. B	O21245	Elongation factor Tu, mitochondrial	3.26e-07	NA	1.82e-15	NA
7. B	Q89J82	Elongation factor Tu	4.34e-07	NA	9.19e-12	NA
7. B	Q5R6E0	116 kDa U5 small nuclear ribonucleoprotein component	1.52e-02	NA	3.39e-07	NA
7. B	Q118Z3	Elongation factor G 1	9.46e-05	NA	1.89e-07	NA
7. B	A6UF29	Translation initiation factor IF-2	0.00e+00	NA	1.94e-155	NA
7. B	P23568	Elongation factor Tu	4.32e-07	NA	3.40e-12	NA
7. B	A5IZ33	Elongation factor G	6.57e-05	NA	6.20e-10	NA
7. B	B2S0H9	Elongation factor Tu	3.67e-07	NA	1.03e-10	NA
7. B	P34617	Translation factor GUF1 homolog, mitochondrial	3.96e-05	NA	1.58e-14	NA
7. B	Q8CQ81	Elongation factor Tu	3.87e-07	NA	1.68e-12	NA
7. B	A2S7H3	Elongation factor G	4.03e-05	NA	5.13e-07	NA
7. B	B8GTN1	GTPase Der	7.55e-03	NA	0.028	NA
7. B	A6VU13	Peptide chain release factor 3	1.11e-05	NA	1.24e-07	NA
7. B	A3CP09	Elongation factor Tu	4.56e-07	NA	7.40e-11	NA
7. B	B7LXT6	Peptide chain release factor 3	1.10e-05	NA	1.22e-07	NA
7. B	A1WLI3	Translation initiation factor IF-2	0.00e+00	NA	4.71e-158	NA
7. B	A9ABD5	Translation initiation factor IF-2	0.00e+00	NA	2.05e-168	NA
7. B	Q88VE0	Elongation factor Tu	3.96e-07	NA	1.40e-12	NA
7. B	Q9XD38	Elongation factor Tu	1.92e-07	NA	1.08e-14	NA
7. B	Q2NGM6	Probable translation initiation factor IF-2	2.18e-11	NA	1.05e-36	NA
7. B	Q8C0D5	Elongation factor-like GTPase 1	6.47e-02	NA	1.34e-11	NA
7. B	Q0SY20	Elongation factor Tu 2	5.76e-07	NA	1.17e-13	NA
7. B	A5WGK9	Elongation factor Tu 1	4.98e-07	NA	9.02e-12	NA
7. B	Q492B1	Elongation factor G	3.70e-05	NA	6.46e-09	NA
7. B	Q1H0I2	Peptide chain release factor 3	1.26e-04	NA	3.97e-06	NA
7. B	O84098	Translation initiation factor IF-2	0.00e+00	NA	5.91e-127	NA
7. B	B6JL99	GTPase Era	2.00e-03	NA	0.025	NA
7. B	B6J6N8	Peptide chain release factor 3	5.22e-05	NA	3.19e-07	NA
7. B	Q3JZR6	GTPase Der	2.02e-03	NA	7.17e-05	NA
7. B	A1VG83	Translation initiation factor IF-2	0.00e+00	NA	8.24e-162	NA
7. B	A5F3K0	Elongation factor Tu	4.24e-07	NA	3.40e-14	NA
7. B	P9WNM9	Elongation factor G-like protein	2.91e-05	NA	0.012	NA
7. B	P10952	Tetracycline resistance protein TetO	3.56e-05	NA	2.76e-11	NA
7. B	Q877P8	Elongation factor Tu	3.49e-07	NA	3.01e-11	NA
7. B	Q3AZB7	Translation initiation factor IF-2	0.00e+00	NA	6.59e-151	NA
7. B	O14460	Elongation factor 2	4.13e-03	NA	1.82e-05	NA
7. B	Q2II78	Elongation factor Tu	4.26e-07	NA	7.54e-14	NA
7. B	Q1GB78	Peptide chain release factor 3	5.66e-05	NA	4.00e-08	NA
7. B	B0SSH9	Elongation factor Tu	4.07e-07	NA	9.00e-15	NA
7. B	Q38WR7	Elongation factor Tu	3.39e-07	NA	5.93e-12	NA
7. B	O31298	Elongation factor Tu	5.17e-07	NA	4.74e-13	NA
7. B	P50068	Elongation factor Tu	3.75e-07	NA	2.97e-15	NA
7. B	Q0SMX0	Elongation factor G 1	1.75e-05	NA	7.94e-08	NA
7. B	C6DG80	Elongation factor G	2.58e-05	NA	1.56e-06	NA
7. B	A4SFN5	Elongation factor 4	3.49e-06	NA	7.03e-06	NA
7. B	Q9ZK19	Elongation factor Tu	4.24e-07	NA	1.71e-10	NA
7. B	A0KQ95	Elongation factor Tu	4.55e-07	NA	1.16e-13	NA
7. B	Q5GWR8	Elongation factor Tu	4.75e-07	NA	8.07e-10	NA
7. B	Q1XDK1	Elongation factor Tu, chloroplastic	2.90e-07	NA	6.94e-12	NA
7. B	Q5L5H6	Elongation factor Tu	5.03e-07	NA	2.34e-11	NA
7. B	Q71WB9	Elongation factor Tu	3.65e-07	NA	1.86e-13	NA
7. B	B2HUQ4	Elongation factor G	5.27e-05	NA	4.39e-07	NA
7. B	A9ETD1	Elongation factor Tu	6.64e-07	NA	4.78e-11	NA
7. B	Q1R270	Peptide chain release factor 3	1.11e-05	NA	1.31e-07	NA
7. B	B0USE8	Peptide chain release factor 3	1.06e-05	NA	1.95e-07	NA
7. B	Q6BJ25	Elongation factor 2	5.09e-03	NA	8.84e-07	NA
7. B	Q15NP2	Elongation factor Tu	4.66e-07	NA	7.18e-14	NA
7. B	Q7W0G3	Peptide chain release factor 3	1.75e-04	NA	5.61e-08	NA
7. B	P9WNM6	Elongation factor G	2.71e-05	NA	7.02e-08	NA
7. B	B0BB51	Elongation factor 4	3.00e-06	NA	3.42e-07	NA
7. B	A7ZSL4	Elongation factor Tu 1	5.69e-07	NA	1.26e-13	NA
7. B	Q2GD83	Elongation factor Tu	4.05e-07	NA	8.32e-10	NA
7. B	Q30Q17	Elongation factor 4	2.61e-06	NA	2.65e-09	NA
7. B	Q2GD82	Elongation factor G	7.37e-06	NA	9.19e-09	NA
7. B	A9NAK7	Elongation factor Tu	3.42e-07	NA	3.25e-13	NA
7. B	A3DBA0	Elongation factor Tu 2	4.79e-07	NA	4.74e-13	NA
7. B	Q6GBT9	Elongation factor Tu	3.97e-07	NA	3.46e-12	NA
7. B	B5FI13	Translation initiation factor IF-2	0.00e+00	NA	3.44e-152	NA
7. B	P64029	Elongation factor Tu	3.75e-07	NA	3.46e-12	NA
7. B	Q1QDV6	Elongation factor 4	1.45e-06	NA	1.45e-08	NA
7. B	Q73IX6	Elongation factor Tu 1	1.88e-07	NA	1.27e-12	NA
7. B	Q8G075	Elongation factor G	3.36e-05	NA	1.10e-09	NA
7. B	A7I4X4	Elongation factor 2	3.91e-05	NA	2.53e-10	NA
7. B	P13639	Elongation factor 2	6.89e-03	NA	5.88e-05	NA
7. B	Q8XFP8	Elongation factor Tu	3.72e-07	NA	2.97e-10	NA
7. B	P50374	Elongation factor Tu, chloroplastic (Fragment)	1.74e-07	NA	7.55e-04	NA
7. B	A6U7A9	GTPase Era	1.85e-03	NA	0.007	NA
7. B	B3QZH5	Elongation factor Tu	2.39e-07	NA	3.28e-09	NA
7. B	Q12GX4	Elongation factor G 1	2.79e-05	NA	6.93e-07	NA
7. B	Q5SHN6	Elongation factor Tu-A	5.18e-07	NA	1.10e-12	NA
7. B	Q3K1T4	Peptide chain release factor 3	1.66e-05	NA	2.98e-07	NA
7. B	Q92A71	GTPase Der	8.50e-04	NA	0.017	NA
7. B	Q47810	Tetracycline resistance protein TetM from transposon TnFO1	2.63e-05	NA	9.94e-11	NA
7. B	P64028	Elongation factor Tu	3.45e-07	NA	3.46e-12	NA
7. B	Q4FUQ9	Peptide chain release factor 3	1.08e-04	NA	2.37e-04	NA
7. B	Q0A8Z4	Elongation factor 4	3.24e-05	NA	3.16e-10	NA
7. B	Q8KTA1	Elongation factor Tu	5.18e-07	NA	5.47e-13	NA
7. B	P42478	Elongation factor Tu (Fragment)	7.70e-07	NA	3.25e-10	NA
7. B	B9MJZ5	Elongation factor 4	4.95e-06	NA	2.77e-11	NA
7. B	B6YQ44	Translation initiation factor IF-2	0.00e+00	NA	9.08e-149	NA
7. B	Q2KDZ5	Translation initiation factor IF-2	0.00e+00	NA	1.51e-150	NA
7. B	Q28UW7	Elongation factor Tu	3.84e-07	NA	2.54e-11	NA
7. B	P33168	Elongation factor Tu	4.89e-07	NA	6.36e-10	NA
7. B	Q03QU8	Elongation factor 4	2.13e-06	NA	2.97e-11	NA
7. B	Q7NEF2	Elongation factor G	1.59e-05	NA	2.62e-08	NA
7. B	C0QHM2	Translation initiation factor IF-2	0.00e+00	NA	1.50e-149	NA
7. B	Q3BRP5	Translation initiation factor IF-2	0.00e+00	NA	2.13e-156	NA
7. B	Q65H50	Elongation factor 4	5.84e-06	NA	2.46e-12	NA
7. B	Q2S9X0	Peptide chain release factor 3	2.93e-05	NA	5.06e-06	NA
7. B	B0T167	Translation initiation factor IF-2	0.00e+00	NA	1.26e-147	NA
7. B	A5FY07	Elongation factor 4	2.84e-06	NA	1.19e-08	NA
7. B	C1FVS6	GTPase Era	9.28e-04	NA	5.60e-05	NA
7. B	Q2YM08	Elongation factor Tu	4.20e-07	NA	7.09e-11	NA
7. B	Q050R3	Elongation factor 4	4.31e-06	NA	1.59e-08	NA
7. B	B1WT49	GTPase Era	3.73e-03	NA	0.002	NA
7. B	B0UWC4	Elongation factor G	1.91e-05	NA	1.51e-07	NA
7. B	Q83JX8	Sulfate adenylyltransferase subunit 1	6.31e-05	NA	3.07e-04	NA
7. B	Q5NID9	Elongation factor Tu	5.35e-07	NA	2.79e-13	NA
7. B	C1CB46	Elongation factor G	6.07e-05	NA	2.02e-09	NA
7. B	C5BQ43	Elongation factor G	4.74e-05	NA	2.72e-09	NA
7. B	B7MZ52	Sulfate adenylyltransferase subunit 1	5.57e-06	NA	4.12e-04	NA
7. B	C3PMH0	Elongation factor G	6.37e-05	NA	1.60e-08	NA
7. B	Q5JGR9	Probable translation initiation factor IF-2	2.09e-05	NA	2.00e-28	NA
7. B	B7MHZ6	GTPase Der	3.76e-03	NA	0.019	NA
7. B	B8F8H7	Probable GTP-binding protein EngB	3.70e-05	NA	0.009	NA
7. B	A0RQX4	Elongation factor 4	3.55e-06	NA	4.78e-12	NA
7. B	C1KVA9	GTPase Era	1.31e-03	NA	0.047	NA
7. B	A7H4R3	Elongation factor Tu	4.71e-07	NA	3.25e-11	NA
7. B	Q98QW3	Elongation factor 4	1.20e-06	NA	2.03e-13	NA
7. B	A8AUR6	Elongation factor G	2.56e-05	NA	2.00e-09	NA
7. B	A0M5A0	Elongation factor G	6.10e-05	NA	5.52e-08	NA
7. B	A4W5A0	Elongation factor Tu	5.22e-07	NA	3.37e-13	NA
7. B	A1JIW9	Translation initiation factor IF-2	0.00e+00	NA	1.17e-158	NA
7. B	O30913	Elongation factor G 1	3.14e-05	NA	7.54e-08	NA
7. B	Q2L2G6	Elongation factor Tu	4.45e-07	NA	5.52e-12	NA
7. B	B1X6J0	Elongation factor G	2.11e-05	NA	1.30e-07	NA
7. B	Q46306	Tetracycline resistance protein TetP	9.79e-06	NA	2.20e-10	NA
7. B	B7UR02	Peptide chain release factor 3	1.06e-05	NA	1.26e-07	NA
7. B	B7G816	Translation factor GUF1 homolog, mitochondrial	1.86e-05	NA	5.19e-10	NA
7. B	P75022	Elongation factor Tu	4.61e-07	NA	2.79e-10	NA
7. B	Q3A9P8	Elongation factor Tu 2	3.98e-07	NA	4.62e-11	NA
7. B	Q8G5B7	Elongation factor Tu	3.72e-07	NA	3.79e-08	NA
7. B	Q3J8Q0	Elongation factor Tu	5.83e-07	NA	1.32e-11	NA
7. B	Q31CB8	Elongation factor 4	1.97e-06	NA	6.93e-09	NA
7. B	A1USL2	Elongation factor Tu 2	4.29e-07	NA	7.96e-11	NA
7. B	Q9KP20	Sulfate adenylyltransferase subunit 1	4.15e-05	NA	3.12e-05	NA
7. B	A9MF24	Sulfate adenylyltransferase subunit 1	6.22e-05	NA	5.94e-05	NA
7. B	Q877B9	Small COPII coat GTPase sar1	1.38e-04	NA	0.001	NA
7. B	A3NUL0	Translation initiation factor IF-2	0.00e+00	NA	1.78e-168	NA
7. B	Q0VSL7	Elongation factor Tu	5.54e-07	NA	3.97e-11	NA
7. B	Q5H1V2	Peptide chain release factor 3	2.31e-05	NA	2.93e-05	NA
7. B	A6QEK0	Elongation factor Tu	3.74e-07	NA	3.46e-12	NA
7. B	Q1GDV0	Elongation factor Tu	4.29e-07	NA	2.47e-11	NA
7. B	Q1BU86	Elongation factor G 1	4.77e-05	NA	2.69e-07	NA
7. B	C1AL18	Elongation factor Tu	4.60e-07	NA	2.16e-09	NA
7. B	Q9ZLW0	GTPase Era	2.20e-03	NA	0.027	NA
7. B	B7NQW0	GTPase Der	4.42e-03	NA	0.030	NA
7. B	B9DQA0	Peptide chain release factor 3	4.04e-05	NA	2.11e-08	NA
7. B	C3PH19	Translation initiation factor IF-2	0.00e+00	NA	3.26e-155	NA
7. B	Q0SZX8	Elongation factor Tu 1	4.85e-07	NA	1.20e-13	NA
7. B	Q975H5	Elongation factor 2	8.01e-04	NA	5.69e-08	NA
7. B	A0K7T2	GTPase Der	3.70e-03	NA	0.023	NA
7. B	Q6B8Y0	Elongation factor Tu, chloroplastic	2.57e-07	NA	5.18e-10	NA
7. B	B3EPG7	Elongation factor 4	3.68e-06	NA	1.18e-05	NA
7. B	B3ESU2	Elongation factor 4	8.46e-07	NA	4.42e-08	NA
7. B	A4G9U1	Elongation factor G	6.27e-05	NA	2.33e-06	NA
7. B	Q8RFD1	Elongation factor 4	3.36e-06	NA	3.44e-09	NA
7. B	Q47LJ1	Elongation factor Tu	4.49e-07	NA	4.93e-09	NA
7. B	Q57710	Probable translation initiation factor IF-2	1.32e-05	NA	5.74e-27	NA
7. B	Q978W8	Translation initiation factor 2 subunit gamma	5.36e-07	NA	0.024	NA
7. B	A6LC18	Elongation factor 4	1.04e-06	NA	3.06e-07	NA
7. B	Q6CRY5	Elongation factor G, mitochondrial	5.15e-05	NA	1.46e-09	NA
7. B	Q2FJ93	Elongation factor G	9.75e-06	NA	3.56e-08	NA
7. B	A8Z5T8	Elongation factor Tu	4.70e-07	NA	9.55e-14	NA
7. B	Q7MH43	Elongation factor Tu 1	4.33e-07	NA	1.13e-13	NA
7. B	B5XZJ3	Probable GTP-binding protein EngB	2.16e-05	NA	0.044	NA
7. B	Q662S4	Elongation factor 4	3.16e-06	NA	3.37e-09	NA
7. B	B2GHU9	Elongation factor 4	4.13e-06	NA	1.38e-07	NA
7. B	A1K7B9	Translation initiation factor IF-2	0.00e+00	NA	8.06e-162	NA
7. B	Q1QUF9	Sulfate adenylyltransferase subunit 1	1.16e-05	NA	5.07e-04	NA
7. B	A4I9M7	Translation factor GUF1 homolog, mitochondrial	5.30e-04	NA	0.002	NA
7. B	Q7VA20	Translation initiation factor IF-2	0.00e+00	NA	2.98e-156	NA
7. B	C3K2X9	Elongation factor G	3.54e-05	NA	2.58e-07	NA
7. B	B9K884	Elongation factor Tu	3.63e-07	NA	2.62e-12	NA
7. B	B7MCV5	Elongation factor G	2.06e-05	NA	1.30e-07	NA
7. B	Q2NQL6	Elongation factor G	2.52e-05	NA	1.46e-07	NA
7. B	B5F415	Sulfate adenylyltransferase subunit 1	9.49e-05	NA	4.09e-05	NA
7. B	Q74MI6	Elongation factor 1-alpha	3.57e-07	NA	1.24e-05	NA
7. B	P0CN33	Elongation factor G, mitochondrial	8.61e-04	NA	1.78e-07	NA
7. B	Q9HNK9	Translation initiation factor 2 subunit gamma	4.45e-06	NA	2.44e-09	NA
7. B	Q8ETY5	Elongation factor G	1.12e-05	NA	1.01e-09	NA
7. B	Q2FXY7	Elongation factor 4	2.20e-06	NA	2.11e-12	NA
7. B	P57608	Peptide chain release factor 3	1.22e-05	NA	3.43e-09	NA
7. B	Q43467	Elongation factor Tu, chloroplastic	7.96e-06	NA	1.24e-07	NA
7. B	Q5WZL4	Elongation factor Tu	4.50e-07	NA	1.88e-10	NA
7. B	P0A3C2	GTPase Era	1.27e-03	NA	4.76e-07	NA
7. B	Q63PZ6	Elongation factor Tu	4.58e-07	NA	3.06e-12	NA
7. B	Q81VT2	Elongation factor Tu	3.21e-07	NA	2.96e-14	NA
7. B	A3P0B5	Elongation factor Tu	4.77e-07	NA	3.06e-12	NA
7. B	Q31VV0	Elongation factor Tu	5.53e-07	NA	1.26e-13	NA
7. B	Q4WP57	Elongation factor G, mitochondrial	9.89e-04	NA	1.95e-06	NA
7. B	B7VKY2	Sulfate adenylyltransferase subunit 1	8.29e-06	NA	4.12e-06	NA
7. B	Q57LJ0	GTPase Der	6.70e-03	NA	0.017	NA
7. B	C7NYH7	Elongation factor 2	1.04e-04	NA	4.27e-09	NA
7. B	A8M531	Elongation factor Tu	5.49e-07	NA	2.01e-08	NA
7. B	Q03ZQ2	Elongation factor G	2.56e-05	NA	6.02e-09	NA
7. B	Q64NK6	Elongation factor G	4.64e-05	NA	1.38e-07	NA
7. B	C4ZB99	Elongation factor Tu	4.05e-07	NA	2.94e-15	NA
7. B	B9RUN8	Translation factor GUF1 homolog, mitochondrial	2.44e-06	NA	2.51e-11	NA
7. B	B3PME9	Elongation factor G	6.55e-05	NA	4.06e-10	NA
7. B	A5CSZ4	Translation initiation factor IF-2	0.00e+00	NA	4.54e-159	NA
7. B	Q13EL8	Translation initiation factor IF-2	0.00e+00	NA	1.78e-155	NA
7. B	Q2SSW8	Elongation factor Tu	5.17e-07	NA	1.44e-13	NA
7. B	Q726J1	Peptide chain release factor 3	6.61e-05	NA	1.05e-06	NA
7. B	P0A1H6	Elongation factor Tu	3.64e-07	NA	2.67e-13	NA
7. B	P0C950	Small COPII coat GTPase SAR1	3.63e-04	NA	4.37e-04	NA
7. B	Q5ZX60	Peptide chain release factor 3	3.34e-05	NA	7.15e-07	NA
7. B	Q8PUR7	Elongation factor 2	4.27e-05	NA	5.01e-06	NA
7. B	B0RB36	Elongation factor Tu	5.03e-07	NA	5.03e-06	NA
7. B	Q2EEV7	Elongation factor Tu, plastid	4.01e-06	NA	5.87e-10	NA
7. B	P64031	Elongation factor Tu	4.27e-07	NA	8.23e-11	NA
7. B	A6QFN0	Peptide chain release factor 3	2.02e-05	NA	2.29e-09	NA
7. B	Q086H2	Translation initiation factor IF-2	0.00e+00	NA	1.37e-164	NA
7. B	Q6FF40	Translation initiation factor IF-2	0.00e+00	NA	9.55e-160	NA
7. B	O93632	Elongation factor 2	3.84e-05	NA	2.73e-08	NA
7. B	A0Q6F0	Sulfate adenylyltransferase subunit 1	5.09e-05	NA	7.51e-04	NA
7. B	Q21RV5	Elongation factor G	5.06e-05	NA	1.65e-06	NA
7. B	Q2KXY7	Translation initiation factor IF-2	0.00e+00	NA	6.69e-153	NA
7. B	B1X3K4	Translation factor GUF1 homolog, organellar chromatophore	1.62e-06	NA	9.41e-11	NA
7. B	C3P9Q2	Elongation factor G	1.19e-05	NA	1.95e-09	NA
7. B	Q0SH84	Elongation factor 4	6.11e-06	NA	2.09e-10	NA
7. B	A1TLE7	Elongation factor 4	1.23e-06	NA	3.62e-08	NA
7. B	Q5GXU9	Translation initiation factor IF-2	0.00e+00	NA	9.26e-155	NA
7. B	B1YR40	GTPase Der	6.77e-03	NA	0.044	NA
7. B	A8GV17	Elongation factor G	5.23e-05	NA	6.54e-09	NA
7. B	B4HEQ8	Ribosome-releasing factor 2, mitochondrial	9.71e-04	NA	0.001	NA
7. B	B1ZLK1	Elongation factor G	9.86e-05	NA	9.83e-10	NA
7. B	A3DA74	Elongation factor Tu 1	5.10e-07	NA	4.74e-13	NA
7. B	A8MLC4	Elongation factor Tu	3.83e-07	NA	5.98e-13	NA
7. B	Q5FTY1	Elongation factor Tu	4.81e-07	NA	4.42e-12	NA
7. B	Q9CIK7	Peptide chain release factor 3	1.35e-05	NA	4.55e-08	NA
7. B	Q2NW23	Translation initiation factor IF-2	0.00e+00	NA	1.59e-151	NA
7. B	Q8K0D5	Elongation factor G, mitochondrial	2.15e-04	NA	2.05e-09	NA
7. B	B3ETZ7	Elongation factor Tu	3.86e-07	NA	1.96e-12	NA
7. B	P13537	Elongation factor Tu	5.43e-07	NA	1.98e-12	NA
7. B	A5DK38	Elongation factor G, mitochondrial	1.28e-04	NA	1.03e-09	NA
7. B	A0KP35	Sulfate adenylyltransferase subunit 1	4.22e-05	NA	2.47e-04	NA
7. B	Q66GG3	Probable GTP-binding protein EngB	2.28e-05	NA	0.006	NA
7. B	Q62KK9	Translation initiation factor IF-2	0.00e+00	NA	4.13e-169	NA
7. B	B5R9U3	Peptide chain release factor 3	3.24e-05	NA	1.30e-07	NA
7. B	Q82K53	Translation initiation factor IF-2	0.00e+00	NA	1.03e-158	NA
7. B	A9VP75	Elongation factor Tu	3.33e-07	NA	2.65e-14	NA
7. B	P60931	Elongation factor 4	9.90e-06	NA	7.60e-07	NA
7. B	Q605B0	Elongation factor Tu	4.75e-07	NA	2.56e-13	NA
7. B	Q8FS84	Elongation factor Tu	4.05e-07	NA	2.79e-06	NA
7. B	A8A317	GTPase Der	4.76e-03	NA	0.025	NA
7. B	B2UUW8	Elongation factor Tu	4.45e-07	NA	6.59e-12	NA
7. B	A5UFG5	Peptide chain release factor 3	9.60e-06	NA	8.53e-06	NA
7. B	Q5FKR8	Elongation factor Tu	3.78e-07	NA	1.60e-14	NA
7. B	Q31PV4	Elongation factor G	9.94e-05	NA	9.94e-10	NA
7. B	A6Q6H4	Elongation factor Tu	5.00e-07	NA	1.01e-09	NA
7. B	B8DTV6	Elongation factor G	3.69e-04	NA	6.95e-09	NA
7. B	O07309	Bifunctional enzyme NodQ	2.31e-03	NA	0.002	NA
7. B	Q12QI1	Translation initiation factor IF-2	0.00e+00	NA	4.94e-162	NA
7. B	A5CCL4	Elongation factor Tu 2	5.86e-07	NA	1.70e-15	NA
7. B	P17746	Elongation factor Tu, chloroplastic	3.97e-07	NA	2.65e-10	NA
7. B	C5BNW9	Peptide chain release factor 3	1.14e-05	NA	5.72e-07	NA
7. B	Q57LC8	Elongation factor 4	8.91e-07	NA	8.14e-09	NA
7. B	P50067	Elongation factor Tu (Fragment)	3.29e-07	NA	5.00e-05	NA
7. B	P57772	Selenocysteine-specific elongation factor	7.97e-05	NA	6.55e-04	NA
7. B	Q9Z802	Elongation factor G	3.75e-05	NA	7.95e-09	NA
7. B	A6T3K7	Elongation factor G	7.47e-05	NA	5.15e-06	NA
7. B	B0BQZ3	Elongation factor Tu	4.97e-07	NA	4.69e-13	NA
7. B	P40175	Elongation factor Tu-3	3.62e-07	NA	2.09e-10	NA
7. B	Q0I537	Elongation factor G	1.89e-05	NA	1.51e-07	NA
7. B	A4SCQ7	Elongation factor Tu	3.72e-07	NA	5.14e-16	NA
7. B	A9NDA0	Peptide chain release factor 3	1.49e-05	NA	4.88e-07	NA
7. B	B3RHG9	Translation factor GUF1, mitochondrial	1.21e-05	NA	3.90e-06	NA
7. B	A8GT71	Elongation factor Tu	4.40e-07	NA	2.74e-14	NA
7. B	A3DJ00	Elongation factor Tu	3.72e-07	NA	1.22e-13	NA
7. B	B5RPI0	Elongation factor Tu	7.21e-07	NA	1.06e-10	NA
7. B	Q606M6	Peptide chain release factor 3	4.71e-05	NA	1.87e-07	NA
7. B	Q28LR4	Elongation factor 4	1.19e-06	NA	1.42e-08	NA
7. B	B1AJG4	Elongation factor G	2.31e-05	NA	1.85e-10	NA
7. B	Q6NJD5	Elongation factor Tu	4.04e-07	NA	7.54e-07	NA
7. B	Q8U152	Elongation factor 1-alpha	2.58e-06	NA	1.17e-04	NA
7. B	Q0ABH8	Elongation factor G	6.45e-06	NA	2.18e-07	NA
7. B	Q2P4Q8	Peptide chain release factor 3	4.10e-05	NA	3.28e-05	NA
7. B	B6J5C9	Elongation factor G	2.57e-05	NA	3.70e-08	NA
7. B	Q83FP1	Elongation factor G	9.76e-06	NA	2.58e-08	NA
7. B	Q01W31	Translation initiation factor IF-2	0.00e+00	NA	3.09e-171	NA
7. B	P42482	Elongation factor Tu	4.31e-07	NA	1.65e-11	NA
7. B	A7I1F0	Elongation factor 4	1.93e-06	NA	4.93e-13	NA
7. B	A3QGU5	Translation initiation factor IF-2	0.00e+00	NA	7.15e-159	NA
7. B	Q042T5	Elongation factor Tu	4.09e-07	NA	1.22e-15	NA
7. B	Q0BRZ7	Elongation factor 4	2.44e-06	NA	1.48e-08	NA
7. B	B9DRL9	Elongation factor Tu	4.99e-07	NA	2.83e-12	NA
7. B	B3E156	Elongation factor Tu	4.27e-07	NA	5.13e-13	NA
7. B	Q0TCU1	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q8DC78	Elongation factor 4	9.38e-07	NA	1.57e-10	NA
7. B	B4SSW8	GTPase Der	2.78e-03	NA	0.013	NA
7. B	A0JMI9	Ribosome-releasing factor 2, mitochondrial	3.26e-04	NA	7.18e-07	NA
7. B	B9E055	GTPase Era	1.05e-03	NA	6.26e-04	NA
7. B	A8MG70	GTPase Era	2.01e-03	NA	0.001	NA
7. B	Q9Y9C1	Translation initiation factor 2 subunit gamma	3.16e-06	NA	3.63e-06	NA
7. B	A4YSJ0	Elongation factor Tu	4.47e-07	NA	9.87e-12	NA
7. B	A9M9Z4	Translation initiation factor IF-2	0.00e+00	NA	2.41e-159	NA
7. B	B7LHN3	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q2NZX1	Elongation factor Tu	4.49e-07	NA	8.07e-10	NA
7. B	A1S3X9	Elongation factor 4	2.46e-05	NA	3.07e-10	NA
7. B	G0S8G9	Eukaryotic translation initiation factor 5B	9.28e-07	NA	4.15e-22	NA
7. B	B0JU67	Translation initiation factor IF-2	0.00e+00	NA	9.83e-159	NA
7. B	A9N7C9	Peptide chain release factor 3	3.25e-05	NA	1.28e-07	NA
7. B	P50377	Elongation factor Tu, chloroplastic (Fragment)	2.10e-07	NA	3.99e-04	NA
7. B	C1AUN7	Elongation factor 4	4.81e-06	NA	1.98e-09	NA
7. B	B2RL52	Elongation factor Tu	3.84e-07	NA	1.84e-13	NA
7. B	B6H2S6	Translation factor guf1, mitochondrial	4.38e-05	NA	1.22e-06	NA
7. B	Q3B6G3	Elongation factor Tu	3.97e-07	NA	1.36e-15	NA
7. B	Q48SQ1	Peptide chain release factor 3	3.05e-05	NA	3.80e-08	NA
7. B	B9MB70	Elongation factor G	2.74e-05	NA	2.09e-06	NA
7. B	Q8KTA8	Elongation factor G	8.25e-05	NA	1.59e-08	NA
7. B	Q8KTB2	Elongation factor G	6.81e-05	NA	2.62e-08	NA
7. B	Q73F98	Elongation factor Tu	3.27e-07	NA	3.13e-14	NA
7. B	Q980A5	Translation initiation factor 2 subunit gamma	6.13e-06	NA	6.38e-07	NA
7. B	P0A7I6	Peptide chain release factor 3	9.79e-06	NA	1.26e-07	NA
7. B	B6YVG2	Elongation factor 1-alpha	3.02e-06	NA	4.03e-08	NA
7. B	Q01698	Elongation factor Tu	5.20e-07	NA	9.34e-13	NA
7. B	B2GKR5	Translation initiation factor IF-2	0.00e+00	NA	8.58e-169	NA
7. B	A2C6Q5	Translation initiation factor IF-2	0.00e+00	NA	2.41e-152	NA
7. B	A4FWF0	Elongation factor 2	4.64e-05	NA	4.49e-10	NA
7. B	Q6A6L7	Elongation factor Tu	4.36e-07	NA	5.02e-09	NA
7. B	C6DJU6	Peptide chain release factor 3	1.21e-05	NA	7.50e-07	NA
7. B	Q1MPT8	Elongation factor Tu	4.31e-07	NA	8.56e-13	NA
7. B	A1UER8	Translation initiation factor IF-2	0.00e+00	NA	2.11e-149	NA
7. B	P52854	Elongation factor Tu	9.50e-07	NA	6.68e-13	NA
7. B	A1T7H8	Translation initiation factor IF-2	0.00e+00	NA	2.82e-154	NA
7. B	A5G4G3	Elongation factor 4	1.91e-06	NA	3.92e-10	NA
7. B	C5DWG7	Translation factor GUF1, mitochondrial	1.24e-04	NA	3.10e-05	NA
7. B	Q9HGI8	Eukaryotic peptide chain release factor GTP-binding subunit	5.06e-05	NA	0.022	NA
7. B	Q31VU9	Elongation factor G	2.12e-05	NA	1.30e-07	NA
7. B	Q56121	Peptide chain release factor 3	1.07e-05	NA	1.28e-07	NA
7. B	B0XZZ2	Translation factor guf1, mitochondrial	7.61e-05	NA	1.13e-06	NA
7. B	B1XAY6	GTPase Der	4.68e-03	NA	0.025	NA
7. B	Q7UZZ9	Translation initiation factor IF-2	0.00e+00	NA	1.21e-154	NA
7. B	A0B7D6	Elongation factor 1-alpha	1.61e-06	NA	0.004	NA
7. B	C4ZSQ9	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q11QB0	Elongation factor G	1.03e-04	NA	7.55e-07	NA
7. B	Q49WE9	Peptide chain release factor 3	1.80e-05	NA	1.05e-09	NA
7. B	B7GYM8	Elongation factor G	5.17e-05	NA	4.31e-07	NA
7. B	Q1JN21	GTPase Era	9.05e-04	NA	6.99e-04	NA
7. B	B7UK50	Elongation factor G	2.37e-05	NA	1.30e-07	NA
7. B	Q8DE73	Sulfate adenylyltransferase subunit 1	5.09e-05	NA	3.97e-05	NA
7. B	P46943	Translation factor GUF1, mitochondrial	1.31e-05	NA	1.61e-06	NA
7. B	A5CR97	Elongation factor 4	3.73e-06	NA	1.16e-09	NA
7. B	A0Q1Q0	GTPase Era	3.27e-03	NA	0.048	NA
7. B	B0R8C8	Elongation factor 2	9.58e-05	NA	9.36e-09	NA
7. B	Q3MDM5	Elongation factor Tu	4.07e-07	NA	2.53e-10	NA
7. B	A3PY75	Translation initiation factor IF-2	0.00e+00	NA	2.11e-149	NA
7. B	A7ZSL5	Elongation factor G	2.25e-05	NA	1.30e-07	NA
7. B	Q66EC7	Sulfate adenylyltransferase subunit 1	1.46e-04	NA	4.16e-05	NA
7. B	A7MUW8	Peptide chain release factor 3	3.41e-05	NA	1.29e-06	NA
7. B	A9R400	Elongation factor 4	6.44e-07	NA	2.16e-10	NA
7. B	Q2YX08	Peptide chain release factor 3	2.14e-05	NA	2.20e-09	NA
7. B	O51741	Translation initiation factor IF-2	0.00e+00	NA	2.03e-146	NA
7. B	P17745	Elongation factor Tu, chloroplastic	6.40e-06	NA	7.33e-11	NA
7. B	Q118Z2	Elongation factor Tu	4.06e-07	NA	2.15e-09	NA
7. B	Q0ID58	Elongation factor G	1.11e-04	NA	1.42e-10	NA
7. B	A5CXN7	Elongation factor G	2.44e-05	NA	9.49e-09	NA
7. B	Q7NQF0	Elongation factor G	2.54e-05	NA	9.68e-07	NA
7. B	P84172	Elongation factor Tu, mitochondrial (Fragment)	5.52e-08	NA	1.56e-06	NA
7. B	B0RB35	Elongation factor G	4.20e-05	NA	4.61e-09	NA
7. B	Q25820	Elongation factor Tu, apicoplast	5.02e-06	NA	2.60e-07	NA
7. B	B3H163	Translation initiation factor IF-2	0.00e+00	NA	3.51e-156	NA
7. B	Q31LL9	Translation initiation factor IF-2	0.00e+00	NA	4.81e-161	NA
7. B	C1F645	Elongation factor G	5.58e-06	NA	6.29e-09	NA
7. B	Q6KHS5	Elongation factor G	1.17e-05	NA	1.54e-09	NA
7. B	Q71WB8	Elongation factor G	2.42e-05	NA	3.89e-09	NA
7. B	Q21BS0	Elongation factor 4	2.28e-06	NA	1.25e-06	NA
7. B	B9E1C8	GTPase Der	3.25e-03	NA	0.015	NA
7. B	A7ZCN0	Elongation factor Tu	4.61e-07	NA	1.58e-10	NA
7. B	B0W010	Ribosome-releasing factor 2, mitochondrial	1.27e-04	NA	1.13e-05	NA
7. B	B1MD87	Translation initiation factor IF-2	0.00e+00	NA	1.78e-158	NA
7. B	Q6ACY9	Elongation factor G	1.89e-05	NA	3.40e-09	NA
7. B	A8FYR3	Peptide chain release factor 3	1.07e-05	NA	1.13e-05	NA
7. B	Q818E4	Elongation factor 4	5.78e-06	NA	4.46e-12	NA
7. B	A3Q968	Elongation factor Tu 1	5.13e-07	NA	6.74e-14	NA
7. B	P72483	Elongation factor Tu	4.40e-07	NA	3.24e-13	NA
7. B	B7MKM5	Sulfate adenylyltransferase subunit 1	5.82e-06	NA	4.38e-04	NA
7. B	Q9RDC9	Elongation factor 4	4.99e-06	NA	1.34e-07	NA
7. B	Q13E78	Elongation factor 4	2.37e-06	NA	1.03e-07	NA
7. B	A3DMQ1	Elongation factor 1-alpha	9.39e-07	NA	4.20e-05	NA
7. B	P09953	Elongation factor Tu	4.36e-07	NA	3.13e-06	NA
7. B	A8MAJ1	Elongation factor 1-alpha	7.08e-07	NA	0.005	NA
7. B	P9WK96	Elongation factor 4	1.19e-05	NA	2.09e-08	NA
7. B	A1WVC4	Elongation factor Tu 1	5.49e-07	NA	1.58e-12	NA
7. B	A0Q892	Peptide chain release factor 3	2.73e-05	NA	9.06e-08	NA
7. B	Q8XJK1	GTPase Der	1.45e-03	NA	1.89e-04	NA
7. B	C6DBH0	GTPase Der	3.33e-03	NA	0.033	NA
7. B	B5ZC31	Elongation factor Tu	3.72e-07	NA	4.95e-16	NA
7. B	P0CD71	Elongation factor Tu	5.18e-07	NA	2.12e-11	NA
7. B	P0A3B0	Elongation factor Tu	4.76e-07	NA	2.62e-14	NA
7. B	B8CXI2	GTPase Era	2.75e-03	NA	3.92e-04	NA
7. B	Q82DQ1	Elongation factor G	1.44e-04	NA	9.87e-08	NA
7. B	A0AIR3	GTPase Era	1.23e-03	NA	0.050	NA
7. B	Q7NVF7	Peptide chain release factor 3	4.61e-05	NA	2.37e-06	NA
7. B	B3CPV1	Elongation factor 4	9.35e-07	NA	8.26e-08	NA
7. B	Q7N8L0	Sulfate adenylyltransferase subunit 1	2.90e-05	NA	2.93e-04	NA
7. B	C0ZIH6	Elongation factor Tu	4.26e-07	NA	8.53e-11	NA
7. B	B2V3Z1	GTPase Der	9.31e-04	NA	3.82e-04	NA
7. B	B1JIV5	Elongation factor G	3.08e-05	NA	8.38e-07	NA
7. B	Q73VV4	Translation initiation factor IF-2	0.00e+00	NA	7.68e-159	NA
7. B	Q3SSW9	Elongation factor G	4.95e-05	NA	3.07e-09	NA
7. B	A8ALY7	Peptide chain release factor 3	1.13e-05	NA	1.25e-07	NA
7. B	A0AK49	GTPase Der	8.65e-04	NA	0.015	NA
7. B	A1VNU2	Translation initiation factor IF-2	0.00e+00	NA	9.83e-166	NA
7. B	B7H1K5	Elongation factor Tu	4.66e-07	NA	7.01e-11	NA
7. B	P33170	Elongation factor Tu	4.30e-07	NA	2.09e-12	NA
7. B	B7MYE6	GTPase Der	3.93e-03	NA	0.019	NA
7. B	P0DA82	Elongation factor Tu	3.94e-07	NA	1.81e-12	NA
7. B	Q9CEI0	Elongation factor Tu	3.89e-07	NA	1.57e-10	NA
7. B	A9H3R7	Elongation factor Tu	5.02e-07	NA	1.11e-11	NA
7. B	Q08BB1	Elongation factor G, mitochondrial	1.29e-04	NA	2.07e-11	NA
7. B	Q21RV6	Elongation factor Tu 2	4.40e-07	NA	5.50e-14	NA
7. B	A7FMI1	Peptide chain release factor 3	1.05e-05	NA	7.50e-07	NA
7. B	Q46Z15	Elongation factor 4	1.10e-06	NA	2.11e-06	NA
7. B	C0MF25	Elongation factor G	1.90e-05	NA	1.43e-08	NA
7. B	B5QZV8	Translation initiation factor IF-2	0.00e+00	NA	3.44e-152	NA
7. B	Q2RKX8	Elongation factor 4	2.85e-06	NA	2.17e-09	NA
7. B	Q6FZL2	Elongation factor Tu 2	4.24e-07	NA	1.15e-11	NA
7. B	Q1C156	Peptide chain release factor 3	2.21e-05	NA	7.37e-07	NA
7. B	A1W2Q5	Elongation factor Tu 1	3.67e-07	NA	5.83e-12	NA
7. B	C0Q7L6	Peptide chain release factor 3	1.05e-05	NA	1.28e-07	NA
7. B	Q18KI6	Translation initiation factor 2 subunit gamma	8.45e-07	NA	3.44e-06	NA
7. B	Q8A463	Elongation factor Tu	4.63e-06	NA	4.03e-13	NA
7. B	C3P9Q3	Elongation factor Tu	3.33e-07	NA	2.96e-14	NA
7. B	B7K414	GTPase Era	4.93e-03	NA	0.045	NA
7. B	A1KGG5	Elongation factor Tu	4.94e-07	NA	2.16e-09	NA
7. B	Q47UW3	Elongation factor G 2	2.79e-05	NA	3.70e-09	NA
7. B	Q927I5	Elongation factor G	2.41e-05	NA	3.79e-09	NA
7. B	Q74IG8	Peptide chain release factor 3	2.96e-05	NA	1.91e-08	NA
7. B	Q049W8	Elongation factor 4	8.66e-06	NA	5.82e-11	NA
7. B	A1KSN4	Peptide chain release factor 3	2.83e-05	NA	3.08e-06	NA
7. B	O51881	GTPase Der	1.20e-03	NA	8.76e-06	NA
7. B	B2J0M4	Elongation factor 4	1.68e-06	NA	8.35e-11	NA
7. B	Q031W8	GTPase Era	1.35e-03	NA	4.55e-07	NA
7. B	A7HZ93	Translation initiation factor IF-2	0.00e+00	NA	3.81e-156	NA
7. B	B2IIJ7	Translation initiation factor IF-2	0.00e+00	NA	6.65e-162	NA
7. B	Q47JA6	Elongation factor G	4.88e-05	NA	8.87e-07	NA
7. B	Q2FJ92	Elongation factor Tu	3.65e-07	NA	3.46e-12	NA
7. B	Q17XF9	GTPase Era	2.17e-03	NA	0.002	NA
7. B	Q600B6	Elongation factor Tu	4.45e-07	NA	1.99e-10	NA
7. B	Q97EH5	Elongation factor Tu	3.69e-07	NA	2.41e-09	NA
7. B	Q8DYI1	GTPase Era	1.39e-03	NA	6.90e-04	NA
7. B	B0SAF6	Elongation factor Tu	4.44e-07	NA	9.00e-15	NA
7. B	A6UZH4	Elongation factor Tu	4.78e-07	NA	7.48e-10	NA
7. B	Q03SA1	GTPase Der	8.18e-04	NA	0.012	NA
7. B	Q32BG5	Translation initiation factor IF-2	0.00e+00	NA	2.74e-153	NA
7. B	B1IIN2	GTPase Der	1.27e-03	NA	4.51e-05	NA
7. B	A6LEJ3	Elongation factor G	1.05e-05	NA	1.28e-06	NA
7. B	A0LIH6	Elongation factor Tu	4.82e-07	NA	7.09e-13	NA
7. B	A7MXE4	Elongation factor Tu	4.32e-07	NA	5.47e-13	NA
7. B	A6TEX7	Elongation factor Tu	4.70e-07	NA	2.42e-13	NA
7. B	Q46PQ4	Elongation factor G 2	3.04e-05	NA	6.28e-09	NA
7. B	A4W691	Peptide chain release factor 3	9.82e-06	NA	4.07e-08	NA
7. B	B7JYV9	Peptide chain release factor 3	5.96e-05	NA	9.18e-10	NA
7. B	A1A0T1	Elongation factor Tu	3.52e-07	NA	6.89e-09	NA
7. B	B7HJ45	Elongation factor G	1.06e-05	NA	1.86e-09	NA
7. B	F4JWP9	109 kDa U5 small nuclear ribonucleoprotein component GFL	8.38e-03	NA	3.64e-06	NA
7. B	Q7V500	Elongation factor Tu	3.39e-07	NA	3.79e-08	NA
7. B	B8BYH3	Translation factor GUF1 homolog, mitochondrial	2.45e-05	NA	9.20e-10	NA
7. B	Q82DQ0	Elongation factor Tu 1	5.29e-07	NA	2.38e-10	NA
7. B	Q3SYU2	Elongation factor 2	5.38e-03	NA	6.41e-05	NA
7. B	P42480	Elongation factor Tu	4.16e-07	NA	3.02e-13	NA
7. B	B3QR64	Elongation factor G	2.94e-05	NA	5.48e-08	NA
7. B	Q04MH7	Elongation factor G	6.29e-05	NA	2.02e-09	NA
7. B	Q5ZUD2	Elongation factor 4	3.07e-06	NA	3.15e-08	NA
7. B	P9WNN0	Elongation factor Tu	4.41e-07	NA	2.16e-09	NA
7. B	Q6D280	GTPase Der	4.87e-03	NA	0.032	NA
7. B	A9N941	GTPase Era	1.24e-03	NA	0.040	NA
7. B	Q73AZ1	GTPase Der	9.20e-04	NA	0.016	NA
7. B	Q9ZEU3	Elongation factor Tu	2.96e-07	NA	2.36e-09	NA
7. B	B4KKD5	Elongation factor G, mitochondrial	9.82e-04	NA	1.59e-10	NA
7. B	B2J5B0	Elongation factor G	9.58e-05	NA	2.35e-08	NA
7. B	A8A4Y4	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q1KVS9	Elongation factor Tu, chloroplastic	4.02e-07	NA	8.31e-12	NA
7. B	Q05D44	Eukaryotic translation initiation factor 5B	2.11e-08	NA	6.50e-22	NA
7. B	A0AIS8	Elongation factor 4	6.61e-06	NA	6.70e-11	NA
7. B	B3WEQ5	Elongation factor 4	5.21e-06	NA	2.73e-09	NA
7. B	B1AJG3	Elongation factor Tu	3.02e-07	NA	2.97e-15	NA
7. B	P30768	Elongation factor Tu	5.01e-07	NA	1.29e-09	NA
7. B	Q4JT41	Elongation factor Tu	3.85e-07	NA	1.50e-06	NA
7. B	Q1R0H8	Elongation factor G	1.67e-05	NA	5.83e-09	NA
7. B	Q87DG7	Bifunctional enzyme CysN/CysC	4.41e-04	NA	0.002	NA
7. B	Q4G342	Elongation factor Tu, chloroplastic	3.12e-07	NA	5.26e-14	NA
7. B	A0LRL8	Elongation factor Tu	4.23e-07	NA	3.14e-09	NA
7. B	Q12AU7	Translation initiation factor IF-2	0.00e+00	NA	1.92e-155	NA
7. B	Q5HVX6	Elongation factor G	2.71e-05	NA	1.66e-07	NA
7. B	B8J444	Elongation factor 4	2.52e-06	NA	8.32e-07	NA
7. B	B2VH43	Peptide chain release factor 3	1.29e-05	NA	6.76e-07	NA
7. B	Q7MTL1	Elongation factor G	6.85e-05	NA	3.69e-08	NA
7. B	A4W2H9	GTPase Era	2.28e-03	NA	4.75e-04	NA
7. B	A4FPM7	Elongation factor Tu	5.15e-07	NA	3.43e-09	NA
7. B	Q46J13	Translation initiation factor IF-2	0.00e+00	NA	3.95e-153	NA
7. B	Q211E6	Elongation factor Tu	4.32e-07	NA	9.06e-13	NA
7. B	Q727D5	Elongation factor Tu	4.43e-07	NA	1.03e-11	NA
7. B	A2RM49	GTPase Der	1.39e-03	NA	0.027	NA
7. B	Q81ZS3	Elongation factor Tu	5.02e-07	NA	2.50e-08	NA
7. B	B4F2B9	Translation initiation factor IF-2	0.00e+00	NA	1.59e-151	NA
7. B	C3L0M1	GTPase Der	1.26e-03	NA	1.84e-04	NA
7. B	P50064	Elongation factor Tu	3.79e-07	NA	6.13e-10	NA
7. B	A5CUB7	Elongation factor G	5.84e-05	NA	4.42e-09	NA
7. B	B6JN44	Elongation factor Tu	4.30e-07	NA	9.85e-12	NA
7. B	B7GRY7	Elongation factor 4	4.58e-06	NA	2.31e-09	NA
7. B	P74227	Elongation factor Tu	2.80e-07	NA	1.92e-11	NA
7. B	A8ABM5	Elongation factor 1-alpha	7.68e-07	NA	0.001	NA
7. B	Q24SR6	Elongation factor 4	1.04e-06	NA	6.47e-11	NA
7. B	Q8KTC1	Elongation factor G	7.05e-05	NA	1.59e-08	NA
7. B	A1ST34	Peptide chain release factor 3	2.59e-05	NA	3.09e-07	NA
7. B	Q464Z4	Elongation factor 1-alpha	1.52e-06	NA	1.29e-04	NA
7. B	Q87WH1	Peptide chain release factor 3	3.42e-05	NA	1.35e-07	NA
7. B	A5U598	Elongation factor 4	2.70e-05	NA	2.09e-08	NA
7. B	A9AH00	GTPase Der	3.40e-03	NA	0.031	NA
7. B	A8EW86	Elongation factor G	7.50e-05	NA	9.49e-08	NA
7. B	Q24VA2	GTPase Der	2.45e-03	NA	0.008	NA
7. B	P64022	Elongation factor G	6.14e-05	NA	2.02e-09	NA
7. B	Q8U1R8	Probable translation initiation factor IF-2	5.93e-05	NA	1.53e-29	NA
7. B	P23845	Sulfate adenylyltransferase subunit 1	5.71e-06	NA	4.12e-04	NA
7. B	Q9HM85	Elongation factor 2	1.04e-04	NA	9.36e-09	NA
7. B	C5BWS3	Translation initiation factor IF-2	0.00e+00	NA	1.03e-155	NA
7. B	Q72PQ1	GTPase Der	6.69e-03	NA	0.008	NA
7. B	Q0TEA7	Sulfate adenylyltransferase subunit 1	5.69e-06	NA	4.12e-04	NA
7. B	C4ZD63	GTPase Der	9.43e-04	NA	0.020	NA
7. B	B0CH34	Elongation factor Tu	4.19e-07	NA	3.87e-11	NA
7. B	Q7W9A5	Translation initiation factor IF-2	0.00e+00	NA	1.38e-154	NA
7. B	B8G1W4	Elongation factor Tu	4.83e-07	NA	3.67e-14	NA
7. B	C4K1P6	Elongation factor G	7.45e-05	NA	1.69e-08	NA
7. B	B0BBV3	Elongation factor Tu	5.47e-07	NA	2.07e-11	NA
7. B	Q1JL31	Peptide chain release factor 3	2.01e-05	NA	3.64e-08	NA
7. B	Q83DC7	Peptide chain release factor 3	1.46e-05	NA	4.88e-07	NA
7. B	Q8DXS7	Elongation factor G	2.39e-05	NA	6.74e-09	NA
7. B	Q8R2Q4	Ribosome-releasing factor 2, mitochondrial	3.54e-04	NA	2.03e-06	NA
7. B	A7MGU7	GTPase Der	5.32e-03	NA	0.003	NA
7. B	Q6LLV5	Elongation factor Tu 2	4.68e-07	NA	9.45e-13	NA
7. B	B2UQY9	Elongation factor Tu	3.70e-07	NA	1.86e-15	NA
7. B	Q66EW6	Peptide chain release factor 3	1.13e-05	NA	7.50e-07	NA
7. B	A9WSW5	Elongation factor Tu	5.37e-07	NA	2.16e-06	NA
7. B	P05197	Elongation factor 2	7.48e-03	NA	6.58e-05	NA
7. B	Q039G4	GTPase Der	1.50e-03	NA	0.016	NA
7. B	Q7N9E9	Probable GTP-binding protein EngB	3.30e-05	NA	0.045	NA
7. B	Q13UU8	Elongation factor G 1	2.14e-05	NA	2.62e-07	NA
7. B	Q0S219	Translation initiation factor IF-2	0.00e+00	NA	2.75e-151	NA
7. B	P90519	Elongation factor 1-alpha	9.54e-07	NA	0.027	NA
7. B	C0MCD8	GTPase Era	9.80e-04	NA	0.001	NA
7. B	Q87M02	Translation initiation factor IF-2	0.00e+00	NA	2.42e-153	NA
7. B	Q9P9Q9	Elongation factor Tu	3.56e-07	NA	2.68e-11	NA
7. B	A8LC58	Elongation factor Tu	4.28e-07	NA	5.53e-09	NA
7. B	B9L7I8	Elongation factor Tu	4.40e-07	NA	4.55e-13	NA
7. B	Q3AW53	Elongation factor Tu	3.42e-07	NA	5.63e-09	NA
7. B	O28385	Elongation factor 2	5.60e-05	NA	4.04e-11	NA
7. B	Q8DY73	GTPase Der	1.57e-03	NA	7.17e-05	NA
7. B	Q7WRC7	Elongation factor G 1	6.03e-05	NA	7.75e-07	NA
7. B	P9WNM4	Bifunctional enzyme CysN/CysC	2.29e-04	NA	0.028	NA
7. B	Q5HQE4	Peptide chain release factor 3	1.81e-05	NA	2.66e-09	NA
7. B	Q8ZJB3	Elongation factor G	2.05e-05	NA	8.38e-07	NA
7. B	C4K2I2	Elongation factor Tu	4.53e-07	NA	2.74e-14	NA
7. B	C4K4F8	Elongation factor Tu	5.08e-07	NA	1.38e-13	NA
7. B	Q13VM6	Elongation factor 4	1.01e-06	NA	6.65e-09	NA
7. B	Q9XCI8	GTPase Der	4.13e-03	NA	0.018	NA
7. B	B2KA49	Elongation factor 4	1.09e-06	NA	2.16e-10	NA
7. B	C5BHI4	Peptide chain release factor 3	1.19e-05	NA	1.31e-07	NA
7. B	Q6CK29	Ribosome-releasing factor 2, mitochondrial	8.49e-04	NA	8.04e-07	NA
7. B	P0A6M9	Elongation factor G	2.35e-05	NA	1.30e-07	NA
7. B	Q7MI34	Peptide chain release factor 3	1.10e-05	NA	2.44e-06	NA
7. B	Q2VIR3	Eukaryotic translation initiation factor 2 subunit 3B	1.91e-06	NA	0.022	NA
7. B	Q3ZXK4	Elongation factor 4	8.25e-07	NA	8.66e-11	NA
7. B	B5E756	GTPase Der	2.43e-03	NA	6.10e-06	NA
7. B	B3RXR7	Translation factor GUF1 homolog, mitochondrial	9.14e-05	NA	3.69e-10	NA
7. B	O69303	Elongation factor Tu	4.81e-07	NA	3.25e-11	NA
7. B	Q6GJC0	Elongation factor Tu	4.13e-07	NA	3.46e-12	NA
7. B	B0BNR5	Translation initiation factor IF-2	0.00e+00	NA	2.68e-156	NA
7. B	B2GBC2	Elongation factor Tu	3.80e-07	NA	1.70e-12	NA
7. B	Q3A9R3	Elongation factor Tu 1	4.76e-07	NA	4.42e-11	NA
7. B	B2G8Y0	Elongation factor G	2.52e-05	NA	2.22e-09	NA
7. B	Q97ID7	GTPase Der	1.39e-03	NA	2.04e-04	NA
7. B	Q5PLB0	Translation initiation factor IF-2	0.00e+00	NA	4.30e-152	NA
7. B	B0RDY9	Translation initiation factor IF-2	0.00e+00	NA	6.54e-159	NA
7. B	C5D3R5	Elongation factor Tu	4.21e-07	NA	5.29e-15	NA
7. B	Q9MUP0	Elongation factor Tu, chloroplastic	3.72e-07	NA	2.74e-11	NA
7. B	A2C4U6	Elongation factor G	1.21e-04	NA	1.28e-10	NA
7. B	Q0BYB1	Elongation factor G	1.67e-04	NA	1.95e-07	NA
7. B	B8D8C1	GTPase Der	1.93e-03	NA	2.46e-04	NA
7. B	Q5HIC7	Elongation factor Tu	3.81e-07	NA	3.46e-12	NA
7. B	B1XTL2	Elongation factor 4	8.69e-07	NA	5.53e-09	NA
7. B	A3PEY3	Translation initiation factor IF-2	0.00e+00	NA	9.37e-155	NA
7. B	P0C0C0	GTPase Era (Fragment)	2.94e-06	NA	5.53e-04	NA
7. B	Q2YB00	Elongation factor G	5.84e-05	NA	6.36e-09	NA
7. B	Q32B27	Elongation factor Tu	5.53e-07	NA	1.26e-13	NA
7. B	Q0VRV7	Peptide chain release factor 3	3.08e-05	NA	5.12e-05	NA
7. B	B5R578	GTPase Der	4.85e-03	NA	0.019	NA
7. B	Q83ES6	Elongation factor Tu	3.41e-07	NA	3.25e-13	NA
7. B	A9A9U4	Elongation factor 2	4.41e-05	NA	5.11e-10	NA
7. B	C5BC84	Probable GTP-binding protein EngB	3.11e-05	NA	0.001	NA
7. B	Q1J8I4	Elongation factor G	2.31e-05	NA	1.50e-08	NA
7. B	C3MAX7	Elongation factor G	4.29e-05	NA	4.51e-10	NA
7. B	B1JBG6	Peptide chain release factor 3	2.91e-05	NA	3.94e-07	NA
7. B	B3PMU1	Elongation factor Tu	3.73e-07	NA	5.28e-15	NA
7. B	Q1JI67	GTPase Era	9.95e-04	NA	6.93e-04	NA
7. B	Q6LXI2	Elongation factor 2	9.65e-05	NA	1.31e-09	NA
7. B	Q1BA94	Translation initiation factor IF-2	0.00e+00	NA	2.11e-149	NA
7. B	Q0RRS3	Elongation factor Tu	4.52e-07	NA	3.40e-09	NA
7. B	Q2YQR7	Translation initiation factor IF-2	0.00e+00	NA	8.89e-160	NA
7. B	Q9USZ1	Elongation factor G, mitochondrial	8.23e-05	NA	1.21e-07	NA
7. B	Q8EX18	Elongation factor Tu	3.21e-07	NA	1.15e-13	NA
7. B	Q8F500	Elongation factor 4	4.18e-06	NA	1.23e-07	NA
7. B	A8P1W0	Elongation factor G, mitochondrial	2.47e-04	NA	1.42e-09	NA
7. B	O83748	Elongation factor G 1	1.09e-04	NA	1.61e-07	NA
7. B	Q3Z983	Elongation factor G	8.67e-05	NA	1.48e-06	NA
7. B	P50066	Elongation factor Tu (Fragment)	1.08e-06	NA	0.010	NA
7. B	Q8KT97	Elongation factor Tu	4.54e-07	NA	8.67e-14	NA
7. B	B2HSL3	Elongation factor Tu	4.22e-07	NA	2.81e-09	NA
7. B	P46211	Elongation factor G	5.71e-06	NA	1.41e-08	NA
7. B	Q4A8T9	Elongation factor 4	4.14e-06	NA	2.37e-11	NA
7. B	Q9JYD2	Translation initiation factor IF-2	0.00e+00	NA	1.10e-153	NA
7. B	Q48DZ2	Peptide chain release factor 3	3.55e-05	NA	1.93e-07	NA
7. B	B9DKV8	Elongation factor Tu	4.16e-07	NA	2.39e-12	NA
7. B	Q8M9W7	Elongation factor Tu, chloroplastic	2.61e-07	NA	4.74e-08	NA
7. B	B4TGZ2	Peptide chain release factor 3	1.13e-05	NA	1.28e-07	NA
7. B	A5IHR6	Elongation factor Tu	4.36e-07	NA	2.68e-10	NA
7. B	Q8E645	Elongation factor Tu	4.38e-07	NA	4.01e-12	NA
7. B	B8I442	GTPase Der	2.07e-03	NA	9.27e-06	NA
7. B	A1TYJ4	Elongation factor G	2.16e-05	NA	9.40e-08	NA
7. B	A5N6N6	GTPase Era	1.14e-03	NA	6.26e-04	NA
7. B	A6KYK9	Elongation factor Tu	3.78e-07	NA	6.53e-12	NA
7. B	A8G6Z5	Translation initiation factor IF-2	0.00e+00	NA	1.01e-154	NA
7. B	C1CIU0	Peptide chain release factor 3	6.55e-05	NA	2.71e-07	NA
7. B	B8HUA9	Translation initiation factor IF-2	0.00e+00	NA	3.68e-169	NA
7. B	Q8NP40	Translation initiation factor IF-2	0.00e+00	NA	1.21e-155	NA
7. B	Q38WW3	GTPase Der	7.28e-04	NA	8.39e-05	NA
7. B	Q87EV4	Translation initiation factor IF-2	0.00e+00	NA	1.18e-150	NA
7. B	A0KQ96	Elongation factor G	2.44e-05	NA	5.13e-07	NA
7. B	Q7VNA2	Elongation factor G	2.08e-05	NA	9.90e-08	NA
7. B	B2VK36	Elongation factor G	2.61e-05	NA	1.25e-06	NA
7. B	A7FNJ0	Elongation factor Tu 1	4.23e-07	NA	1.96e-13	NA
7. B	P37214	GTPase Era	2.30e-03	NA	2.69e-04	NA
7. B	Q1AVV0	Elongation factor 4	4.99e-06	NA	1.75e-06	NA
7. B	A7I656	Elongation factor 1-alpha	5.10e-07	NA	2.40e-06	NA
7. B	Q7U4D2	Elongation factor G	8.10e-05	NA	5.85e-10	NA
7. B	Q8KTB9	Elongation factor G	4.98e-05	NA	1.40e-08	NA
7. B	B7HQU2	Elongation factor Tu	3.35e-07	NA	3.13e-14	NA
7. B	B2IA64	Elongation factor G	5.26e-05	NA	7.80e-08	NA
7. B	Q3A6P9	Elongation factor Tu 2	5.81e-07	NA	6.28e-13	NA
7. B	A4VI89	Peptide chain release factor 3	3.30e-05	NA	3.01e-07	NA
7. B	A4JAM5	Elongation factor Tu	4.93e-07	NA	1.15e-11	NA
7. B	P51287	Elongation factor Tu, chloroplastic	2.73e-07	NA	6.75e-12	NA
7. B	C1CEG3	Elongation factor 4	5.73e-06	NA	1.98e-10	NA
7. B	Q0C1F4	Elongation factor Tu 1	5.36e-07	NA	1.33e-07	NA
7. B	A7GK18	Elongation factor Tu	3.07e-07	NA	7.64e-16	NA
7. B	B5E653	Elongation factor Tu	4.70e-07	NA	8.23e-11	NA
7. B	Q7UMW2	Bifunctional enzyme CysN/CysC	1.58e-04	NA	9.27e-05	NA
7. B	B5RM34	Elongation factor Tu	4.42e-07	NA	1.06e-10	NA
7. B	C4ZX86	GTPase Der	3.25e-03	NA	0.025	NA
7. B	C6A4M0	Elongation factor 2	6.27e-05	NA	5.74e-09	NA
7. B	B8GJK8	Elongation factor 2	3.41e-05	NA	1.72e-06	NA
7. B	Q5ZYP5	Elongation factor Tu	4.33e-07	NA	2.68e-10	NA
7. B	O27131	Elongation factor 2	1.06e-04	NA	7.10e-11	NA
7. B	A4YCR6	Elongation factor 1-alpha	8.23e-07	NA	0.045	NA
7. B	C3NHB6	Elongation factor 2	1.07e-03	NA	2.49e-08	NA
7. B	Q3KI56	Peptide chain release factor 3	3.08e-05	NA	3.17e-07	NA
7. B	Q2NVM8	Sulfate adenylyltransferase subunit 1	1.39e-04	NA	1.96e-04	NA
7. B	A7GGA7	GTPase Der	1.21e-03	NA	4.17e-05	NA
7. B	Q6YQV8	Elongation factor Tu	4.61e-07	NA	5.77e-13	NA
7. B	P13060	Eukaryotic translation elongation factor 2	5.21e-03	NA	1.49e-05	NA
7. B	B5EE25	GTPase Der	4.20e-03	NA	0.002	NA
7. B	A6UV43	Elongation factor 1-alpha	7.46e-07	NA	0.007	NA
7. B	O50306	Elongation factor Tu	4.14e-07	NA	3.13e-14	NA
7. B	B4T0P5	GTPase Der	4.73e-03	NA	0.018	NA
7. B	A6TZ24	Elongation factor G	1.15e-05	NA	3.56e-08	NA
7. B	P0A7I5	Peptide chain release factor 3	1.07e-05	NA	1.26e-07	NA
7. B	Q3SLQ2	Elongation factor G	2.39e-05	NA	4.27e-07	NA
7. B	A8G907	Translation initiation factor IF-2	0.00e+00	NA	4.13e-158	NA
7. B	Q2NQL7	Elongation factor Tu	5.34e-07	NA	1.37e-13	NA
7. B	Q73SD1	Elongation factor Tu	5.33e-07	NA	1.89e-09	NA
7. B	P09445	Elongation factor 2	6.01e-03	NA	6.58e-05	NA
7. B	B1LBI4	GTPase Der	8.59e-03	NA	0.007	NA
7. B	B5YS58	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	B0B9K4	Translation initiation factor IF-2	0.00e+00	NA	8.13e-127	NA
7. B	B8I5N8	Elongation factor Tu	4.62e-07	NA	4.16e-12	NA
7. B	Q8KAH0	Elongation factor Tu	3.91e-07	NA	1.53e-14	NA
7. B	Q8Z4P6	GTPase Der	5.48e-03	NA	0.018	NA
7. B	Q3BWY6	Elongation factor Tu	4.22e-07	NA	8.66e-10	NA
7. B	A9M3X0	Elongation factor G	2.73e-05	NA	5.04e-07	NA
7. B	Q3K022	GTPase Era	1.85e-03	NA	6.90e-04	NA
7. B	Q0I1U9	Elongation factor Tu	5.04e-07	NA	1.84e-14	NA
7. B	B8DBY9	GTPase Der	6.54e-04	NA	0.014	NA
7. B	A1SNN5	Elongation factor Tu	4.63e-07	NA	6.60e-09	NA
7. B	Q9PK73	Elongation factor Tu	NA	NA	2.01e-11	NA
7. B	Q4K519	Elongation factor Tu	5.68e-07	NA	3.40e-09	NA
7. B	Q5R9V1	Elongation factor G, mitochondrial	1.42e-04	NA	4.26e-09	NA
7. B	B7LEG9	Sulfate adenylyltransferase subunit 1	6.78e-06	NA	8.08e-05	NA
7. B	P0A6P6	GTPase Der	3.50e-03	NA	0.025	NA
7. B	A9KRZ3	Elongation factor G	2.42e-05	NA	7.42e-09	NA
7. B	Q0V3J4	Translation factor GUF1, mitochondrial	3.05e-05	NA	1.10e-05	NA
7. B	B1YVM2	Elongation factor 4	2.41e-06	NA	1.86e-07	NA
7. B	Q6BPD3	Elongation factor G, mitochondrial	6.65e-05	NA	6.19e-09	NA
7. B	B7NKN7	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q9RXK5	Elongation factor G	1.79e-05	NA	1.27e-05	NA
7. B	A5GAW4	Elongation factor Tu	5.30e-07	NA	3.97e-10	NA
7. B	P68791	Elongation factor G	9.53e-06	NA	3.56e-08	NA
7. B	Q17VM8	Elongation factor Tu	3.96e-07	NA	2.36e-10	NA
7. B	Q0T208	GTPase Der	5.29e-03	NA	0.008	NA
7. B	P30767	Elongation factor G	1.28e-04	NA	3.87e-09	NA
7. B	Q3SLQ1	Elongation factor Tu	4.59e-07	NA	1.10e-08	NA
7. B	Q814C5	Elongation factor G	9.83e-06	NA	1.86e-09	NA
7. B	Q5QWB4	Elongation factor G	8.37e-06	NA	3.83e-09	NA
7. B	Q03IS1	Elongation factor G	2.50e-05	NA	4.42e-09	NA
7. B	A7FMS2	Translation initiation factor IF-2	0.00e+00	NA	6.38e-154	NA
7. B	A3PGI1	Elongation factor Tu	4.45e-07	NA	1.36e-11	NA
7. B	Q5E8B9	Elongation factor G 1	2.48e-05	NA	3.04e-08	NA
7. B	A0RW30	Elongation factor 2	2.56e-04	NA	1.68e-08	NA
7. B	A5IQA2	Elongation factor Tu	3.69e-07	NA	3.46e-12	NA
7. B	P60792	Elongation factor 4	7.72e-06	NA	9.01e-10	NA
7. B	Q2LWC5	Peptide chain release factor 3	6.17e-05	NA	3.03e-08	NA
7. B	Q65PA9	Elongation factor Tu	3.50e-07	NA	9.70e-14	NA
7. B	C0QA05	GTPase Der	2.13e-03	NA	0.046	NA
7. B	B8ZLK3	Peptide chain release factor 3	6.24e-05	NA	2.12e-07	NA
7. B	Q5P089	Elongation factor 4	7.75e-07	NA	1.54e-08	NA
7. B	Q123W3	Elongation factor G 2	2.42e-05	NA	2.25e-07	NA
7. B	Q8E635	Peptide chain release factor 3	1.74e-05	NA	2.98e-07	NA
7. B	Q0I2G9	Peptide chain release factor 3	2.58e-05	NA	7.53e-07	NA
7. B	Q03F25	Elongation factor Tu	3.55e-07	NA	8.82e-12	NA
7. B	B9JYK6	Translation initiation factor IF-2	0.00e+00	NA	6.39e-150	NA
7. B	Q7VJ85	Elongation factor G	1.05e-05	NA	1.27e-07	NA
7. B	Q64T74	Elongation factor 4	1.06e-06	NA	3.39e-07	NA
7. B	P59506	Elongation factor Tu	4.44e-07	NA	5.87e-13	NA
7. B	A9M5Q2	Elongation factor Tu	4.16e-07	NA	7.09e-11	NA
7. B	Q2S1P8	Elongation factor Tu	4.48e-07	NA	1.56e-13	NA
7. B	Q3J9L6	Peptide chain release factor 3	4.86e-05	NA	1.99e-07	NA
7. B	Q3AMT6	Elongation factor Tu	3.18e-07	NA	4.35e-09	NA
7. B	Q1QN32	Elongation factor Tu	4.49e-07	NA	1.05e-13	NA
7. B	Q976B1	Elongation factor 1-alpha	1.31e-06	NA	3.02e-05	NA
7. B	Q2RJM5	Translation initiation factor IF-2	0.00e+00	NA	0.0	NA
7. B	Q87L45	Elongation factor G 1	1.03e-05	NA	1.24e-07	NA
7. B	Q58448	Elongation factor 2	7.21e-05	NA	8.29e-10	NA
7. B	Q2GJ61	Elongation factor Tu	6.96e-06	NA	2.94e-07	NA
7. B	A1ALS6	Elongation factor Tu	5.31e-07	NA	8.01e-11	NA
7. B	Q8DCQ7	Elongation factor Tu 2	4.23e-07	NA	1.47e-12	NA
7. B	B8J1Y4	Translation initiation factor IF-2	0.00e+00	NA	4.27e-166	NA
7. B	Q2NEL0	Elongation factor 2	1.11e-04	NA	4.84e-06	NA
7. B	A4J108	Elongation factor G	3.56e-06	NA	5.97e-08	NA
7. B	O51115	Elongation factor 4	3.00e-06	NA	6.05e-10	NA
7. B	Q9LNC5	110 kDa U5 small nuclear ribonucleoprotein component CLO	1.49e-02	NA	8.28e-08	NA
7. B	Q8R050	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A	1.30e-04	NA	4.84e-04	NA
7. B	Q1HPK6	Translation elongation factor 2	5.88e-03	NA	3.38e-05	NA
7. B	Q46WE0	Elongation factor G 1	2.12e-05	NA	3.91e-06	NA
7. B	Q5WVI1	Elongation factor 4	1.62e-06	NA	1.87e-08	NA
7. B	B3WFB1	Peptide chain release factor 3	4.32e-05	NA	4.40e-08	NA
7. B	Q88XF3	Peptide chain release factor 3	5.80e-05	NA	3.90e-09	NA
7. B	B4SBU5	Elongation factor Tu	4.12e-07	NA	6.48e-15	NA
7. B	B4TFX1	Sulfate adenylyltransferase subunit 1	8.34e-05	NA	3.59e-05	NA
7. B	Q3B2V1	Elongation factor 4	3.54e-06	NA	1.07e-05	NA
7. B	Q04B34	Probable GTP-binding protein EngB	9.18e-06	NA	0.031	NA
7. B	A8A5E7	Elongation factor G	2.38e-05	NA	1.30e-07	NA
7. B	Q2IPZ7	Translation initiation factor IF-2	0.00e+00	NA	5.65e-141	NA
7. B	Q1J822	GTPase Era	1.68e-03	NA	6.28e-04	NA
7. B	Q5E830	Sulfate adenylyltransferase subunit 1	9.24e-06	NA	1.39e-05	NA
7. B	A0R8H8	Elongation factor Tu	3.33e-07	NA	2.96e-14	NA
7. B	A5VJ92	Elongation factor Tu	3.48e-07	NA	1.37e-12	NA
7. B	Q2W2H3	Elongation factor Tu	5.17e-07	NA	1.92e-12	NA
7. B	Q92SW4	Translation initiation factor IF-2	0.00e+00	NA	1.13e-154	NA
7. B	B4S9B7	Elongation factor 4	3.74e-06	NA	4.31e-08	NA
7. B	B0KK53	Elongation factor Tu	4.95e-07	NA	7.09e-09	NA
7. B	A8LR11	Elongation factor 4	9.64e-07	NA	1.53e-06	NA
7. B	F1QGW6	Eukaryotic translation initiation factor 2 subunit 3	1.80e-06	NA	0.021	NA
7. B	A2CC87	Elongation factor Tu	3.25e-07	NA	2.33e-08	NA
7. B	Q0TMN0	Elongation factor Tu	3.55e-07	NA	2.97e-10	NA
7. B	B8MJJ5	Elongation factor G, mitochondrial	8.91e-04	NA	2.59e-06	NA
7. B	B1MGH7	Elongation factor Tu	5.69e-07	NA	1.56e-08	NA
7. B	Q8Y0I4	Elongation factor 4	2.60e-06	NA	4.43e-08	NA
7. B	Q3JSY9	Translation initiation factor IF-2	0.00e+00	NA	1.53e-168	NA
7. B	Q74JU6	Elongation factor Tu	4.07e-07	NA	8.91e-16	NA
7. B	Q2RQU6	Elongation factor Tu 2	4.44e-07	NA	3.47e-11	NA
7. B	Q8EB10	Sulfate adenylyltransferase subunit 1	8.52e-04	NA	5.33e-07	NA
7. B	B0RCT0	Elongation factor 4	3.58e-06	NA	1.05e-09	NA
7. B	Q8KTA6	Elongation factor Tu	5.28e-07	NA	3.49e-13	NA
7. B	B6K6L6	Translation factor guf1, mitochondrial	1.24e-06	NA	1.41e-07	NA
7. B	A4WDE0	Elongation factor 4	6.66e-07	NA	5.76e-09	NA
7. B	A1VEB9	Elongation factor G	2.01e-05	NA	5.11e-08	NA
7. B	Q5R600	Ribosome-releasing factor 2, mitochondrial	8.35e-04	NA	8.16e-07	NA
7. B	B8H414	Elongation factor G	3.41e-05	NA	4.16e-09	NA
7. B	P0CN32	Elongation factor G, mitochondrial	2.42e-05	NA	1.66e-07	NA
7. B	Q12Z93	Probable translation initiation factor IF-2	6.69e-12	NA	3.18e-38	NA
7. B	B5Y282	Peptide chain release factor 3	2.99e-05	NA	1.30e-07	NA
7. B	Q2S8Z8	Elongation factor Tu	5.83e-07	NA	1.58e-10	NA
7. B	Q71Y78	GTPase Der	7.91e-04	NA	0.014	NA
7. B	C0ZVT7	Elongation factor Tu	4.11e-07	NA	5.33e-08	NA
7. B	A0JZ88	Elongation factor Tu	5.09e-07	NA	5.93e-06	NA
7. B	A4HAG7	Translation factor GUF1 homolog, mitochondrial	1.14e-03	NA	0.002	NA
7. B	P56003	Elongation factor Tu	4.16e-07	NA	7.08e-12	NA
7. B	P64064	GTPase Der	1.63e-03	NA	3.51e-05	NA
7. B	Q9Z0N2	Eukaryotic translation initiation factor 2 subunit 3, Y-linked	1.80e-06	NA	0.021	NA
7. B	C1CC62	Elongation factor G	6.12e-05	NA	1.93e-09	NA
7. B	Q39VA6	Translation initiation factor IF-2	0.00e+00	NA	0.0	NA
7. B	Q0AF71	GTPase Era	9.66e-03	NA	0.012	NA
7. B	A4J7F8	Elongation factor 4	2.03e-06	NA	1.34e-11	NA
7. B	Q7V2Q1	Elongation factor 4	1.95e-06	NA	1.36e-08	NA
7. B	B4SUU6	Elongation factor G	2.43e-05	NA	7.70e-07	NA
7. B	B5EFP7	Elongation factor G	2.20e-05	NA	5.82e-09	NA
7. B	B4RU35	Peptide chain release factor 3	3.40e-05	NA	6.53e-07	NA
7. B	Q9AC25	Translation initiation factor IF-2	0.00e+00	NA	2.37e-151	NA
7. B	Q2JUX4	Elongation factor Tu	3.88e-07	NA	6.23e-11	NA
7. B	A1T4L5	Elongation factor G	9.43e-06	NA	2.63e-09	NA
7. B	Q9V0V7	Elongation factor 1-alpha	2.57e-06	NA	2.93e-06	NA
7. B	Q87SX9	Sulfate adenylyltransferase subunit 1	4.42e-05	NA	5.83e-06	NA
7. B	B0U262	Peptide chain release factor 3	3.70e-05	NA	1.67e-05	NA
7. B	A3PEZ8	Elongation factor G	9.41e-05	NA	4.36e-10	NA
7. B	Q03QN5	Elongation factor Tu	3.93e-07	NA	5.83e-12	NA
7. B	O86490	Peptide chain release factor 3	2.52e-05	NA	2.29e-09	NA
7. B	C1KZK6	Elongation factor Tu	4.37e-07	NA	1.86e-13	NA
7. B	Q721H8	Peptide chain release factor 3	2.49e-05	NA	2.08e-06	NA
7. B	Q089Q7	Elongation factor G 1	3.10e-05	NA	4.63e-09	NA
7. B	Q3AEZ3	GTPase Era	1.53e-03	NA	0.010	NA
7. B	P0DA85	Elongation factor G	2.27e-05	NA	1.50e-08	NA
7. B	A3M306	Elongation factor G	5.32e-05	NA	4.39e-07	NA
7. B	Q21WJ5	Translation initiation factor IF-2	0.00e+00	NA	5.48e-153	NA
7. B	O83217	Elongation factor Tu	2.57e-07	NA	3.77e-12	NA
7. B	Q83NT9	Elongation factor Tu	4.68e-07	NA	6.87e-07	NA
7. B	Q0SX36	Peptide chain release factor 3	1.03e-05	NA	1.24e-07	NA
7. B	Q29BD5	Ribosome-releasing factor 2, mitochondrial	2.22e-04	NA	0.002	NA
7. B	Q1B684	Elongation factor 4	4.63e-06	NA	8.22e-08	NA
7. B	B1LEH8	Peptide chain release factor 3	1.08e-05	NA	1.26e-07	NA
7. B	A6W7Z2	Translation initiation factor IF-2	0.00e+00	NA	4.13e-158	NA
7. B	A8YZP5	Elongation factor Tu	3.87e-07	NA	3.46e-12	NA
7. B	O59521	Elongation factor 2	6.67e-05	NA	7.89e-11	NA
7. B	P0CE47	Elongation factor Tu 1	5.93e-07	NA	1.26e-13	NA
7. B	A8G709	Elongation factor G	1.08e-04	NA	4.33e-10	NA
7. B	B9KNH9	Elongation factor 4	2.67e-06	NA	3.49e-08	NA
7. B	Q8D3H2	Elongation factor G	5.76e-05	NA	5.53e-09	NA
7. B	Q5RDE1	Eukaryotic translation initiation factor 5B	2.30e-10	NA	1.28e-19	NA
7. B	O52836	Tetracycline resistance protein TetW	1.23e-05	NA	7.99e-13	NA
7. B	Q8KT95	Elongation factor Tu	4.55e-07	NA	2.02e-13	NA
7. B	Q8DCQ8	Elongation factor G	2.64e-05	NA	7.19e-08	NA
7. B	Q8DS90	GTPase Der	1.42e-03	NA	5.24e-05	NA
7. B	B2FNR1	GTPase Der	8.08e-03	NA	0.006	NA
7. B	C1CLI6	Elongation factor Tu	4.31e-07	NA	8.23e-11	NA
7. B	A6W394	Elongation factor Tu	6.02e-07	NA	1.21e-11	NA
7. B	A8YU90	Peptide chain release factor 3	4.50e-05	NA	1.56e-08	NA
7. B	Q8X7X7	Sulfate adenylyltransferase subunit 1	5.89e-06	NA	3.95e-04	NA
7. B	Q3YSU3	Elongation factor G	9.47e-06	NA	5.28e-08	NA
7. B	Q2N9U6	Elongation factor 4	2.91e-06	NA	2.64e-06	NA
7. B	P14081	Selenocysteine-specific elongation factor	1.27e-05	NA	4.27e-12	NA
7. B	C1ET36	Elongation factor G	1.07e-05	NA	1.95e-09	NA
7. B	Q98QG1	Elongation factor Tu	4.41e-07	NA	1.69e-11	NA
7. B	A6WWW5	Translation initiation factor IF-2	0.00e+00	NA	1.53e-157	NA
7. B	O66428	Elongation factor G	6.81e-06	NA	1.89e-09	NA
7. B	C3LRM1	Sulfate adenylyltransferase subunit 1	4.35e-05	NA	3.12e-05	NA
7. B	C1L1Q9	Peptide chain release factor 3	4.37e-05	NA	1.88e-06	NA
7. B	A4VHM7	Elongation factor G	4.81e-05	NA	5.73e-08	NA
7. B	B1Y7G9	Elongation factor G	2.49e-05	NA	4.04e-06	NA
7. B	Q79G84	Elongation factor Tu	4.70e-07	NA	1.28e-12	NA
7. B	C5CC66	Elongation factor Tu	5.41e-07	NA	1.51e-06	NA
7. B	Q9Z8I4	Elongation factor 4	2.88e-06	NA	6.99e-09	NA
7. B	Q72GW4	Elongation factor Tu	5.26e-07	NA	1.40e-12	NA
7. B	B8HVR7	Elongation factor Tu	4.23e-07	NA	2.41e-11	NA
7. B	O24310	Elongation factor Tu, chloroplastic	NA	NA	2.80e-09	NA
7. B	A9IMT5	Translation initiation factor IF-2	0.00e+00	NA	6.36e-155	NA
7. B	A5IM81	Elongation factor Tu	4.12e-07	NA	1.64e-12	NA
7. B	B4RJN1	Peptide chain release factor 3	2.29e-05	NA	3.57e-06	NA
7. B	P51836	GTPase Era	1.21e-03	NA	0.040	NA
7. B	A0QS98	Elongation factor Tu	5.11e-07	NA	1.22e-08	NA
7. B	A1W2Q4	Elongation factor G	4.42e-05	NA	2.09e-06	NA
7. B	A3N247	Elongation factor G	2.01e-05	NA	2.21e-07	NA
7. B	B7GU46	Elongation factor Tu	3.68e-07	NA	1.55e-08	NA
7. B	Q1LI29	Elongation factor G 1	2.27e-05	NA	2.82e-06	NA
7. B	Q72ER1	Translation initiation factor IF-2	0.00e+00	NA	8.32e-162	NA
7. B	B8ZSC1	Elongation factor Tu	5.24e-07	NA	1.29e-09	NA
7. B	B2HKS2	Translation initiation factor IF-2	0.00e+00	NA	9.63e-161	NA
7. B	A4QBG9	Elongation factor G	2.03e-05	NA	3.79e-10	NA
7. B	Q6HPR1	Elongation factor G	8.25e-06	NA	1.95e-09	NA
7. B	Q24208	Eukaryotic translation initiation factor 2 subunit 3	1.05e-06	NA	0.006	NA
7. B	Q1JNC4	GTPase Der	1.33e-03	NA	3.51e-05	NA
7. B	Q839G8	Elongation factor Tu	4.16e-07	NA	1.34e-13	NA
7. B	B7LCQ1	GTPase Der	4.79e-03	NA	0.025	NA
7. B	B3QUN2	Translation initiation factor IF-2	0.00e+00	NA	1.91e-156	NA
7. B	Q3ALG5	Elongation factor 4	1.91e-06	NA	2.86e-11	NA
7. B	Q40450	Elongation factor TuA, chloroplastic	5.95e-06	NA	1.09e-09	NA
7. B	C4Y8M4	Translation factor GUF1, mitochondrial	1.23e-04	NA	3.12e-05	NA
7. B	Q5FJT7	GTPase Era	2.00e-03	NA	0.022	NA
7. B	B5XNG8	Elongation factor 4	1.21e-06	NA	1.08e-10	NA
7. B	Q149F3	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B	1.21e-04	NA	5.18e-04	NA
7. B	Q6CBI0	Ribosome-releasing factor 2, mitochondrial	3.22e-04	NA	1.60e-07	NA
7. B	A0RQJ3	Elongation factor Tu	4.70e-07	NA	2.65e-11	NA
7. B	A3CLS9	Peptide chain release factor 3	1.06e-05	NA	3.01e-07	NA
7. B	B4NAU8	Ribosome-releasing factor 2, mitochondrial	2.27e-04	NA	2.52e-08	NA
7. B	C1F697	Translation initiation factor IF-2	0.00e+00	NA	3.48e-157	NA
7. B	B3EAE7	Translation initiation factor IF-2	0.00e+00	NA	6.33e-172	NA
7. B	B1YGU8	Elongation factor Tu	3.95e-07	NA	7.23e-14	NA
7. B	Q5WY34	Peptide chain release factor 3	3.85e-05	NA	6.12e-07	NA
7. B	A0PM42	Elongation factor Tu	4.30e-07	NA	2.81e-09	NA
7. B	A5FZW7	Elongation factor Tu	3.82e-07	NA	1.67e-14	NA
7. B	P33167	Elongation factor Tu	4.85e-07	NA	2.47e-11	NA
7. B	Q6LLQ5	Probable GTP-binding protein EngB	4.14e-05	NA	0.005	NA
7. B	Q3JMP6	Elongation factor Tu	4.46e-07	NA	3.06e-12	NA
7. B	A4JDX1	Translation initiation factor IF-2	0.00e+00	NA	3.03e-168	NA
7. B	A6TZ25	Elongation factor Tu	3.63e-07	NA	3.46e-12	NA
7. B	Q9HGI6	Eukaryotic peptide chain release factor GTP-binding subunit	5.92e-04	NA	7.63e-04	NA
7. B	B8ZL95	Elongation factor Tu	4.46e-07	NA	8.23e-11	NA
7. B	Q53871	Elongation factor Tu-1	4.60e-07	NA	1.91e-10	NA
7. B	A6VN03	Peptide chain release factor 3	1.31e-05	NA	6.63e-06	NA
7. B	A9NEN4	Elongation factor Tu	3.88e-07	NA	2.58e-10	NA
7. B	Q14JC2	Elongation factor G	5.08e-05	NA	8.22e-09	NA
7. B	Q2IK81	Elongation factor G 2	1.09e-04	NA	1.93e-08	NA
7. B	A8A8A3	Peptide chain release factor 3	1.14e-05	NA	1.18e-07	NA
7. B	Q88PH8	Peptide chain release factor 3	1.03e-04	NA	3.49e-07	NA
7. B	Q03YI2	Elongation factor Tu	3.49e-07	NA	7.64e-12	NA
7. B	A3CP94	GTPase Era	1.37e-03	NA	3.15e-04	NA
7. B	A5WH42	Elongation factor Tu 2	5.04e-07	NA	9.87e-12	NA
7. B	Q7UZY6	Elongation factor G	1.14e-04	NA	4.11e-10	NA
7. B	Q64VQ9	Sulfate adenylyltransferase subunit 1	5.10e-04	NA	1.40e-05	NA
7. B	A0KU03	Peptide chain release factor 3	3.69e-05	NA	2.17e-05	NA
7. B	B1VET0	Elongation factor G	6.61e-05	NA	1.02e-09	NA
7. B	C3PHY1	Elongation factor 4	1.17e-05	NA	8.57e-07	NA
7. B	A8A5E6	Elongation factor Tu 1	5.51e-07	NA	1.26e-13	NA
7. B	Q8TVE5	Translation initiation factor 2 subunit gamma	9.57e-06	NA	1.27e-05	NA
7. B	C4KZP9	Elongation factor Tu	3.97e-07	NA	6.29e-13	NA
7. B	Q6A7M5	Translation initiation factor IF-2	0.00e+00	NA	1.41e-168	NA
7. B	Q5FUP6	Elongation factor G	6.93e-05	NA	1.07e-08	NA
7. B	B7LKC7	GTPase Der	3.65e-03	NA	0.026	NA
7. B	B9DKV7	Elongation factor G	1.12e-05	NA	4.22e-10	NA
7. B	B9M913	GTPase Era	6.21e-04	NA	0.001	NA
7. B	Q9V1Z8	Elongation factor 2	5.56e-05	NA	9.29e-11	NA
7. B	O84067	Elongation factor 4	3.15e-06	NA	3.67e-07	NA
7. B	Q24UI6	Translation initiation factor IF-2	0.00e+00	NA	0.0	NA
7. B	B2U207	Translation initiation factor IF-2	0.00e+00	NA	4.12e-153	NA
7. B	A1T4L6	Elongation factor Tu	4.11e-07	NA	8.35e-09	NA
7. B	Q6F0J5	Elongation factor Tu	5.12e-07	NA	2.49e-12	NA
7. B	B0K3E4	GTPase Der	2.05e-03	NA	0.004	NA
7. B	P60785	Elongation factor 4	9.55e-07	NA	1.14e-09	NA
7. B	Q1LLR6	Translation initiation factor IF-2	0.00e+00	NA	4.39e-167	NA
7. B	Q1MS56	GTPase Der	4.88e-03	NA	0.007	NA
7. B	B2K5N5	Elongation factor G	2.32e-05	NA	8.38e-07	NA
7. B	Q30X13	Elongation factor Tu	4.86e-07	NA	1.07e-11	NA
7. B	B7MB89	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	B2J5B1	Elongation factor Tu	3.59e-07	NA	6.46e-11	NA
7. B	P56059	GTPase Era	1.95e-03	NA	0.018	NA
7. B	C1CFT0	GTPase Der	2.11e-03	NA	6.10e-06	NA
7. B	A1TJ04	Elongation factor G	4.20e-05	NA	3.58e-06	NA
7. B	Q0BKK2	Peptide chain release factor 3	3.69e-05	NA	8.10e-08	NA
7. B	B2G718	GTPase Der	1.86e-03	NA	1.30e-04	NA
7. B	A5VL77	Peptide chain release factor 3	5.40e-05	NA	8.99e-09	NA
7. B	Q7W2S3	Peptide chain release factor 3	1.86e-04	NA	5.14e-08	NA
7. B	A1UIU2	Elongation factor 4	4.10e-06	NA	8.22e-08	NA
7. B	Q969S9	Ribosome-releasing factor 2, mitochondrial	2.56e-04	NA	6.76e-07	NA
7. B	Q2RNY6	Elongation factor 4	8.94e-07	NA	5.86e-08	NA
7. B	Q30V54	Peptide chain release factor 3	2.52e-04	NA	5.04e-08	NA
7. B	Q1LSY4	Elongation factor Tu	3.11e-07	NA	3.31e-13	NA
7. B	Q0AIJ7	Elongation factor Tu 1	5.55e-07	NA	2.19e-08	NA
7. B	C3LSR4	Peptide chain release factor 3	1.14e-05	NA	2.07e-06	NA
7. B	P02992	Elongation factor Tu, mitochondrial	5.31e-06	NA	4.48e-10	NA
7. B	Q48VB6	Elongation factor G	2.02e-05	NA	1.50e-08	NA
7. B	B7LXG3	Sulfate adenylyltransferase subunit 1	5.62e-06	NA	8.08e-05	NA
7. B	A1UU50	Translation initiation factor IF-2	0.00e+00	NA	6.25e-155	NA
7. B	Q4QJL3	Peptide chain release factor 3	1.06e-05	NA	2.21e-06	NA
7. B	Q9K1I8	Elongation factor G	2.92e-05	NA	4.96e-07	NA
7. B	Q9TKZ5	Elongation factor Tu, chloroplastic	3.67e-07	NA	9.84e-11	NA
7. B	Q63TP8	Translation initiation factor IF-2	0.00e+00	NA	1.53e-168	NA
7. B	P57938	Elongation factor G	2.33e-05	NA	3.54e-07	NA
7. B	Q985A5	GTPase Era	3.83e-03	NA	4.54e-04	NA
7. B	C5FMX6	Translation factor GUF1, mitochondrial	2.02e-04	NA	4.24e-07	NA
7. B	A7GK17	Elongation factor G	5.66e-06	NA	1.78e-09	NA
7. B	B1KRQ3	Peptide chain release factor 3	1.24e-05	NA	9.37e-06	NA
7. B	B1KMH4	Sulfate adenylyltransferase subunit 1	5.13e-05	NA	3.11e-06	NA
7. B	Q8XPH8	Peptide chain release factor 3	4.77e-04	NA	5.66e-07	NA
7. B	Q55E94	Elongation factor G, mitochondrial	6.79e-04	NA	6.95e-09	NA
7. B	A8GXR7	GTPase Der	1.02e-03	NA	0.043	NA
7. B	Q9KV37	Elongation factor Tu-A	3.91e-07	NA	3.22e-14	NA
7. B	A9R055	Peptide chain release factor 3	1.07e-05	NA	7.37e-07	NA
7. B	Q9HWD2	Elongation factor G 1	5.38e-05	NA	5.21e-08	NA
7. B	B1JL43	Peptide chain release factor 3	1.16e-05	NA	7.50e-07	NA
7. B	A5FV42	Elongation factor G	6.80e-05	NA	6.87e-09	NA
7. B	Q79GC6	Elongation factor Tu	4.92e-07	NA	1.28e-12	NA
7. B	Q0BYB2	Elongation factor Tu 2	4.46e-07	NA	7.07e-08	NA
7. B	A9HW20	Peptide chain release factor 3	1.32e-04	NA	9.27e-08	NA
7. B	Q4P257	Elongation factor G, mitochondrial	8.26e-04	NA	2.46e-07	NA
7. B	B8J1A0	Elongation factor Tu	4.52e-07	NA	2.22e-09	NA
7. B	Q9V1G0	Translation initiation factor 2 subunit gamma	1.05e-05	NA	4.81e-07	NA
7. B	B4S5M9	Elongation factor Tu	4.14e-07	NA	2.40e-14	NA
7. B	A6Q4R8	GTPase Der	3.17e-03	NA	0.002	NA
7. B	B5YTP7	Elongation factor G	2.01e-05	NA	1.30e-07	NA
7. B	A1AVJ8	Elongation factor Tu 1	4.36e-07	NA	4.08e-09	NA
7. B	Q4FLK5	Elongation factor Tu	4.60e-07	NA	5.26e-07	NA
7. B	Q3SK69	Peptide chain release factor 3	3.09e-05	NA	2.63e-06	NA
7. B	B1KX71	GTPase Der	1.48e-03	NA	4.71e-05	NA
7. B	C5CCD4	Elongation factor 4	4.20e-06	NA	1.10e-10	NA
7. B	Q83GW1	Elongation factor Tu	4.66e-07	NA	6.63e-07	NA
7. B	A0LRL7	Elongation factor G	3.85e-05	NA	6.27e-08	NA
7. B	Q8DDQ8	Probable GTP-binding protein EngB	4.57e-05	NA	0.018	NA
7. B	B1KSM7	Elongation factor Tu	4.28e-07	NA	1.87e-11	NA
7. B	Q03GI2	Peptide chain release factor 3	5.65e-05	NA	1.18e-10	NA
7. B	Q5GRY3	Elongation factor Tu 2	2.02e-07	NA	1.91e-12	NA
7. B	A4XZ93	Elongation factor G	4.91e-05	NA	9.91e-08	NA
7. B	A1T056	Elongation factor Tu	4.21e-07	NA	8.87e-13	NA
7. B	B7PJS6	Translation factor GUF1 homolog, mitochondrial	2.01e-06	NA	1.22e-09	NA
7. B	P42472	Elongation factor Tu (Fragment)	5.37e-06	NA	1.28e-11	NA
7. B	B8D9V0	Elongation factor G	1.78e-05	NA	8.86e-08	NA
7. B	Q482Z9	Sulfate adenylyltransferase subunit 1	3.02e-05	NA	1.12e-04	NA
7. B	A1WCN6	Elongation factor Tu 2	3.74e-07	NA	2.40e-12	NA
7. B	B8ZP66	GTPase Era	1.59e-03	NA	1.83e-04	NA
7. B	B6YVG5	Elongation factor 2	5.52e-05	NA	1.67e-09	NA
7. B	B3M011	Ribosome-releasing factor 2, mitochondrial	1.40e-04	NA	0.003	NA
7. B	C4K3Z1	Elongation factor 4	1.01e-06	NA	4.76e-11	NA
7. B	Q6LVC1	Elongation factor G 1	2.70e-05	NA	2.05e-07	NA
7. B	Q660H9	Elongation factor G 2	1.28e-05	NA	5.02e-08	NA
7. B	Q5F5S3	Elongation factor G	2.81e-05	NA	5.49e-07	NA
7. B	B5BL11	Peptide chain release factor 3	1.07e-05	NA	1.28e-07	NA
7. B	B4S5N0	Elongation factor G	3.26e-05	NA	3.88e-09	NA
7. B	Q6A6L5	Elongation factor G	2.59e-05	NA	4.47e-06	NA
7. B	Q5X862	Elongation factor G	2.34e-05	NA	3.11e-06	NA
7. B	Q3A709	Peptide chain release factor 3	4.37e-05	NA	2.06e-08	NA
7. B	B9KFH1	Elongation factor G	2.87e-05	NA	3.62e-08	NA
7. B	A1KRF9	Elongation factor Tu	4.15e-07	NA	4.37e-10	NA
7. B	Q8NN68	Elongation factor 4	8.32e-06	NA	3.12e-07	NA
7. B	O31300	Elongation factor Tu (Fragment)	9.82e-06	NA	4.20e-12	NA
7. B	A8EW02	Elongation factor Tu	5.09e-07	NA	2.64e-09	NA
7. B	B8DTV7	Elongation factor Tu	4.36e-07	NA	5.15e-08	NA
7. B	Q6ACZ0	Elongation factor Tu	5.48e-07	NA	4.96e-07	NA
7. B	A4XI36	Elongation factor G	1.49e-05	NA	7.13e-07	NA
7. B	C4YJQ8	Elongation factor 2	1.75e-03	NA	1.85e-06	NA
7. B	Q2J2J9	Translation initiation factor IF-2	0.00e+00	NA	6.35e-158	NA
7. B	B8D9K1	Sulfate adenylyltransferase subunit 1	1.06e-03	NA	2.51e-04	NA
7. B	Q2JQ51	Elongation factor 4	1.63e-06	NA	1.18e-10	NA
7. B	Q3J5S4	Elongation factor Tu	4.40e-07	NA	1.36e-11	NA
7. B	Q4QMT5	Elongation factor Tu 2	5.20e-07	NA	1.58e-13	NA
7. B	B0B9H2	Elongation factor 4	3.84e-06	NA	3.42e-07	NA
7. B	Q0ADD1	Peptide chain release factor 3	1.92e-04	NA	1.81e-06	NA
7. B	B5BGZ2	Elongation factor G	2.46e-05	NA	7.70e-07	NA
7. B	Q1H2L5	Elongation factor 4	1.04e-06	NA	8.76e-10	NA
7. B	P57498	Sulfate adenylyltransferase subunit 1	6.62e-03	NA	2.57e-04	NA
7. B	B1JR12	Probable GTP-binding protein EngB	3.81e-05	NA	0.006	NA
7. B	Q57918	Selenocysteine-specific elongation factor	7.00e-06	NA	1.70e-09	NA
7. B	C0R543	Elongation factor G	6.31e-06	NA	5.10e-07	NA
7. B	Q8ZBP2	Sulfate adenylyltransferase subunit 1	2.15e-04	NA	4.16e-05	NA
7. B	P13927	Elongation factor Tu	4.16e-07	NA	6.24e-12	NA
7. B	A3CPT0	GTPase Der	2.02e-03	NA	5.33e-05	NA
7. B	C1DQ00	Peptide chain release factor 3	4.30e-05	NA	2.81e-07	NA
7. B	A1JIH3	Elongation factor Tu 1	5.23e-07	NA	1.92e-12	NA
7. B	P16018	Elongation factor 1-alpha	2.65e-06	NA	1.89e-08	NA
7. B	A2RDW3	Peptide chain release factor 3	1.57e-05	NA	3.74e-08	NA
7. B	B8G6S9	Elongation factor G	4.86e-05	NA	7.45e-06	NA
7. B	P41203	Elongation factor 1-alpha	8.66e-07	NA	0.005	NA
7. B	B1XZN0	Elongation factor 4	7.11e-07	NA	7.54e-10	NA
7. B	P69952	Elongation factor Tu	4.04e-07	NA	1.79e-12	NA
7. B	B7KCH0	Peptide chain release factor 3	9.65e-05	NA	1.29e-10	NA
7. B	P57593	Elongation factor G	2.11e-05	NA	8.86e-08	NA
7. B	A5FLU8	Elongation factor 4	4.09e-06	NA	6.24e-07	NA
7. B	Q8TJT7	Translation initiation factor 2 subunit gamma	3.38e-06	NA	3.97e-08	NA
7. B	Q576S5	Elongation factor 4	1.46e-06	NA	2.31e-08	NA
7. B	Q5HVZ7	Elongation factor Tu	4.96e-07	NA	3.25e-11	NA
7. B	A5ULM6	Elongation factor 2	6.41e-05	NA	6.26e-12	NA
7. B	Q089R8	Elongation factor Tu 1	4.62e-07	NA	5.04e-12	NA
7. B	P50376	Elongation factor Tu, chloroplastic (Fragment)	1.68e-07	NA	0.012	NA
7. B	A6VNE0	Translation initiation factor IF-2	0.00e+00	NA	1.04e-159	NA
7. B	Q4KIC9	Peptide chain release factor 3	3.57e-05	NA	3.43e-07	NA
7. B	Q8YU48	Elongation factor 4	3.78e-07	NA	6.66e-11	NA
7. B	A1JJ92	Peptide chain release factor 3	9.32e-06	NA	6.94e-07	NA
7. B	Q54XD8	Eukaryotic translation initiation factor 2 subunit 3	4.95e-05	NA	3.78e-05	NA
7. B	Q13TF5	Elongation factor Tu	4.99e-07	NA	5.77e-12	NA
7. B	Q5FM92	Elongation factor G	4.43e-05	NA	1.84e-09	NA
7. B	Q3YWT3	Elongation factor Tu 1	5.98e-07	NA	1.26e-13	NA
7. B	A9BCI5	Translation initiation factor IF-2	0.00e+00	NA	1.73e-154	NA
7. B	A4XKV8	GTPase Era	1.65e-03	NA	0.008	NA
7. B	Q5BJP6	Ribosome-releasing factor 2, mitochondrial	6.95e-05	NA	3.06e-06	NA
7. B	A1SLK7	Translation initiation factor IF-2	0.00e+00	NA	8.76e-177	NA
7. B	Q5QWA3	Elongation factor Tu	4.32e-07	NA	9.71e-15	NA
7. B	C1AQW9	Elongation factor 4	2.58e-05	NA	2.09e-08	NA
7. B	Q9A9F4	Elongation factor 4	2.77e-06	NA	1.49e-09	NA
7. B	B9LSM6	Translation initiation factor 2 subunit gamma	7.84e-07	NA	4.05e-07	NA
7. B	A4QEZ2	Translation initiation factor IF-2	0.00e+00	NA	7.08e-155	NA
7. B	B4TWD8	Translation initiation factor IF-2	0.00e+00	NA	2.74e-152	NA
7. B	B7NDF4	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	Q112D2	Elongation factor 4	2.09e-06	NA	2.32e-09	NA
7. B	Q2T0I7	Elongation factor G 1	6.16e-05	NA	1.68e-07	NA
7. B	P35021	Elongation factor 1-alpha	7.45e-07	NA	0.002	NA
7. B	A0QIY2	Translation initiation factor IF-2	0.00e+00	NA	4.75e-148	NA
7. B	B7LS46	Elongation factor G	2.27e-05	NA	1.30e-07	NA
7. B	P9WNM8	Elongation factor G-like protein	3.26e-05	NA	0.013	NA
7. B	Q134R0	Elongation factor Tu 2	4.98e-07	NA	7.99e-13	NA
7. B	Q2NJE6	Elongation factor 4	3.52e-06	NA	3.88e-10	NA
7. B	A1VYI6	Elongation factor Tu	4.79e-07	NA	3.25e-11	NA
7. B	B4EYV7	Elongation factor G	1.59e-05	NA	3.80e-07	NA
7. B	Q874B9	Elongation factor 2	7.82e-03	NA	2.21e-06	NA
7. B	A7FW89	GTPase Der	7.92e-04	NA	1.56e-04	NA
7. B	Q3M7Y0	Peptide chain release factor 3	7.63e-05	NA	4.18e-11	NA
7. B	B8HY03	Peptide chain release factor 3	6.45e-05	NA	1.29e-11	NA
7. B	A7MZI5	Translation initiation factor IF-2	0.00e+00	NA	2.15e-156	NA
7. B	B3EUF3	Elongation factor G	6.15e-05	NA	7.46e-07	NA
7. B	Q15R31	Elongation factor 4	1.10e-06	NA	1.67e-09	NA
7. B	Q664R6	Elongation factor G	2.15e-05	NA	8.38e-07	NA
7. B	A9KD33	Elongation factor Tu	3.40e-07	NA	3.25e-13	NA
7. B	Q1MIE3	Elongation factor Tu	4.39e-07	NA	2.55e-10	NA
7. B	Q4ZMP2	Elongation factor Tu	5.75e-07	NA	3.12e-08	NA
7. B	Q8FPA7	Translation initiation factor IF-2	0.00e+00	NA	1.38e-154	NA
7. B	O94316	Pre-mRNA-splicing factor cwf10	2.47e-02	NA	2.87e-07	NA
7. B	A8GVB2	Elongation factor Tu	4.94e-07	NA	1.97e-11	NA
7. B	Q748X8	Elongation factor Tu	5.41e-07	NA	4.34e-12	NA
7. B	B1XGY0	Translation initiation factor IF-2	0.00e+00	NA	3.66e-153	NA
7. B	P26752	Elongation factor 2	1.24e-04	NA	1.97e-10	NA
7. B	Q3JZB5	Elongation factor G	6.06e-05	NA	6.74e-09	NA
7. B	Q6MU82	Elongation factor G	5.01e-05	NA	1.56e-09	NA
7. B	B0CCD0	Elongation factor Tu	3.90e-07	NA	8.58e-10	NA
7. B	B7GJ65	Elongation factor Tu	2.90e-07	NA	3.68e-14	NA
7. B	B1VET1	Elongation factor Tu	4.30e-07	NA	2.42e-06	NA
7. B	C6C171	Elongation factor Tu	4.87e-07	NA	1.22e-11	NA
7. B	B1LBP3	Elongation factor G	9.04e-05	NA	4.35e-09	NA
7. B	A8G8E0	Elongation factor Tu 1	5.04e-07	NA	5.04e-13	NA
7. B	B5BGJ5	Translation initiation factor IF-2	0.00e+00	NA	4.30e-152	NA
7. B	B4LS49	Elongation factor G, mitochondrial	3.03e-04	NA	1.44e-10	NA
7. B	B7LR37	Translation initiation factor IF-2	0.00e+00	NA	4.35e-153	NA
7. B	Q5N390	Elongation factor 4	1.75e-06	NA	8.22e-12	NA
7. B	Q52360	Tetracycline resistance protein TetQ	2.11e-05	NA	7.37e-07	NA
7. B	A8ACA7	Elongation factor 2	1.71e-04	NA	5.16e-09	NA
7. B	Q8R603	Elongation factor Tu	4.58e-07	NA	3.70e-10	NA
7. B	Q04ED6	Elongation factor G	3.30e-05	NA	1.36e-07	NA
7. B	A1D4D1	Small COPII coat GTPase sar1	1.12e-04	NA	0.001	NA
7. B	O51634	Elongation factor G 2	8.18e-06	NA	1.93e-08	NA
7. B	A8EXK1	Elongation factor G	6.33e-05	NA	2.03e-08	NA
7. B	Q96RP9	Elongation factor G, mitochondrial	1.33e-04	NA	4.19e-09	NA
7. B	A2RCI2	Elongation factor G	2.34e-05	NA	1.46e-08	NA
7. B	Q8DM20	Elongation factor 4	2.14e-06	NA	1.69e-11	NA
7. B	B0VTG3	Elongation factor G	5.20e-05	NA	4.24e-07	NA
7. B	A1WAW8	Elongation factor 4	8.96e-07	NA	6.98e-08	NA
7. B	C1CK50	GTPase Era	4.33e-03	NA	1.86e-04	NA
7. B	Q2UGQ2	Elongation factor G, mitochondrial	3.55e-04	NA	3.28e-06	NA
7. B	Q2NEL1	Elongation factor 1-alpha	9.62e-07	NA	3.48e-04	NA
7. B	B8DE49	GTPase Era	2.29e-03	NA	0.047	NA
7. B	Q65SF0	Peptide chain release factor 3	1.18e-05	NA	7.00e-06	NA
7. B	A5FR18	Elongation factor 4	9.77e-07	NA	8.66e-11	NA
7. B	Q5GWS9	Elongation factor G	4.13e-05	NA	8.88e-08	NA
7. B	B2RKK1	Elongation factor 4	9.71e-07	NA	4.00e-07	NA
7. B	Q87A35	Elongation factor G	5.43e-05	NA	7.80e-08	NA
7. B	Q82S73	Peptide chain release factor 3	8.30e-04	NA	9.38e-07	NA
7. B	Q9FLE4	Translation factor GUF1 homolog, mitochondrial	2.23e-06	NA	2.00e-11	NA
7. B	B8DAY7	Elongation factor Tu	3.93e-07	NA	4.21e-14	NA
7. B	B8D8G4	GTPase Der	1.53e-03	NA	2.34e-04	NA
7. B	B2UTX1	GTPase Era	2.05e-03	NA	0.006	NA
7. B	A0K6X5	Translation initiation factor IF-2	0.00e+00	NA	5.61e-168	NA
7. B	Q8YP63	Elongation factor Tu	4.48e-07	NA	4.15e-10	NA
7. B	A4VHM8	Elongation factor Tu 2	4.85e-07	NA	3.65e-09	NA
7. B	A8EWR6	Sulfate adenylyltransferase subunit 1	2.34e-04	NA	1.03e-05	NA
7. B	Q030L6	GTPase Der	1.29e-03	NA	0.027	NA
7. B	A1AEU5	Sulfate adenylyltransferase subunit 1	6.29e-06	NA	4.38e-04	NA
7. B	Q8IYD1	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B	3.88e-05	NA	0.004	NA
7. B	Q1QEP5	Translation initiation factor IF-2	0.00e+00	NA	1.20e-150	NA
7. B	A4WEY3	Translation initiation factor IF-2	0.00e+00	NA	5.80e-150	NA
7. B	A9W4P8	Elongation factor G	2.43e-04	NA	1.06e-09	NA
7. B	Q9HXB0	Peptide chain release factor 3	3.46e-05	NA	1.11e-06	NA
7. B	P0CT16	Small COPII coat GTPase SAR1	4.23e-04	NA	0.035	NA
7. B	Q8XZV6	Translation initiation factor IF-2	0.00e+00	NA	3.84e-165	NA
7. B	A1BJ36	Elongation factor Tu	3.80e-07	NA	4.46e-14	NA
7. B	Q31R08	Elongation factor 4	1.69e-06	NA	2.52e-12	NA
7. B	B5Z4Q6	Peptide chain release factor 3	1.03e-05	NA	1.26e-07	NA
7. B	C5Z3W1	Translation factor GUF1 homolog, mitochondrial	2.85e-05	NA	1.96e-10	NA
7. B	Q65PB0	Elongation factor G	8.45e-06	NA	1.26e-09	NA
7. B	B3PII1	Sulfate adenylyltransferase subunit 1	9.49e-06	NA	8.42e-06	NA
7. B	Q3IJV1	Elongation factor Tu 2	4.30e-07	NA	6.62e-16	NA
7. B	Q00ZZ1	Translation factor GUF1 homolog, mitochondrial	4.68e-06	NA	9.56e-11	NA
7. B	P66021	Peptide chain release factor 3	2.08e-05	NA	3.64e-08	NA
7. B	B4RV85	GTPase Der	6.59e-03	NA	0.021	NA
7. B	B0C6Z1	Peptide chain release factor 3	8.88e-05	NA	6.41e-12	NA
7. B	B4T461	Sulfate adenylyltransferase subunit 1	9.82e-05	NA	4.13e-05	NA
7. B	Q81SW9	GTPase Der	1.49e-03	NA	0.016	NA
7. B	Q2KTQ5	Peptide chain release factor 3	1.28e-04	NA	1.45e-08	NA
7. B	Q1CCT8	Elongation factor G	2.20e-05	NA	8.38e-07	NA
7. B	A2QU25	Translation factor guf1, mitochondrial	5.10e-06	NA	8.92e-07	NA
7. B	P53893	Ribosome assembly protein 1	9.60e-02	NA	0.011	NA
7. B	B1J4D8	Elongation factor 4	1.00e-06	NA	2.98e-09	NA
7. B	Q46ZP1	Translation initiation factor IF-2	0.00e+00	NA	9.59e-161	NA
7. B	Q4A703	Elongation factor G	2.84e-05	NA	1.21e-10	NA
7. B	Q0VSL8	Elongation factor G	2.86e-05	NA	1.09e-08	NA
7. B	Q5QXU1	Peptide chain release factor 3	3.86e-05	NA	3.68e-07	NA
7. B	Q6BMV8	Translation factor GUF1, mitochondrial	2.96e-06	NA	4.68e-04	NA
7. B	Q7URV2	Elongation factor G	4.63e-06	NA	1.51e-09	NA
7. B	Q8TXJ4	Elongation factor 2	6.06e-03	NA	5.57e-06	NA
7. B	C8VPJ1	Translation factor guf1, mitochondrial	9.34e-06	NA	3.05e-06	NA
7. B	Q1ISC5	Elongation factor G	2.54e-05	NA	3.79e-10	NA
7. B	Q5FCW3	Putative elongation factor Tu-like protein	2.46e-07	NA	2.86e-09	NA
7. B	Q0BPG2	Translation initiation factor IF-2	0.00e+00	NA	4.22e-161	NA
7. B	B2ISJ9	Elongation factor G	6.36e-05	NA	2.00e-09	NA
7. B	Q55002	Oxytetracycline resistance protein	1.43e-05	NA	6.97e-11	NA
7. B	Q8G5B6	Elongation factor G	1.26e-04	NA	9.96e-09	NA
7. B	Q83NI1	Elongation factor 4	3.71e-06	NA	2.41e-06	NA
7. B	Q6HL51	GTPase Der	1.42e-03	NA	0.016	NA
7. B	B3EP63	Elongation factor Tu	3.78e-07	NA	5.03e-15	NA
7. B	Q9A3K4	Elongation factor G	3.52e-05	NA	4.16e-09	NA
7. B	Q8EK71	Elongation factor G 1	2.62e-05	NA	7.91e-09	NA
7. B	Q6LUJ2	Translation initiation factor IF-2	0.00e+00	NA	1.35e-147	NA
7. B	Q254E1	Elongation factor 4	8.81e-06	NA	6.69e-09	NA
7. B	Q5YZZ7	Elongation factor 4	4.46e-06	NA	3.91e-09	NA
7. B	A8Z6I6	Elongation factor G	6.98e-05	NA	1.13e-07	NA
7. B	Q82WD0	Translation initiation factor IF-2	0.00e+00	NA	3.24e-153	NA
7. B	P09591	Elongation factor Tu	4.44e-07	NA	7.48e-10	NA
7. B	A5G9T7	Peptide chain release factor 3	6.96e-05	NA	4.70e-08	NA
7. B	A3MYA2	Peptide chain release factor 3	1.22e-05	NA	3.23e-06	NA
7. B	C0PYN4	GTPase Der	4.28e-03	NA	0.017	NA
7. B	B2SXS6	GTPase Der	2.29e-03	NA	0.006	NA
7. B	Q1IX68	Elongation factor G	1.97e-05	NA	7.88e-06	NA
7. B	Q9R342	Elongation factor Tu	5.20e-07	NA	4.96e-14	NA
7. B	Q9I244	Elongation factor G 2	3.42e-05	NA	1.32e-09	NA
7. B	Q04BM6	Peptide chain release factor 3	4.77e-05	NA	4.00e-08	NA
7. B	Q5VQ69	Translation factor GUF1 homolog, mitochondrial	6.20e-06	NA	5.66e-10	NA
7. B	C4ZUJ5	Elongation factor G	2.25e-05	NA	1.30e-07	NA
7. B	P22679	Elongation factor Tu	3.67e-07	NA	4.19e-14	NA
7. B	A3N246	Elongation factor Tu	5.00e-07	NA	4.69e-13	NA
7. B	A1VAK4	Elongation factor Tu	4.42e-07	NA	1.03e-11	NA
7. B	B8JAF3	Elongation factor 4	3.83e-06	NA	2.32e-10	NA
7. B	A7GN41	GTPase Der	9.83e-04	NA	0.009	NA
7. B	A4TGY6	Elongation factor G	2.19e-05	NA	8.38e-07	NA
7. B	A6LPP6	Elongation factor Tu	4.16e-07	NA	1.03e-11	NA
7. B	Q71ZK8	GTPase Era	1.24e-03	NA	0.047	NA
7. B	Q1R5U4	Elongation factor Tu 2	5.68e-07	NA	1.17e-13	NA
7. B	Q039K9	Elongation factor Tu	3.49e-07	NA	1.80e-14	NA
7. B	Q23716	Elongation factor 2	6.43e-03	NA	7.41e-07	NA
7. B	C3PPA9	Elongation factor Tu	4.47e-07	NA	2.74e-14	NA
7. B	Q6MEF3	Elongation factor 4	5.00e-06	NA	9.97e-09	NA
7. B	B8NDZ1	Ribosome-releasing factor 2, mitochondrial	1.80e-03	NA	1.09e-06	NA
7. B	Q1JAY1	Peptide chain release factor 3	1.43e-04	NA	3.64e-08	NA
7. B	B2I6P5	Peptide chain release factor 3	1.90e-05	NA	1.64e-05	NA
7. B	B0TM14	Elongation factor Tu	4.75e-07	NA	3.22e-13	NA
7. B	B6I6E1	Sulfate adenylyltransferase subunit 1	6.44e-06	NA	7.09e-05	NA
7. B	B1ICR4	Elongation factor Tu	4.49e-07	NA	8.23e-11	NA
7. B	A3PHQ9	Elongation factor 4	2.71e-06	NA	3.43e-08	NA
7. B	Q0ABH7	Elongation factor Tu	4.99e-07	NA	5.46e-11	NA
7. B	B1LBP2	Elongation factor Tu	3.59e-07	NA	1.64e-12	NA
7. B	Q7Z2Z2	Elongation factor-like GTPase 1	1.94e-02	NA	1.85e-12	NA
7. B	A7MWE9	Sulfate adenylyltransferase subunit 1	1.16e-05	NA	4.86e-06	NA
7. B	P68789	Elongation factor G	1.17e-05	NA	3.56e-08	NA
7. B	C5GRI9	Translation factor GUF1, mitochondrial	5.84e-05	NA	2.69e-06	NA
7. B	A4J5X2	Translation initiation factor IF-2	0.00e+00	NA	0.0	NA
7. B	A5GMR2	Elongation factor 4	1.84e-06	NA	1.12e-10	NA
7. B	P0DA97	GTPase Era	8.76e-04	NA	6.99e-04	NA
7. B	O26859	Uncharacterized protein MTH_765	4.71e-07	NA	1.12e-05	NA
7. B	P60338	Elongation factor Tu-A	5.23e-07	NA	1.10e-12	NA
7. B	Q9ASR1	Elongation factor 2	7.26e-03	NA	5.33e-05	NA
7. B	B5RH09	Elongation factor G	2.48e-05	NA	7.70e-07	NA
7. B	Q8PZA0	Translation initiation factor 2 subunit gamma	2.70e-06	NA	8.18e-08	NA
7. B	B0K8N3	GTPase Der	2.00e-03	NA	0.004	NA
7. B	P09757	Tetracycline resistance protein TetM	1.54e-05	NA	1.00e-10	NA
7. B	Q660Y4	Elongation factor G 1	1.55e-05	NA	1.40e-07	NA
7. B	A4X4N7	Translation initiation factor IF-2	0.00e+00	NA	1.27e-158	NA
7. B	A6TWJ8	Elongation factor Tu 2	4.56e-07	NA	9.76e-07	NA
7. B	B8DN94	Elongation factor G	1.86e-05	NA	7.03e-09	NA
7. B	A3Q2A6	Elongation factor 4	1.39e-05	NA	8.22e-08	NA
7. B	B0UHX2	Elongation factor G	4.70e-05	NA	1.07e-09	NA
7. B	Q0T0B3	Translation initiation factor IF-2	0.00e+00	NA	3.99e-153	NA
7. B	P80868	Elongation factor G	4.32e-06	NA	1.96e-09	NA
7. B	Q5A0M4	Elongation factor 2	2.18e-03	NA	1.73e-06	NA
7. B	B0RU84	Elongation factor Tu 1	4.35e-07	NA	5.32e-09	NA
7. B	B5FAH2	Elongation factor 4	1.04e-06	NA	2.17e-12	NA
7. B	A4VW74	GTPase Era	2.07e-03	NA	4.75e-04	NA
7. B	A6Q241	Elongation factor 4	2.57e-06	NA	2.82e-11	NA
7. B	Q605A9	Elongation factor G 2	2.64e-05	NA	8.68e-08	NA
7. B	B8ELG5	Elongation factor Tu	4.08e-07	NA	1.78e-10	NA
7. B	Q8FNA3	Elongation factor 4	6.04e-06	NA	2.76e-08	NA
7. B	B8E6N9	Peptide chain release factor 3	3.64e-05	NA	2.30e-05	NA
7. B	B5FA93	Peptide chain release factor 3	1.14e-05	NA	1.32e-06	NA
7. B	Q5ZYP6	Elongation factor G	2.05e-05	NA	3.03e-06	NA
7. B	Q3ILP5	Elongation factor G 1	2.58e-05	NA	4.57e-09	NA
7. B	B1MY04	Elongation factor Tu	3.43e-07	NA	1.27e-12	NA
7. B	A1WMW4	Elongation factor 4	6.86e-07	NA	2.58e-08	NA
7. B	A7FZ71	Elongation factor Tu	3.91e-07	NA	1.90e-11	NA
7. B	Q839G9	Elongation factor G	2.41e-05	NA	1.67e-08	NA
7. B	Q2S204	Peptide chain release factor 3	4.92e-05	NA	2.55e-07	NA
7. B	B3P8M3	Ribosome-releasing factor 2, mitochondrial	2.00e-04	NA	0.002	NA
7. B	B8FUP2	Elongation factor 4	9.69e-07	NA	6.47e-11	NA
7. B	B2TMB9	GTPase Era	5.73e-03	NA	0.001	NA
7. B	Q62HK4	Elongation factor G 1	5.39e-05	NA	1.59e-07	NA
7. B	B9M7Q2	Peptide chain release factor 3	6.10e-05	NA	3.12e-08	NA
7. B	B3WE38	Elongation factor Tu	3.70e-07	NA	1.80e-14	NA
7. B	A2SLG0	Elongation factor G	4.12e-05	NA	1.25e-06	NA
7. B	Q4FUV9	Elongation factor 4	1.19e-06	NA	1.49e-08	NA
7. B	B5EI57	Translation initiation factor IF-2	0.00e+00	NA	2.11e-178	NA
7. B	Q1H4P0	Elongation factor G	5.16e-05	NA	7.93e-07	NA
7. B	B8D852	Elongation factor G	2.36e-05	NA	8.86e-08	NA
7. B	B8ZUS2	Elongation factor 4	6.62e-06	NA	7.72e-11	NA
7. B	O81004	GTP-binding protein At2g22870	1.81e-02	NA	0.017	NA
7. B	Q8CPR1	Peptide chain release factor 3	2.05e-05	NA	2.66e-09	NA
7. B	A6X0B5	Elongation factor G	2.85e-05	NA	1.65e-11	NA
7. B	P43927	Selenocysteine-specific elongation factor	1.69e-05	NA	5.04e-09	NA
7. B	B2G6R2	Elongation factor Tu	3.75e-07	NA	1.37e-12	NA
7. B	Q5SKA7	Elongation factor 4	1.09e-06	NA	1.64e-07	NA
7. B	O26361	Translation initiation factor 2 subunit gamma	8.96e-07	NA	6.10e-07	NA
7. B	Q2A5H2	Elongation factor G	1.36e-06	NA	7.88e-09	NA
7. B	Q1J8C9	GTPase Der	1.91e-03	NA	3.06e-05	NA
7. B	B5VN01	Elongation factor G, mitochondrial	1.93e-04	NA	1.91e-09	NA
7. B	A5IM80	Elongation factor G	7.35e-05	NA	4.10e-09	NA
7. B	Q0CUN7	Small COPII coat GTPase sar1	4.31e-04	NA	0.003	NA
7. B	B4U458	GTPase Era	9.97e-04	NA	5.17e-04	NA
7. B	Q4Q3F0	Translation factor GUF1 homolog, mitochondrial	1.52e-04	NA	0.002	NA
7. B	Q7VA04	Elongation factor G	1.18e-05	NA	8.63e-10	NA
7. B	Q4FVL5	Translation initiation factor IF-2	0.00e+00	NA	1.61e-150	NA
7. B	C0M937	Elongation factor G	2.32e-05	NA	1.43e-08	NA
7. B	A8FKQ5	Elongation factor Tu	4.57e-07	NA	3.25e-11	NA
7. B	P0CT17	Small COPII coat GTPase SAR1	4.90e-04	NA	0.035	NA
7. B	B6I240	Elongation factor G	2.38e-05	NA	1.30e-07	NA
7. B	P34811	Elongation factor G-1, chloroplastic	1.34e-04	NA	6.17e-07	NA
7. B	A5D5K0	Elongation factor Tu 1	5.69e-07	NA	5.88e-11	NA
7. B	Q1R5U3	Elongation factor G	2.52e-05	NA	1.30e-07	NA
7. B	Q6DB76	Probable GTP-binding protein EngB	3.08e-05	NA	0.001	NA
7. B	A0Q874	Elongation factor Tu	5.34e-07	NA	2.69e-13	NA
7. B	P49410	Elongation factor Tu, mitochondrial	2.48e-06	NA	4.83e-08	NA
7. B	Q182C3	GTPase Era	2.69e-03	NA	0.047	NA
7. B	Q4K530	Elongation factor G	6.30e-05	NA	6.33e-08	NA
7. B	A9N205	GTPase Der	4.21e-03	NA	0.018	NA
7. B	B8ZRT4	Translation initiation factor IF-2	0.00e+00	NA	4.48e-152	NA
7. B	Q4URD6	Elongation factor G	6.74e-06	NA	1.12e-07	NA
7. B	Q39Y08	Elongation factor Tu	5.30e-07	NA	9.52e-12	NA
7. B	O66429	Elongation factor Tu	3.97e-07	NA	2.57e-09	NA
7. B	Q89A56	Peptide chain release factor 3	8.19e-05	NA	1.45e-08	NA
7. B	Q8ZJB2	Elongation factor Tu-A	5.33e-07	NA	9.03e-13	NA
7. B	Q08425	Tetracycline resistance protein TetQ	2.26e-05	NA	7.37e-07	NA
7. B	Q54R04	ADP-ribosylation factor-like protein 8	3.46e-06	NA	0.021	NA
7. B	A8FM79	Elongation factor 4	3.07e-06	NA	2.40e-09	NA
7. B	Q895X8	GTPase Der	1.30e-03	NA	4.79e-04	NA
7. B	O50565	Elongation factor G	5.27e-05	NA	1.52e-06	NA
7. B	B1HMZ0	Elongation factor Tu	4.54e-07	NA	5.45e-13	NA
7. B	Q1CCT9	Elongation factor Tu 2	5.30e-07	NA	9.03e-13	NA
7. B	A8QCE7	Translation factor GUF1 homolog, mitochondrial	1.23e-04	NA	2.14e-08	NA
7. B	B0TQ95	Peptide chain release factor 3	1.10e-05	NA	1.38e-06	NA
7. B	C4ZZQ5	Sulfate adenylyltransferase subunit 1	5.71e-06	NA	4.12e-04	NA
7. B	Q1IFW8	Elongation factor Tu	4.73e-07	NA	2.57e-08	NA
7. B	B8H8S3	Elongation factor 4	3.63e-06	NA	8.61e-12	NA
7. B	P42475	Elongation factor Tu	3.98e-07	NA	2.37e-13	NA
7. B	A5UCY6	Probable GTP-binding protein EngB	4.95e-05	NA	0.050	NA
7. B	Q72QU8	Elongation factor 4	4.25e-06	NA	1.23e-07	NA
7. B	P85834	Elongation factor Tu, mitochondrial	4.95e-06	NA	2.69e-08	NA
7. B	Q83PF4	Probable GTP-binding protein EngB	2.86e-05	NA	0.010	NA
7. B	P33159	Elongation factor 2	1.30e-04	NA	9.81e-09	NA
7. B	A3N8V8	Translation initiation factor IF-2	0.00e+00	NA	1.53e-168	NA
7. B	A6KYJ7	Elongation factor G	6.85e-05	NA	1.94e-07	NA
7. B	Q2U3T4	Translation factor guf1, mitochondrial	2.73e-05	NA	6.57e-06	NA
7. B	P41091	Eukaryotic translation initiation factor 2 subunit 3	5.42e-06	NA	0.023	NA
7. B	Q0AUG3	Elongation factor Tu 2	5.20e-07	NA	5.59e-12	NA
7. B	A0PM41	Elongation factor G	1.00e-04	NA	2.49e-09	NA
7. B	A3D7J9	Peptide chain release factor 3	1.16e-05	NA	2.22e-05	NA
7. B	Q0BEX1	GTPase Der	3.04e-03	NA	0.042	NA
7. B	B1JDW6	Elongation factor Tu	5.22e-07	NA	7.09e-09	NA
7. B	Q90705	Elongation factor 2	5.42e-03	NA	5.22e-05	NA
7. B	Q7VJZ1	Elongation factor 4	8.66e-07	NA	5.64e-09	NA
7. B	Q9X1V8	Elongation factor 4	4.59e-06	NA	5.69e-06	NA
7. B	B6I583	GTPase Der	2.85e-03	NA	0.025	NA
7. B	B7VBK5	Peptide chain release factor 3	3.46e-05	NA	1.11e-06	NA
7. B	Q31IY4	Elongation factor Tu	4.93e-07	NA	8.36e-10	NA
7. B	O60841	Eukaryotic translation initiation factor 5B	3.33e-08	NA	4.02e-22	NA
7. B	Q74M52	Elongation factor 2	3.01e-04	NA	8.20e-08	NA
7. B	Q8PNS6	Elongation factor G	2.41e-05	NA	8.29e-08	NA
7. B	B7MTC0	Peptide chain release factor 3	1.13e-05	NA	1.26e-07	NA
7. B	B5RDQ7	Sulfate adenylyltransferase subunit 1	8.26e-05	NA	2.79e-05	NA
7. B	P0C583	Small COPII coat GTPase sar1	4.39e-04	NA	0.002	NA
7. B	P13550	Elongation factor G	3.08e-05	NA	9.46e-10	NA
7. B	Q8G603	Elongation factor 4	4.64e-05	NA	2.35e-09	NA
7. B	C1CM45	GTPase Der	1.97e-03	NA	6.10e-06	NA
7. B	B7K3Z7	Elongation factor 4	5.85e-07	NA	7.02e-11	NA
7. B	P26751	Elongation factor 1-alpha	2.68e-06	NA	1.01e-04	NA
7. B	C4Z2R9	Elongation factor Tu	5.62e-07	NA	2.10e-12	NA
7. B	B1LNG6	GTPase Der	3.05e-03	NA	0.025	NA
7. B	Q0BSG5	Elongation factor G	1.29e-05	NA	8.37e-09	NA
7. B	Q97SE4	Peptide chain release factor 3	2.24e-05	NA	2.34e-07	NA
7. B	A7NR66	Elongation factor G	2.47e-05	NA	7.71e-06	NA
7. B	Q8DBT6	Peptide chain release factor 3	3.07e-05	NA	2.41e-06	NA
7. B	Q57J26	Elongation factor G	1.99e-05	NA	7.70e-07	NA
7. B	A4JEN6	GTPase Der	4.05e-03	NA	0.025	NA
7. B	P68158	Elongation factor Tu, chloroplastic	6.50e-06	NA	1.09e-09	NA
7. B	Q0HNT9	Elongation factor Tu 2	5.19e-07	NA	1.36e-12	NA
7. B	Q7UX15	Elongation factor 4 1	8.41e-07	NA	3.41e-08	NA
7. B	Q9JVH7	Peptide chain release factor 3	2.33e-05	NA	8.34e-07	NA
7. B	A7N9S4	Elongation factor G	1.41e-06	NA	7.48e-09	NA
7. B	Q6L202	Elongation factor 1-alpha	4.36e-07	NA	0.001	NA
7. B	Q2IXR2	Elongation factor Tu	4.81e-07	NA	1.58e-12	NA
7. B	Q5L3Z9	Elongation factor Tu	3.14e-07	NA	8.65e-14	NA
7. B	B7NDU8	Elongation factor G	2.32e-05	NA	1.46e-07	NA
7. B	P13442	Bifunctional enzyme NodQ	1.63e-03	NA	0.003	NA
7. B	Q73PN3	Elongation factor Tu	5.85e-07	NA	2.44e-11	NA
7. B	Q034X8	Elongation factor G	7.74e-05	NA	6.44e-09	NA
7. B	Q2GFN6	Elongation factor Tu	5.50e-06	NA	4.40e-09	NA
7. B	B6IZ00	GTPase Era	1.20e-03	NA	0.029	NA
7. B	C1EN01	GTPase Der	9.62e-04	NA	0.016	NA
7. B	B0KQD8	Peptide chain release factor 3	3.97e-05	NA	3.37e-07	NA
7. B	P33171	Elongation factor Tu	3.37e-07	NA	5.76e-10	NA
7. B	Q8UE15	Elongation factor G	5.36e-05	NA	6.74e-11	NA
7. B	A8ANW5	Sulfate adenylyltransferase subunit 1	6.24e-06	NA	2.55e-05	NA
7. B	A8F0P0	Elongation factor G	2.74e-05	NA	2.04e-08	NA
7. B	Q8RB50	GTPase Era	2.78e-03	NA	1.75e-06	NA
7. B	B9MS56	GTPase Era	2.32e-03	NA	0.008	NA
7. B	B0CS18	Translation factor GUF1, mitochondrial	3.78e-06	NA	9.72e-09	NA
7. B	B1IS45	Peptide chain release factor 3	9.85e-06	NA	1.18e-07	NA
7. B	Q01475	Small COPII coat GTPase sar1	4.73e-04	NA	0.047	NA
7. B	O67618	Elongation factor 4	2.76e-06	NA	5.32e-13	NA
7. B	Q4L3K9	Elongation factor Tu	3.97e-07	NA	1.92e-12	NA
7. B	B5E1P9	Peptide chain release factor 3	NA	NA	3.90e-07	NA
7. B	B1MW21	Elongation factor G	2.56e-05	NA	5.16e-09	NA
7. B	A7FXK1	GTPase Era	9.06e-04	NA	3.31e-05	NA
7. B	Q2S909	Elongation factor G 1	3.84e-05	NA	5.14e-09	NA
7. B	Q7NAV3	Elongation factor G	2.43e-05	NA	9.55e-11	NA
7. B	P0A3C3	GTPase Era	2.74e-03	NA	1.86e-04	NA
7. B	A4W3F7	GTPase Der	1.90e-03	NA	4.72e-05	NA
7. B	A4FM34	Translation initiation factor IF-2	0.00e+00	NA	2.15e-157	NA
7. B	B1VGK6	Elongation factor 4	5.88e-06	NA	7.46e-08	NA
7. B	Q057A1	Elongation factor G	4.34e-05	NA	1.59e-08	NA
7. B	P0A1H4	Elongation factor G	2.55e-05	NA	7.70e-07	NA
7. B	B4TU33	Peptide chain release factor 3	1.11e-05	NA	1.28e-07	NA
7. B	B8B2R1	Translation factor GUF1 homolog, mitochondrial	1.00e-05	NA	3.58e-10	NA
7. B	Q88QN7	Elongation factor Tu-B	5.47e-07	NA	2.57e-08	NA
7. B	A3LWR2	Ribosome-releasing factor 2, mitochondrial	6.13e-04	NA	4.93e-10	NA
7. B	Q9KU80	Translation initiation factor IF-2	0.00e+00	NA	2.12e-161	NA
7. B	A1RXH6	Probable translation initiation factor IF-2	7.21e-11	NA	1.18e-29	NA
7. B	A8G1F0	Elongation factor Tu	4.73e-07	NA	4.18e-13	NA
7. B	Q0TA85	Elongation factor Tu 2	6.10e-07	NA	1.17e-13	NA
7. B	A8GYW2	Elongation factor Tu	5.17e-07	NA	4.25e-13	NA
7. B	B0UV21	Elongation factor Tu	4.93e-07	NA	1.84e-14	NA
7. B	A7RR04	Elongation factor G, mitochondrial	2.26e-04	NA	6.54e-11	NA
7. B	Q6MMS6	Translation initiation factor IF-2	0.00e+00	NA	1.50e-160	NA
7. B	A5UBE8	Peptide chain release factor 3	9.37e-06	NA	2.10e-06	NA
7. B	B6JET1	Elongation factor Tu	4.18e-07	NA	1.76e-12	NA
7. B	Q5XB97	Peptide chain release factor 3	1.52e-04	NA	3.77e-08	NA
7. B	B5Z6P0	GTPase Era	2.00e-03	NA	0.012	NA
7. B	Q06SH3	Elongation factor Tu, chloroplastic	4.00e-07	NA	6.65e-10	NA
7. B	P72533	Tetracycline resistance protein TetO	3.98e-05	NA	5.14e-11	NA
7. B	Q1QN33	Elongation factor G	3.82e-06	NA	1.23e-09	NA
7. B	B0WGM1	Elongation factor G, mitochondrial	2.43e-04	NA	1.38e-11	NA
7. B	A5VXN3	Elongation factor Tu	5.39e-07	NA	7.09e-09	NA
7. B	A1AJU2	Peptide chain release factor 3	1.04e-05	NA	1.31e-07	NA
7. B	Q6AP86	Elongation factor Tu 1	4.57e-07	NA	3.18e-14	NA
7. B	A2RG20	GTPase Era	8.25e-04	NA	6.99e-04	NA
7. B	Q6AJD2	Peptide chain release factor 3	4.37e-05	NA	2.77e-09	NA
7. B	Q3IUD8	Elongation factor 1-alpha	9.15e-06	NA	1.23e-07	NA
7. B	Q1MQY8	Translation initiation factor IF-2	0.00e+00	NA	5.56e-165	NA
7. B	B5RMK6	GTPase Era	1.28e-04	NA	0.044	NA
7. B	Q110K2	Peptide chain release factor 3	1.18e-04	NA	2.25e-10	NA
7. B	Q9PKX6	Elongation factor 4	3.03e-06	NA	1.43e-07	NA
7. B	Q250N4	Elongation factor Tu	4.67e-07	NA	3.67e-14	NA
7. B	Q0BFY3	Translation initiation factor IF-2	0.00e+00	NA	6.77e-169	NA
7. B	Q1D7V1	Elongation factor Tu 1	4.05e-07	NA	4.60e-14	NA
7. B	Q2S1N7	Translation initiation factor IF-2	0.00e+00	NA	2.54e-160	NA
7. B	Q9CHH6	GTPase Der	1.23e-03	NA	0.032	NA
7. B	A6T0Y8	Translation initiation factor IF-2	0.00e+00	NA	9.86e-168	NA
7. B	A4TQJ9	Peptide chain release factor 3	1.18e-05	NA	7.37e-07	NA
7. B	Q9Y450	HBS1-like protein	1.14e-03	NA	0.007	NA
7. B	A8HTW6	Elongation factor Tu	5.21e-07	NA	1.68e-12	NA
7. B	Q92R46	GTPase Era	1.74e-03	NA	0.017	NA
7. B	B9IZJ2	Elongation factor Tu	3.19e-07	NA	3.13e-14	NA
7. B	Q2SDW8	GTPase Der	5.33e-03	NA	0.016	NA
7. B	Q57KJ0	Sulfate adenylyltransferase subunit 1	9.76e-05	NA	4.18e-06	NA
7. B	Q1CN86	Elongation factor Tu 1	4.62e-07	NA	2.06e-13	NA
7. B	P02991	Elongation factor Tu, chloroplastic	4.16e-07	NA	5.97e-13	NA
7. B	Q46455	Selenocysteine-specific elongation factor	2.72e-05	NA	1.52e-13	NA
7. B	Q3AHW1	Translation initiation factor IF-2	0.00e+00	NA	2.97e-156	NA
7. B	A8AQM8	Elongation factor G	2.36e-05	NA	1.41e-06	NA
7. B	Q2JUX5	Elongation factor G	9.23e-06	NA	2.06e-06	NA
7. B	Q7MGR1	Elongation factor Tu 2	4.28e-07	NA	1.41e-12	NA
7. B	Q7UZY7	Elongation factor Tu	3.04e-07	NA	7.54e-10	NA
7. B	Q39Z86	Peptide chain release factor 3	6.94e-05	NA	7.38e-09	NA
7. B	O29663	Translation initiation factor 2 subunit gamma	8.47e-05	NA	1.55e-06	NA
7. B	Q8UGK1	GTPase Era	7.25e-04	NA	0.049	NA
7. B	A9S3D3	Translation factor GUF1 homolog, mitochondrial	7.12e-06	NA	4.20e-09	NA
7. B	B9DRF9	GTPase Era	2.16e-03	NA	0.001	NA
7. B	Q9PD78	Bifunctional enzyme CysN/CysC	4.94e-05	NA	0.002	NA
7. B	Q8K948	Elongation factor G	2.21e-05	NA	5.72e-09	NA
7. B	B9W9T4	Elongation factor G, mitochondrial	5.86e-05	NA	5.60e-09	NA
7. B	C7ZA26	Translation factor GUF1, mitochondrial	7.42e-05	NA	1.17e-06	NA
7. B	B8ZKU0	Elongation factor G	6.79e-05	NA	1.79e-09	NA
7. B	B4RQX2	Elongation factor G	2.87e-05	NA	5.49e-07	NA
7. B	A1WXV1	Translation initiation factor IF-2	0.00e+00	NA	7.44e-159	NA
7. B	B6YQ04	Elongation factor Tu	3.72e-07	NA	1.81e-12	NA
7. B	Q9Z5I9	Translation initiation factor IF-2	0.00e+00	NA	4.48e-152	NA
7. B	Q3AWX3	Elongation factor 4	1.81e-06	NA	5.02e-10	NA
7. B	Q5R8Z3	Elongation factor 2	5.26e-03	NA	5.88e-05	NA
7. B	Q9YAV0	Elongation factor 1-alpha	5.76e-07	NA	3.35e-04	NA
7. B	Q2G5E7	Translation initiation factor IF-2	0.00e+00	NA	1.74e-144	NA
7. B	B2VG01	Sulfate adenylyltransferase subunit 1	6.53e-06	NA	6.57e-05	NA
7. B	B3L3C9	Translation factor GUF1 homolog, mitochondrial	3.12e-04	NA	2.75e-05	NA
7. B	Q5PIW4	Elongation factor Tu	4.60e-07	NA	2.67e-13	NA
7. B	A5DWY7	Translation factor GUF1, mitochondrial	6.52e-05	NA	0.004	NA
7. B	O74718	Eukaryotic peptide chain release factor GTP-binding subunit	3.59e-04	NA	0.007	NA
7. B	Q0HMD9	Elongation factor G 2	7.83e-05	NA	2.80e-07	NA
7. B	B2JIU7	GTPase Der	2.32e-03	NA	0.013	NA
7. B	A6LLL1	Elongation factor Tu	4.53e-07	NA	7.22e-13	NA
7. B	Q9JV65	Elongation factor 4	1.13e-06	NA	2.13e-10	NA
7. B	Q0ID59	Elongation factor Tu	3.53e-07	NA	2.71e-08	NA
7. B	Q5LUS0	Elongation factor 4	8.30e-07	NA	3.08e-05	NA
7. B	Q8ZBC2	Translation initiation factor IF-2	0.00e+00	NA	6.38e-154	NA
7. B	Q69ZS7	HBS1-like protein	5.84e-04	NA	0.016	NA
7. B	C1AL17	Elongation factor G	1.07e-05	NA	7.02e-08	NA
7. B	Q5F5Q8	Elongation factor Tu	4.26e-07	NA	4.04e-10	NA
7. B	A5IRJ6	Peptide chain release factor 3	2.04e-05	NA	2.03e-09	NA
7. B	B2TZQ6	Peptide chain release factor 3	1.12e-05	NA	1.18e-07	NA
7. B	P50379	Elongation factor Tu, chloroplastic (Fragment)	1.88e-07	NA	7.49e-05	NA
7. B	Q15029	116 kDa U5 small nuclear ribonucleoprotein component	1.59e-02	NA	3.17e-07	NA
7. B	Q6MJ13	Elongation factor G 1	2.35e-04	NA	3.74e-08	NA
7. B	B7HJ46	Elongation factor Tu	3.21e-07	NA	2.96e-14	NA
7. B	P64088	GTPase Era	8.79e-04	NA	6.99e-04	NA
7. B	A9MT05	Elongation factor Tu	3.99e-07	NA	2.67e-13	NA
7. B	A7NS01	Elongation factor Tu 2	6.43e-07	NA	1.12e-10	NA
7. B	A1RH82	Peptide chain release factor 3	3.02e-05	NA	2.19e-05	NA
7. B	A1AIF3	Elongation factor Tu 2	5.55e-07	NA	1.17e-13	NA
7. B	A4XQE4	Peptide chain release factor 3	2.85e-05	NA	5.33e-07	NA
7. B	P64023	Elongation factor G	6.12e-05	NA	2.02e-09	NA
7. B	D3E3N9	Elongation factor 2	7.81e-05	NA	3.37e-05	NA
7. B	A8FSD4	Elongation factor 4	1.32e-05	NA	1.47e-10	NA
7. B	Q6MU81	Elongation factor Tu	5.41e-07	NA	1.44e-13	NA
7. B	Q5HRK4	Elongation factor Tu	3.97e-07	NA	1.68e-12	NA
7. B	B8HD12	Elongation factor G	4.55e-05	NA	1.49e-09	NA
7. B	Q39T84	GTPase Era	2.86e-04	NA	3.17e-04	NA
7. B	A0B7D5	Elongation factor 2	3.79e-05	NA	5.69e-05	NA
7. B	Q47CH1	Peptide chain release factor 3	9.87e-05	NA	3.33e-07	NA
7. B	Q6KHP1	Elongation factor 4	3.51e-06	NA	1.10e-10	NA
7. B	C5PCH4	Translation factor GUF1, mitochondrial	5.17e-05	NA	2.78e-07	NA
7. B	A1VA24	Peptide chain release factor 3	6.91e-05	NA	1.05e-06	NA
7. B	Q8Z0U8	Peptide chain release factor 3	1.03e-05	NA	1.31e-07	NA
7. B	B6YW69	Translation initiation factor 2 subunit gamma	1.84e-06	NA	2.16e-11	NA
7. B	Q23445	GTP-binding protein SAR1	3.60e-03	NA	0.046	NA
7. B	C3PKP2	Elongation factor Tu	4.90e-07	NA	7.59e-08	NA
7. B	A9BCK0	Elongation factor Tu	3.01e-07	NA	2.16e-10	NA
7. B	A2SH40	Translation initiation factor IF-2	0.00e+00	NA	7.56e-167	NA
7. B	A5USJ1	Elongation factor Tu 1	6.33e-07	NA	1.17e-10	NA
7. B	C1CXH0	Elongation factor G	1.86e-05	NA	2.00e-05	NA
7. B	A4IXZ5	Sulfate adenylyltransferase subunit 1	2.94e-05	NA	7.25e-04	NA
7. B	A9ITX6	Translation initiation factor IF-2	0.00e+00	NA	6.21e-152	NA
7. B	Q46497	Selenocysteine-specific elongation factor	6.96e-05	NA	1.62e-12	NA
7. B	Q8G3Y5	Translation initiation factor IF-2	0.00e+00	NA	2.35e-161	NA
7. B	Q5P409	Peptide chain release factor 3	3.23e-05	NA	3.01e-07	NA
7. B	Q7VDF7	Elongation factor 4	1.84e-06	NA	1.38e-10	NA
7. B	Q4DZ91	Translation factor GUF1 homolog 2, mitochondrial	1.32e-04	NA	3.58e-05	NA
7. B	Q5WLR4	Elongation factor Tu	3.41e-07	NA	1.74e-12	NA
7. B	A2S2A6	GTPase Der	4.84e-03	NA	0.024	NA
7. B	A6LE88	Elongation factor Tu	3.60e-07	NA	8.31e-13	NA
7. B	Q28WF7	Translation initiation factor IF-2	0.00e+00	NA	1.38e-150	NA
7. B	Q055E6	Elongation factor Tu	3.50e-07	NA	1.62e-14	NA
7. B	Q1JG54	Peptide chain release factor 3	3.38e-05	NA	5.77e-08	NA
7. B	B0UFE0	Elongation factor 4	9.35e-07	NA	1.50e-08	NA
7. B	C5C0J3	Elongation factor Tu	5.23e-07	NA	9.11e-06	NA
7. B	A2BYN4	Elongation factor Tu	3.11e-07	NA	2.00e-09	NA
7. B	B0BWA2	Elongation factor G	6.65e-05	NA	1.72e-08	NA
7. B	Q31XB3	Sulfate adenylyltransferase subunit 1	2.31e-05	NA	4.27e-04	NA
7. B	Q2SU24	Elongation factor G 2	4.29e-05	NA	5.13e-07	NA
7. B	A8F4Q9	Elongation factor Tu	5.14e-07	NA	1.39e-13	NA
7. B	Q39KI2	Elongation factor Tu	4.85e-07	NA	3.83e-11	NA
7. B	B1JT88	GTPase Der	6.53e-03	NA	0.023	NA
7. B	P0A6M8	Elongation factor G	2.33e-05	NA	1.30e-07	NA
7. B	A5ULM5	Elongation factor 1-alpha	3.19e-06	NA	6.46e-11	NA
7. B	Q1RHC3	Elongation factor G	5.80e-05	NA	6.77e-09	NA
7. B	Q07KJ2	Elongation factor Tu	4.32e-07	NA	1.43e-12	NA
7. B	B8DUL6	Elongation factor 4	4.57e-06	NA	4.66e-10	NA
7. B	B9IVM6	GTPase Der	9.31e-04	NA	0.016	NA
7. B	A4WVL1	Elongation factor G	2.55e-05	NA	6.74e-08	NA
7. B	Q3YRK7	Elongation factor Tu	5.04e-06	NA	3.85e-09	NA
7. B	P64027	Elongation factor Tu	4.13e-07	NA	4.37e-10	NA
7. B	A5B4D2	Translation factor GUF1 homolog, chloroplastic	NA	NA	4.08e-09	NA
7. B	B3E422	GTPase Era	4.21e-03	NA	0.046	NA
7. B	Q4ZMP1	Elongation factor G	3.11e-05	NA	5.71e-08	NA
7. B	B4RTW4	Sulfate adenylyltransferase subunit 1	3.54e-05	NA	0.001	NA
7. B	B2SFC9	Elongation factor Tu	5.50e-07	NA	2.69e-13	NA
7. B	A6U0C5	Peptide chain release factor 3	1.87e-05	NA	2.03e-09	NA
7. B	Q5KWZ3	Elongation factor 4	6.50e-06	NA	5.59e-13	NA
7. B	Q8PJ55	Translation initiation factor IF-2	0.00e+00	NA	1.58e-156	NA
7. B	Q9TLV8	Elongation factor Tu, chloroplastic	2.99e-07	NA	1.30e-10	NA
7. B	B2JYK5	Probable GTP-binding protein EngB	3.61e-05	NA	0.006	NA
7. B	B2TXT6	GTPase Der	3.53e-03	NA	0.006	NA
7. B	A7TFN8	Elongation factor G, mitochondrial	4.09e-05	NA	1.05e-08	NA
7. B	Q74IS8	Translation initiation factor IF-2	0.00e+00	NA	0.0	NA
7. B	Q8Y422	Elongation factor Tu	3.85e-07	NA	1.86e-13	NA
7. B	A5ELM9	Elongation factor Tu	4.41e-07	NA	9.87e-12	NA
7. B	Q1Q8P1	Elongation factor G	8.17e-05	NA	1.29e-07	NA
7. B	P61877	Elongation factor 2	5.51e-05	NA	7.49e-11	NA
7. B	Q54807	Tetracycline resistance protein TetM from transposon Tn5251	2.01e-05	NA	9.11e-11	NA
7. B	Q72I01	Elongation factor G	4.99e-05	NA	5.23e-07	NA
7. B	A5FQQ5	Elongation factor Tu	5.63e-07	NA	2.27e-09	NA
7. B	Q9KUZ6	Elongation factor Tu-B	4.17e-07	NA	3.40e-14	NA
7. B	Q88QN8	Elongation factor G 1	7.72e-06	NA	6.73e-08	NA
7. B	Q30TQ5	Elongation factor Tu	4.25e-07	NA	2.26e-11	NA
7. B	Q8UE16	Elongation factor Tu	3.99e-07	NA	2.51e-10	NA
7. B	Q2RFP4	Elongation factor G	2.87e-06	NA	1.85e-08	NA
7. B	A6T3K6	Elongation factor Tu	4.20e-07	NA	1.32e-11	NA
7. B	A4J3P1	GTPase Der	3.27e-03	NA	0.035	NA
7. B	B1XY67	Translation initiation factor IF-2	0.00e+00	NA	7.23e-161	NA
7. B	Q464Z3	Elongation factor 2	3.93e-05	NA	5.46e-06	NA
7. B	A1AMM1	Translation initiation factor IF-2	0.00e+00	NA	7.66e-178	NA
7. B	A3CXM8	Elongation factor 2	4.19e-05	NA	4.22e-06	NA
7. B	A5VR08	Elongation factor Tu	4.22e-07	NA	7.09e-11	NA
7. B	Q8DK04	Translation initiation factor IF-2	0.00e+00	NA	4.73e-159	NA
7. B	Q0HNU0	Elongation factor G 1	2.64e-05	NA	9.40e-09	NA
7. B	Q5E7H2	Elongation factor G 2	5.64e-05	NA	7.29e-06	NA
7. B	A9MN39	Elongation factor G	1.96e-05	NA	8.04e-07	NA
7. B	B4PMC6	Ribosome-releasing factor 2, mitochondrial	8.65e-05	NA	0.002	NA
7. B	B2ILY0	Peptide chain release factor 3	6.28e-05	NA	2.16e-07	NA
7. B	Q4JWS1	Elongation factor 4	5.65e-06	NA	6.13e-07	NA
7. B	C4LL63	Elongation factor Tu	4.31e-07	NA	2.36e-06	NA
7. B	B4HY41	Elongation factor G, mitochondrial	4.40e-04	NA	1.73e-10	NA
7. B	A5GRE6	Elongation factor 4	1.87e-06	NA	2.00e-09	NA
7. B	Q4L3K8	Elongation factor G	1.22e-05	NA	7.04e-09	NA
7. B	Q4FQG5	Elongation factor G	9.16e-05	NA	1.31e-07	NA
7. B	A5VTB2	Translation initiation factor IF-2	0.00e+00	NA	1.17e-158	NA
7. B	Q5PBH1	Elongation factor Tu	4.90e-06	NA	1.42e-06	NA
7. B	Q7M8H5	Elongation factor 4	1.85e-06	NA	9.98e-09	NA
7. B	Q8TRC4	Elongation factor 1-alpha	1.47e-06	NA	1.14e-08	NA
7. B	B8DLL9	Elongation factor Tu	4.32e-07	NA	8.68e-12	NA
7. B	P0A6N3	Elongation factor Tu	5.89e-07	NA	1.17e-13	NA
7. B	B4EAW5	GTPase Der	1.25e-03	NA	0.023	NA
7. B	Q9UZK7	Probable translation initiation factor IF-2	2.86e-06	NA	1.86e-27	NA
7. B	B0C9R9	Elongation factor 4	1.44e-06	NA	1.45e-13	NA
7. B	Q1GP96	Elongation factor G	2.02e-05	NA	8.45e-06	NA
7. B	A5DB27	Ribosome-releasing factor 2, mitochondrial	7.94e-04	NA	9.15e-11	NA
7. B	Q754C8	Elongation factor 2	6.10e-03	NA	9.03e-06	NA
7. B	Q8N442	Translation factor GUF1, mitochondrial	1.45e-05	NA	1.96e-10	NA
7. B	Q5XDR3	GTPase Der	1.72e-03	NA	3.51e-05	NA
7. B	A6V0K2	Peptide chain release factor 3	3.82e-05	NA	1.22e-06	NA
7. B	A5F904	Peptide chain release factor 3	1.18e-05	NA	2.16e-06	NA
7. B	Q0BNS9	Elongation factor G	1.43e-06	NA	7.88e-09	NA
7. B	Q0T1I2	Sulfate adenylyltransferase subunit 1	6.35e-05	NA	2.91e-04	NA
7. B	B6Q1T9	Ribosome-releasing factor 2, mitochondrial	7.08e-04	NA	2.11e-06	NA
7. B	Q32CV2	Elongation factor 4	9.17e-07	NA	1.22e-09	NA
7. B	P29542	Elongation factor Tu-1	4.75e-07	NA	2.11e-09	NA
7. B	Q8XRM7	Elongation factor G 2	2.82e-05	NA	3.73e-07	NA
7. B	A6L744	Elongation factor 4	2.77e-06	NA	2.63e-06	NA
7. B	Q5BB57	Ribosome-releasing factor 2, mitochondrial	1.12e-03	NA	4.10e-07	NA
7. B	Q1GK42	Elongation factor G	1.08e-04	NA	1.33e-08	NA
7. B	B7IT17	Elongation factor Tu	4.18e-07	NA	3.10e-14	NA
7. B	Q5M5I8	Elongation factor Tu	4.50e-07	NA	1.96e-11	NA
7. B	B3PDM5	GTPase Der	7.54e-03	NA	0.025	NA
7. B	Q7TT91	Elongation factor Tu	4.75e-07	NA	1.28e-12	NA
7. B	A1ST27	Sulfate adenylyltransferase subunit 1	4.35e-05	NA	3.22e-05	NA
7. B	B5XJW0	GTPase Der	1.64e-03	NA	3.51e-05	NA
7. B	Q3SVT1	Elongation factor 4	2.49e-06	NA	6.43e-07	NA
7. B	A5G692	GTPase Der	4.89e-03	NA	0.019	NA
7. B	Q9TMM9	Elongation factor Tu, apicoplast	4.62e-07	NA	4.21e-11	NA
7. B	Q73SD2	Elongation factor G	4.98e-05	NA	2.41e-09	NA
7. B	Q38VL2	Peptide chain release factor 3	9.51e-06	NA	8.21e-10	NA
7. B	B7NLP5	Elongation factor G	2.60e-05	NA	1.30e-07	NA
7. B	A1AVJ7	Elongation factor G	3.04e-05	NA	1.39e-08	NA
7. B	C1CPU9	Peptide chain release factor 3	5.76e-05	NA	2.12e-07	NA
7. B	Q59P53	Translation factor GUF1, mitochondrial	1.96e-05	NA	8.55e-05	NA
7. B	Q4URD7	Elongation factor Tu 1	4.48e-07	NA	4.54e-09	NA
7. B	Q6F823	Peptide chain release factor 3	1.20e-05	NA	9.48e-06	NA
7. B	Q39T85	GTPase Der	4.04e-03	NA	0.006	NA
7. B	Q2JMX7	Elongation factor Tu	3.83e-07	NA	5.29e-09	NA
7. B	P32324	Elongation factor 2	5.77e-03	NA	4.18e-06	NA
7. B	P50065	Elongation factor Tu (Fragment)	7.84e-07	NA	0.007	NA
7. B	B1KZM3	GTPase Era	9.83e-04	NA	5.76e-05	NA
7. B	Q0SS66	GTPase Der	9.36e-04	NA	1.89e-04	NA
7. B	Q39US7	Elongation factor 4	2.51e-06	NA	2.24e-08	NA
7. B	Q10251	Eukaryotic translation initiation factor 5B	4.21e-09	NA	1.06e-22	NA
7. B	B7N699	GTPase Der	4.41e-03	NA	0.025	NA
7. B	A4IW92	Elongation factor Tu	5.05e-07	NA	2.69e-13	NA
7. B	A3CQM2	Elongation factor G	2.57e-05	NA	1.93e-09	NA
7. B	Q2G8Y2	Elongation factor Tu	3.04e-07	NA	1.11e-10	NA
7. B	Q67NS9	GTPase Der	1.83e-03	NA	0.001	NA
7. B	A1V6B9	Elongation factor 4	1.29e-06	NA	5.27e-09	NA
7. B	Q03Q83	Peptide chain release factor 3	3.50e-05	NA	4.42e-10	NA
7. B	Q21M89	Elongation factor G 1	4.55e-05	NA	3.61e-08	NA
7. B	A6WHR4	Elongation factor Tu	4.71e-07	NA	4.74e-13	NA
7. B	Q82T70	Elongation factor G	6.31e-05	NA	1.12e-08	NA
7. B	Q5R797	Eukaryotic translation initiation factor 2 subunit 3	7.66e-07	NA	0.023	NA
7. B	Q7VTD5	Elongation factor G	4.52e-05	NA	7.95e-07	NA
7. B	Q46WC7	Elongation factor Tu	4.13e-07	NA	4.42e-13	NA
7. B	A7HM54	Elongation factor Tu	3.90e-07	NA	4.35e-14	NA
7. B	A2RP72	Elongation factor G	1.46e-05	NA	3.70e-09	NA
7. B	Q8PUR8	Elongation factor 1-alpha	1.43e-06	NA	0.003	NA
7. B	Q0TEX4	GTPase Der	5.47e-03	NA	0.030	NA
7. B	A5U071	Elongation factor Tu	4.59e-07	NA	2.16e-09	NA
7. B	Q9K055	Elongation factor 4	7.54e-07	NA	2.17e-10	NA
7. B	A8AYN4	Peptide chain release factor 3	1.98e-05	NA	2.40e-07	NA
7. B	A6VGV6	Elongation factor 1-alpha	5.21e-07	NA	0.015	NA
7. B	P30925	Elongation factor 2	5.00e-04	NA	2.51e-08	NA
7. B	P40173	Elongation factor G 1	2.37e-05	NA	9.78e-08	NA
7. B	Q3YU19	Peptide chain release factor 3	9.19e-06	NA	1.18e-07	NA
7. B	Q1JCT6	Elongation factor Tu	4.50e-07	NA	4.01e-13	NA
7. B	Q975N8	Translation initiation factor 2 subunit gamma	1.06e-05	NA	3.25e-08	NA
7. B	Q2RIV4	GTPase Der	1.21e-03	NA	0.006	NA
7. B	B8I5N7	Elongation factor G	2.19e-05	NA	3.20e-07	NA
7. B	A6UV44	Elongation factor 2	4.42e-05	NA	2.40e-09	NA
7. B	B0S1N2	GTPase Der	6.52e-04	NA	0.009	NA
7. B	C1CCK2	Peptide chain release factor 3	6.46e-05	NA	2.12e-07	NA
7. B	Q2NZY2	Elongation factor G	1.95e-05	NA	8.88e-08	NA
7. B	Q661E5	Elongation factor Tu	4.91e-07	NA	2.17e-10	NA
7. B	Q1C2U1	Elongation factor Tu 1	4.30e-07	NA	9.03e-13	NA
7. B	Q089Q6	Elongation factor Tu 2	5.07e-07	NA	4.90e-12	NA
7. B	P9WK97	Elongation factor 4	1.06e-05	NA	2.09e-08	NA
7. B	Q8F6K1	GTPase Der	2.37e-03	NA	0.001	NA
7. B	B1IUS8	Sulfate adenylyltransferase subunit 1	6.31e-06	NA	3.75e-04	NA
7. B	Q48712	Tetracycline resistance protein TetS	2.47e-05	NA	4.62e-12	NA
7. B	Q12JZ0	Elongation factor G 2	6.87e-05	NA	9.76e-07	NA
7. B	A6QBQ5	Translation initiation factor IF-2	0.00e+00	NA	1.14e-168	NA
7. B	Q06193	Elongation factor 2	1.71e-03	NA	1.29e-06	NA
7. B	B9DUR6	Peptide chain release factor 3	5.35e-05	NA	1.35e-07	NA
7. B	Q031X0	Peptide chain release factor 3	1.55e-05	NA	4.71e-08	NA
7. B	P0A6P5	GTPase Der	5.90e-03	NA	0.025	NA
7. B	B1L7Q0	Elongation factor 2	1.25e-04	NA	1.01e-07	NA
7. B	A8IG20	Translation initiation factor IF-2	0.00e+00	NA	6.13e-159	NA
7. B	Q0TCB9	Elongation factor G	2.31e-05	NA	1.30e-07	NA
7. B	C3LSP8	Translation initiation factor IF-2	0.00e+00	NA	2.12e-161	NA
7. B	Q3APH1	Elongation factor Tu	4.23e-07	NA	6.03e-15	NA
7. B	Q3IHI5	Peptide chain release factor 3	1.28e-05	NA	2.70e-07	NA
7. B	Q12WT3	Elongation factor 1-alpha	1.85e-06	NA	7.40e-04	NA
7. B	B6ELP3	Sulfate adenylyltransferase subunit 1	8.44e-05	NA	1.73e-05	NA
7. B	A0JUU0	Translation initiation factor IF-2	0.00e+00	NA	1.63e-164	NA
7. B	P40174	Elongation factor Tu-1	4.06e-07	NA	9.59e-10	NA
7. B	A1TSK3	Translation initiation factor IF-2	0.00e+00	NA	6.61e-162	NA
7. B	Q1J7N4	Elongation factor Tu	4.05e-07	NA	1.81e-12	NA
7. B	Q0RP81	Elongation factor 4	4.53e-06	NA	1.86e-06	NA
7. B	A5CCA0	Elongation factor Tu 1	4.97e-07	NA	4.89e-15	NA
7. B	Q31IY5	Elongation factor G	5.90e-05	NA	4.56e-06	NA
7. B	Q30WJ0	Translation initiation factor IF-2	0.00e+00	NA	6.51e-157	NA
7. B	Q3YWT2	Elongation factor G	2.41e-05	NA	1.30e-07	NA
7. B	Q8BFR5	Elongation factor Tu, mitochondrial	3.91e-06	NA	2.83e-08	NA
7. B	B1XSP8	Elongation factor G	4.66e-05	NA	1.82e-06	NA
7. B	B8ZQ69	Elongation factor 4	9.00e-06	NA	2.79e-11	NA
7. B	B9WBR8	Translation factor GUF1, mitochondrial	9.75e-06	NA	2.18e-04	NA
7. B	B0UU13	Translation initiation factor IF-2	0.00e+00	NA	3.49e-158	NA
7. B	Q01SX2	Elongation factor Tu	4.92e-07	NA	5.53e-10	NA
7. B	B7JKB6	Elongation factor G	NA	NA	2.00e-09	NA
7. B	Q0ICK8	GTPase Der	3.62e-03	NA	0.038	NA
7. B	B2GUV7	Eukaryotic translation initiation factor 5B	2.53e-10	NA	6.97e-22	NA
7. B	Q5M101	Elongation factor Tu	4.42e-07	NA	1.96e-11	NA
7. B	O23755	Elongation factor 2	3.86e-04	NA	2.22e-05	NA
7. B	P17245	Elongation factor Tu, cyanelle	4.03e-07	NA	6.99e-08	NA
7. B	Q8DV91	Peptide chain release factor 3	1.63e-05	NA	4.56e-07	NA
7. B	A1WHC2	Elongation factor G	3.90e-05	NA	1.50e-06	NA
7. B	A8H733	Peptide chain release factor 3	3.27e-05	NA	1.32e-05	NA
7. B	Q5QTY8	Translation initiation factor IF-2	0.00e+00	NA	2.53e-160	NA
7. B	B9MDP9	Elongation factor 4	9.21e-07	NA	7.04e-08	NA
7. B	B7IT16	Elongation factor G	9.96e-06	NA	1.93e-09	NA
7. B	P35450	Elongation factor G, chloroplastic (Fragment)	5.73e-07	NA	2.87e-05	NA
7. B	A4WGC5	Probable GTP-binding protein EngB	2.97e-05	NA	0.026	NA
7. B	Q0AIJ8	Elongation factor G	4.69e-05	NA	1.75e-08	NA
7. B	Q6KI66	Elongation factor Tu	3.77e-07	NA	1.63e-14	NA
7. B	A1VRT5	Elongation factor 4	9.12e-07	NA	1.33e-08	NA
7. B	A3DIZ9	Elongation factor G	6.13e-06	NA	6.08e-07	NA
7. B	P48865	Elongation factor Tu	4.74e-07	NA	1.85e-13	NA
7. B	A4XZ92	Elongation factor Tu	4.73e-07	NA	4.13e-09	NA
7. B	B7UHH0	Sulfate adenylyltransferase subunit 1	5.56e-06	NA	3.07e-04	NA
7. B	Q73IX7	Elongation factor G	2.63e-05	NA	5.10e-07	NA
7. B	Q487B0	Peptide chain release factor 3	1.05e-05	NA	2.86e-06	NA
7. B	Q1LI13	Elongation factor Tu	4.04e-07	NA	3.94e-13	NA
7. B	Q92GW4	Elongation factor Tu	4.90e-07	NA	2.33e-14	NA
7. B	C3MVH1	Elongation factor 2	3.08e-04	NA	2.49e-08	NA
7. B	Q81FR5	GTPase Der	1.46e-03	NA	0.016	NA
7. B	B5FTS9	Sulfate adenylyltransferase subunit 1	8.21e-05	NA	4.24e-05	NA
7. B	B0TWY6	Peptide chain release factor 3	3.07e-05	NA	1.21e-07	NA
7. B	P72339	Bifunctional enzyme NodQ	3.50e-03	NA	1.27e-04	NA
7. B	Q134S7	Elongation factor Tu 1	4.92e-07	NA	8.21e-13	NA
7. B	A0QL35	Elongation factor Tu	4.52e-07	NA	1.89e-09	NA
7. B	A2BT83	Elongation factor Tu	3.06e-07	NA	8.32e-10	NA
7. B	A4T1R2	Elongation factor Tu	4.14e-07	NA	1.92e-09	NA
7. B	A1CLD7	Translation factor guf1, mitochondrial	5.29e-05	NA	1.09e-06	NA
7. B	Q21XN4	Elongation factor 4	5.81e-07	NA	5.30e-08	NA
7. B	P64025	Elongation factor Tu	4.29e-07	NA	7.09e-11	NA
7. B	Q5X873	Elongation factor Tu	4.32e-07	NA	2.68e-10	NA
7. B	P19486	Elongation factor 1-alpha	3.23e-06	NA	0.005	NA
7. B	A9W4X1	Sulfate adenylyltransferase subunit 1	3.47e-05	NA	0.006	NA
7. B	Q39KH0	Elongation factor G 1	5.81e-05	NA	8.44e-07	NA
7. B	A4WX88	Elongation factor 4	2.53e-06	NA	1.00e-08	NA
7. B	P29544	Elongation factor Tu-3	3.42e-07	NA	1.55e-08	NA
7. B	A1TYJ5	Elongation factor Tu	5.71e-07	NA	4.49e-10	NA
7. B	Q38UQ9	Elongation factor G	6.91e-05	NA	2.18e-09	NA
7. B	A1AGM6	Elongation factor Tu 1	6.09e-07	NA	1.26e-13	NA
7. B	A4Y9B3	Peptide chain release factor 3	3.69e-05	NA	2.38e-05	NA
7. B	P39883	Peptide chain release factor 3	2.09e-04	NA	1.40e-08	NA
7. B	Q1Q8P2	Elongation factor Tu	5.05e-07	NA	3.13e-06	NA
7. B	C1DAR4	Elongation factor G	6.07e-05	NA	1.45e-06	NA
7. B	B9KD01	Elongation factor 4	2.74e-06	NA	5.62e-10	NA
7. B	B2USN4	Translation initiation factor IF-2	0.00e+00	NA	1.63e-145	NA
7. B	A5WGL0	Elongation factor G	2.25e-05	NA	2.93e-08	NA
7. B	Q8R7V2	Elongation factor Tu-A	4.01e-07	NA	6.68e-12	NA
7. B	Q1BGX0	GTPase Der	3.56e-03	NA	0.023	NA
7. B	B8E0B2	GTPase Obg	5.34e-02	NA	0.043	NA
7. B	Q31KM4	Peptide chain release factor 3	2.87e-04	NA	4.99e-11	NA
7. B	Q48V63	GTPase Der	1.42e-03	NA	3.83e-05	NA
7. B	Q8U082	Translation initiation factor 2 subunit gamma	5.40e-06	NA	1.24e-06	NA
7. B	A8AVL8	GTPase Der	2.03e-03	NA	3.51e-05	NA
7. B	A3NVW6	GTPase Der	2.74e-03	NA	0.024	NA
7. B	Q8TRC3	Elongation factor 2	4.06e-05	NA	1.05e-05	NA
7. B	P29543	Elongation factor Tu-2	4.30e-07	NA	1.33e-08	NA
7. B	Q5HIC8	Elongation factor G	9.92e-06	NA	3.56e-08	NA
7. B	B0TW33	Elongation factor 4	1.58e-06	NA	7.35e-08	NA
7. B	B0K530	Probable GTP-binding protein EngB	1.99e-05	NA	0.023	NA
7. B	Q4A597	Elongation factor Tu	3.72e-07	NA	1.42e-13	NA
7. B	Q04C17	Elongation factor G	2.66e-05	NA	6.52e-09	NA
7. B	Q041Z5	Peptide chain release factor 3	3.71e-05	NA	2.12e-08	NA
7. B	O93640	Elongation factor 2	4.20e-05	NA	7.50e-06	NA
7. B	Q3BQQ3	Peptide chain release factor 3	6.29e-05	NA	2.88e-05	NA
7. B	Q814C4	Elongation factor Tu	3.35e-07	NA	2.96e-14	NA
7. B	B6I2Q6	Peptide chain release factor 3	1.06e-05	NA	1.18e-07	NA
7. B	P64026	Elongation factor Tu	4.06e-07	NA	4.37e-10	NA
7. B	B7NT95	Sulfate adenylyltransferase subunit 1	5.74e-06	NA	4.12e-04	NA
7. B	P57662	GTPase Der	3.28e-03	NA	2.34e-04	NA
7. B	Q875Z2	Elongation factor 2	5.78e-04	NA	7.01e-07	NA