Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54707.1
JCVISYN3A_0298

Uncharacterized L7Ae family protein.
M. mycoides homolog: Q6MTP9.
TIGRfam Classification: 1=Unknown.
Category: Quasiessential.

Statistics

Total GO Annotation: 67
Unique PROST Go: 20
Unique BLAST Go: 0
Unique Foldseek Go: 9

Total Homologs: 265
Unique PROST Homologs: 109
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 15

Literature

Danchin and Fang [1]: K-turn RNA binding protein; ribosomal protein L7Ae|K-turn binding; present in growing ribosomes (ribosomal RNA folding process)
Yang and Tsui [2]: Arginine repressor
Antczak et al. [3]: Ribosomal protein L7Ae/L30e family
Zhang et al. [4]: GO:0000470|maturation of LSU-rRNA
Bianchi et al. [5]: "ylxQ-like, L7AE family, binds RNA switches"

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P55768 (Probable ribosomal protein in infB 5'region) with a FATCAT P-Value: 0 and RMSD of 1.12 angstrom. The sequence alignment identity is 27.8%.
Structural alignment shown in left. Query protein AVX54707.1 colored as red in alignment, homolog P55768 colored as blue. Query protein AVX54707.1 is also shown in right top, homolog P55768 showed in right bottom. They are colored based on secondary structures.

  AVX54707.1 M---QKDKLLKAIGMAYTSNNLITGFRL-LEEIKLKKVKFVILSSDMGLAQQKKYI-NKCLSRNIECVFNVLTKQELAKACGKDILVAIGLKDDNFIKLI 95
      P55768 MNEGNRQKAMNLIGLAMRAGKLITGEELTIADIRNEKAKIVFVANDAS-ENTKKKVKDKSSYYEVPC-FELFSEAEITQMIGKPRKV-FGIVDNGFAK-- 95

  AVX54707.1 KSN-L--- 99
      P55768 KTKELIEG 103

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0005840 ribosome
2. PF GO:0003723 RNA binding
2. PF GO:0031429 box H/ACA snoRNP complex
2. PF GO:0042254 ribosome biogenesis
2. PF GO:0030627 pre-mRNA 5'-splice site binding
2. PF GO:0034512 box C/D RNA binding
2. PF GO:0030621 U4 snRNA binding
2. PF GO:0000470 maturation of LSU-rRNA
2. PF GO:0022627 cytosolic small ribosomal subunit
2. PF GO:1990904 ribonucleoprotein complex
2. PF GO:0022625 cytosolic large ribosomal subunit
2. PF GO:0031118 rRNA pseudouridine synthesis
2. PF GO:0003735 structural constituent of ribosome
2. PF GO:0048025 negative regulation of mRNA splicing, via spliceosome
2. PF GO:0031120 snRNA pseudouridine synthesis
2. PF GO:0030490 maturation of SSU-rRNA
2. PF GO:0001651 dense fibrillar component
2. PF GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. PF GO:0046540 U4/U6 x U5 tri-snRNP complex
2. PF GO:0006412 translation
2. PF GO:0005690 U4atac snRNP
2. PF GO:0000398 mRNA splicing, via spliceosome
2. PF GO:0071011 precatalytic spliceosome
2. PF GO:0031428 box C/D RNP complex
2. PF GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
2. PF GO:0032040 small-subunit processome
2. PF GO:0034511 U3 snoRNA binding
2. PF GO:1905216 positive regulation of RNA binding
2. PF GO:0001682 tRNA 5'-leader removal
2. PF GO:0005730 nucleolus
2. PF GO:0000469 cleavage involved in rRNA processing
2. PF GO:0042788 polysomal ribosome
2. PF GO:0071005 U2-type precatalytic spliceosome
2. PF GO:0030622 U4atac snRNA binding
2. PF GO:0034513 box H/ACA snoRNA binding
2. PF GO:0005681 spliceosomal complex
2. PF GO:0019843 rRNA binding
2. PF GO:0004526 ribonuclease P activity
5. P GO:0050829 defense response to Gram-negative bacterium
5. P GO:1904571 positive regulation of selenocysteine incorporation
5. P GO:0005886 plasma membrane
5. P GO:0010608 posttranscriptional regulation of gene expression
5. P GO:0006364 rRNA processing
5. P GO:0000493 box H/ACA snoRNP assembly
5. P GO:0090263 positive regulation of canonical Wnt signaling pathway
5. P GO:0022626 cytosolic ribosome
5. P GO:0002181 cytoplasmic translation
5. P GO:0035368 selenocysteine insertion sequence binding
5. P GO:0005524 ATP binding
5. P GO:0007338 single fertilization
5. P GO:0030532 small nuclear ribonucleoprotein complex
5. P GO:0060415 muscle tissue morphogenesis
5. P GO:0031640 killing of cells of another organism
5. P GO:0051117 ATPase binding
5. P GO:0014069 postsynaptic density
5. P GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
5. P GO:0042777 plasma membrane ATP synthesis coupled proton transport
5. P GO:0000492 box C/D snoRNP assembly
6. F GO:0015030 Cajal body
6. F GO:0070034 telomerase RNA binding
6. F GO:0005697 telomerase holoenzyme complex
6. F GO:0000172 ribonuclease MRP complex
6. F GO:0030681 multimeric ribonuclease P complex
6. F GO:0005655 nucleolar ribonuclease P complex
6. F GO:0033204 ribonuclease P RNA binding
6. F GO:0007004 telomere maintenance via telomerase
6. F GO:0090661 box H/ACA telomerase RNP complex

Uniprot GO Annotations

GO Description

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P55768 Probable ribosomal protein in infB 5'region 0.00e+00 1.48e-32 0.007 0.9066
2. PF P38664 60S ribosomal protein L30 2.13e-10 1.85e-25 NA 0.7965
2. PF Q2FJ96 Putative ribosomal protein L7Ae-like 1.87e-08 1.03e-09 NA 0.7686
2. PF O29494 50S ribosomal protein L7Ae 5.61e-09 8.26e-11 NA 0.7526
2. PF P58375 60S ribosomal protein L30 1.52e-10 1.60e-17 NA 0.8606
2. PF B1Y9V4 50S ribosomal protein L7Ae 5.64e-08 1.34e-03 NA 0.7397
2. PF P62008 50S ribosomal protein L7Ae 9.62e-09 9.65e-13 NA 0.7646
2. PF Q6CM69 13 kDa ribonucleoprotein-associated protein 1.40e-09 1.74e-08 NA 0.7459
2. PF O49884 60S ribosomal protein L30 8.04e-11 2.50e-17 NA 0.823
2. PF A7I9N4 50S ribosomal protein L30e 7.17e-09 6.86e-16 NA 0.7509
2. PF O27127 50S ribosomal protein L30e 5.95e-10 1.53e-22 NA 0.8212
2. PF A7WYX0 Putative ribosomal protein L7Ae-like 1.30e-08 1.03e-09 NA 0.7698
2. PF A3MXZ2 50S ribosomal protein L30e 7.80e-11 7.86e-25 NA 0.7254
2. PF A6UT51 50S ribosomal protein L7Ae 2.49e-08 1.06e-14 NA 0.7093
2. PF A9A9U8 50S ribosomal protein L30e 8.57e-11 6.21e-23 NA 0.8711
2. PF A4FWF4 50S ribosomal protein L30e 1.00e-10 3.80e-24 NA 0.8728
2. PF P67883 60S ribosomal protein L30 8.94e-11 1.48e-16 NA 0.7981
2. PF A5UJN3 50S ribosomal protein L7Ae 3.33e-08 1.31e-12 NA 0.7344
2. PF Q6GJC4 Putative ribosomal protein L7Ae-like 3.94e-08 1.03e-09 NA 0.7569
2. PF C6A1G2 50S ribosomal protein L30e 2.75e-10 8.72e-26 NA 0.7483
2. PF P55858 50S ribosomal protein L7Ae 6.23e-09 6.35e-10 NA 0.7444
2. PF Q8U0M6 50S ribosomal protein L30e 4.59e-11 2.97e-25 NA 0.7142
2. PF O13019 40S ribosomal protein S12 6.89e-09 1.09e-07 NA 0.7742
2. PF P84175 40S ribosomal protein S12 7.98e-09 5.20e-07 NA 0.7686
2. PF Q971C9 50S ribosomal protein L7Ae 9.00e-09 4.51e-12 NA 0.7475
2. PF Q2NEK6 50S ribosomal protein L30e 1.06e-09 5.35e-22 NA 0.8321
2. PF Q9HJ56 50S ribosomal protein L7Ae 7.00e-09 1.18e-12 NA 0.755
2. PF Q3B8S0 NHP2-like protein 1 2.29e-09 2.45e-08 NA 0.7648
2. PF Q76KA2 60S ribosomal protein L30 1.76e-10 7.27e-17 NA 0.8631
2. PF Q9Z9M0 Putative ribosomal protein L7Ae-like 5.89e-11 8.36e-11 NA 0.8107
2. PF Q03253 40S ribosomal protein S12 1.76e-08 3.90e-04 NA 0.8007
2. PF O74018 50S ribosomal protein L30e 5.96e-10 2.74e-25 NA 0.7796
2. PF Q9XHS0 40S ribosomal protein S12 1.04e-08 3.13e-05 NA 0.7754
2. PF Q9YAX7 50S ribosomal protein L7Ae 9.04e-09 2.44e-10 NA 0.7614
2. PF Q752U5 60S ribosomal protein L30 1.76e-10 1.60e-24 NA 0.7939
2. PF P0A0G3 Putative ribosomal protein L7Ae-like 2.14e-08 1.03e-09 NA 0.7699
2. PF C3NMR6 50S ribosomal protein L7Ae 8.67e-09 8.42e-10 NA 0.7572
2. PF A8MB78 50S ribosomal protein L30e 9.01e-11 1.09e-24 NA 0.8032
2. PF P46350 Ribosome-associated protein L7Ae-like 4.31e-10 2.38e-11 NA 0.7959
2. PF Q8TXJ0 50S ribosomal protein L30e 4.70e-12 3.64e-22 NA 0.8126
2. PF Q2NGM2 50S ribosomal protein L7Ae 7.64e-09 8.55e-11 NA 0.7488
2. PF C3N8Q2 50S ribosomal protein L7Ae 8.65e-09 8.42e-10 NA 0.7587
2. PF B8D6E8 50S ribosomal protein L7Ae 2.01e-08 3.77e-10 NA 0.7418
2. PF A4YIL9 50S ribosomal protein L7Ae 9.89e-09 3.85e-13 NA 0.7423
2. PF Q4R5C6 NHP2-like protein 1 2.33e-09 2.45e-08 NA 0.7646
2. PF Q5I7K9 60S ribosomal protein L30 1.15e-10 2.78e-11 NA 0.797
2. PF Q9HQH8 50S ribosomal protein L7Ae 1.62e-08 6.96e-12 NA 0.7388
2. PF Q6C4U7 60S ribosomal protein L30 1.27e-10 6.90e-18 NA 0.8002
2. PF Q2FPJ8 50S ribosomal protein L30e 7.54e-09 6.96e-16 NA 0.6743
2. PF Q18GA8 50S ribosomal protein L7Ae 1.54e-08 1.08e-12 NA 0.7384
2. PF A3MTA9 50S ribosomal protein L7Ae 6.12e-08 3.61e-04 NA 0.729
2. PF A1RSE6 50S ribosomal protein L30e 1.46e-10 1.91e-24 NA 0.784
2. PF C5A1V9 50S ribosomal protein L7Ae 8.73e-09 2.98e-12 NA 0.7647
2. PF Q3IPM9 50S ribosomal protein L7Ae 1.73e-08 2.84e-12 NA 0.7404
2. PF P29160 50S ribosomal protein L30e 4.14e-11 1.02e-24 NA 0.7961
2. PF Q0W8W9 50S ribosomal protein L7Ae 1.99e-08 2.61e-12 NA 0.7524
2. PF B8GDW0 50S ribosomal protein L30e 4.60e-09 3.08e-14 NA 0.7565
2. PF Q5JGR3 50S ribosomal protein L7Ae 9.23e-09 2.09e-12 NA 0.7642
2. PF Q8TQL9 50S ribosomal protein L7Ae 1.19e-08 1.77e-16 NA 0.7445
2. PF B1YC27 50S ribosomal protein L30e 1.52e-10 1.18e-27 NA 0.7007
2. PF Q8R7U8 Putative ribosomal protein L7Ae-like 2.11e-07 2.14e-13 NA 0.8229
2. PF Q8PU74 50S ribosomal protein L7Ae 1.12e-08 1.87e-16 NA 0.7415
2. PF Q97EH1 Putative ribosomal protein L7Ae-like 4.25e-09 4.61e-11 NA 0.8198
2. PF A0B560 50S ribosomal protein L30e 6.58e-09 6.34e-18 NA 0.7327
2. PF P62009 50S ribosomal protein L7Ae 9.67e-09 9.65e-13 NA 0.7645
2. PF Q3T0D5 60S ribosomal protein L30 2.94e-10 7.27e-17 NA 0.8072
2. PF Q5L403 Putative ribosomal protein L7Ae-like 3.06e-10 1.17e-09 NA 0.8084
2. PF P0CQ53 13 kDa ribonucleoprotein-associated protein 2.36e-09 3.86e-08 NA 0.7939
2. PF Q8TV03 50S ribosomal protein L7Ae 7.94e-09 1.16e-12 NA 0.7537
2. PF Q8PUR3 50S ribosomal protein L30e 4.59e-07 1.56e-13 NA 0.6178
2. PF P0A0G5 Putative ribosomal protein L7Ae-like 1.78e-08 1.03e-09 NA 0.7659
2. PF A0RUB4 50S ribosomal protein L7Ae 2.23e-09 1.15e-12 NA 0.7732
2. PF Q9EV99 Putative ribosomal protein L7Ae-like 3.58e-10 1.42e-09 NA 0.8072
2. PF Q8U160 50S ribosomal protein L7Ae 8.89e-09 5.67e-13 NA 0.7652
2. PF Q8ZTA5 50S ribosomal protein L7Ae 7.14e-08 9.65e-04 NA 0.7638
2. PF O28389 50S ribosomal protein L30e 3.73e-09 3.37e-12 NA 0.745
2. PF Q5JE35 50S ribosomal protein L30e 4.60e-10 1.91e-23 NA 0.7378
2. PF Q757T2 13 kDa ribonucleoprotein-associated protein 1.55e-09 9.31e-08 NA 0.7467
2. PF P11522 50S ribosomal protein L30e 2.67e-09 2.27e-28 NA 0.8055
2. PF Q9V112 50S ribosomal protein L30e 4.55e-10 8.81e-25 NA 0.7358
2. PF C3N038 50S ribosomal protein L7Ae 6.96e-09 8.42e-10 NA 0.7581
2. PF A5IQ98 Putative ribosomal protein L7Ae-like 1.23e-08 1.03e-09 NA 0.7663
2. PF P67884 60S ribosomal protein L30 9.19e-11 1.48e-16 NA 0.7988
2. PF Q980R3 50S ribosomal protein L30e 1.79e-08 2.88e-28 NA 0.7181
2. PF Q9YAU3 50S ribosomal protein L30e 5.61e-10 2.37e-26 NA 0.8058
2. PF P49153 60S ribosomal protein L30 4.37e-11 8.69e-17 NA 0.8619
2. PF Q8TRB9 50S ribosomal protein L30e 2.94e-07 4.22e-16 NA 0.7259
2. PF A5ULN4 50S ribosomal protein L30e 1.77e-10 3.79e-25 NA 0.8739
2. PF Q5XH16 NHP2-like protein 1 2.52e-09 1.10e-09 NA 0.7672
2. PF C3MYY9 50S ribosomal protein L7Ae 7.36e-09 8.42e-10 NA 0.7618
2. PF Q6FXZ0 60S ribosomal protein L30 1.88e-10 7.91e-26 NA 0.796
2. PF Q6KZI7 50S ribosomal protein L7Ae 8.38e-09 2.04e-11 NA 0.7466
2. PF P39095 60S ribosomal protein L30 5.70e-11 1.04e-16 NA 0.8641
2. PF Q6FQV5 13 kDa ribonucleoprotein-associated protein 1.77e-09 1.22e-08 NA 0.7549
2. PF A3DMR6 50S ribosomal protein L7Ae 2.16e-08 2.93e-09 NA 0.753
2. PF Q6GBU3 Putative ribosomal protein L7Ae-like 3.71e-08 1.03e-09 NA 0.7642
2. PF Q76I81 40S ribosomal protein S12 8.19e-09 1.57e-06 NA 0.7728
2. PF P47840 40S ribosomal protein S12 1.10e-08 5.98e-07 NA 0.776
2. PF A8A912 50S ribosomal protein L7Ae 2.13e-08 1.76e-09 NA 0.7412
2. PF Q4P0K3 13 kDa ribonucleoprotein-associated protein 1.96e-09 4.00e-07 NA 0.7468
2. PF A8F978 Putative ribosomal protein L7Ae-like 3.05e-10 8.51e-10 NA 0.8032
2. PF C5A206 50S ribosomal protein L30e 7.68e-11 6.12e-24 NA 0.7374
2. PF B6YWH9 50S ribosomal protein L7Ae 9.71e-09 1.92e-11 NA 0.7632
2. PF A0B601 50S ribosomal protein L7Ae 2.01e-08 3.62e-12 NA 0.7433
2. PF P14025 50S ribosomal protein L30e 8.91e-11 3.53e-20 NA 0.8747
2. PF A4IJI3 Putative ribosomal protein L7Ae-like 2.86e-10 2.40e-09 NA 0.8083
2. PF P46405 40S ribosomal protein S12 8.14e-09 1.57e-06 NA 0.7722
2. PF P0A0G4 Putative ribosomal protein L7Ae-like 1.71e-08 1.03e-09 NA 0.7648
2. PF P62426 50S ribosomal protein L7Ae 4.87e-08 4.14e-15 NA 0.6968
2. PF C3MJN1 50S ribosomal protein L7Ae 8.48e-09 8.42e-10 NA 0.7573
2. PF P58374 60S ribosomal protein L30 1.88e-10 5.84e-20 NA 0.8079
2. PF Q466D1 50S ribosomal protein L7Ae 1.13e-08 4.09e-15 NA 0.7498
2. PF Q7S7F1 60S ribosomal protein L30 3.94e-11 1.07e-15 NA 0.7844
2. PF P0DJ59 60S ribosomal protein L30 7.21e-11 2.67e-20 NA 0.8229
2. PF P62427 50S ribosomal protein L7Ae 6.90e-09 1.43e-12 NA 0.7548
2. PF Q6BLQ3 13 kDa ribonucleoprotein-associated protein 1.76e-09 2.55e-08 NA 0.7546
2. PF Q97BK8 50S ribosomal protein L7Ae 6.03e-09 2.98e-12 NA 0.7442
2. PF C4KJ77 50S ribosomal protein L7Ae 6.96e-09 8.42e-10 NA 0.7578
2. PF A6TZ21 Putative ribosomal protein L7Ae-like 1.12e-08 1.03e-09 NA 0.7737
2. PF Q5HID1 Putative ribosomal protein L7Ae-like 3.21e-08 1.03e-09 NA 0.7632
2. PF P0CQ52 13 kDa ribonucleoprotein-associated protein 2.30e-09 3.86e-08 NA 0.7945
2. PF A6VGV1 50S ribosomal protein L30e 9.70e-11 6.51e-23 NA 0.8739
2. PF P32729 Probable ribosomal protein YlxQ 0.00e+00 1.92e-31 NA 0.9129
2. PF P12743 50S ribosomal protein L7Ae 8.10e-09 1.81e-12 NA 0.7496
2. PF A9A2Z3 50S ribosomal protein L7Ae 9.04e-09 1.15e-09 NA 0.7489
2. PF Q6C0I0 13 kDa ribonucleoprotein-associated protein 2.31e-09 3.68e-07 NA 0.7461
2. PF Q9SMI3 40S ribosomal protein S12 1.29e-08 5.20e-07 NA 0.7685
2. PF A6QEJ6 Putative ribosomal protein L7Ae-like 1.27e-08 1.03e-09 NA 0.7795
2. PF O26355 50S ribosomal protein L7Ae 9.30e-09 1.18e-11 NA 0.7512
2. PF B9LPY2 50S ribosomal protein L7Ae 3.08e-08 2.22e-13 NA 0.725
2. PF A2BK92 50S ribosomal protein L7Ae 1.04e-08 1.36e-11 NA 0.756
2. PF C5D3R1 Putative ribosomal protein L7Ae-like 3.74e-10 5.96e-11 NA 0.8066
2. PF Q9M5M6 60S ribosomal protein L30 8.77e-11 8.12e-17 NA 0.8232
2. PF Q6LXI6 50S ribosomal protein L30e 3.78e-10 2.98e-22 NA 0.8714
2. PF P58372 60S ribosomal protein L30 1.26e-10 2.25e-15 NA 0.8623
2. PF B0R4Z9 50S ribosomal protein L7Ae 1.52e-08 6.96e-12 NA 0.7392
2. PF Q4J8P1 50S ribosomal protein L7Ae 7.15e-09 1.63e-11 NA 0.7661
2. PF Q6P8E9 NHP2-like protein 1 2.11e-09 1.56e-08 NA 0.7662
2. PF Q8ZYQ6 50S ribosomal protein L30e 5.99e-11 3.30e-29 NA 0.7479
2. PF O59936 40S ribosomal protein S12 1.06e-08 4.33e-06 NA 0.7725
2. PF P58376 50S ribosomal protein L30e 1.68e-10 4.50e-29 NA 0.7718
5. P P55769 NHP2-like protein 1 2.61e-09 2.45e-08 NA NA
5. P B0BQW9 UPF0235 protein APJL_1398 4.33e-01 4.68e-02 NA NA
5. P P54061 50S ribosomal protein L30e 4.40e-11 8.45e-21 NA NA
5. P Q9KUQ7 UPF0235 protein VC_0458 4.53e-01 6.68e-04 NA NA
5. P P62890 60S ribosomal protein L30 1.42e-10 7.27e-17 NA NA
5. P B5QY78 UPF0235 protein YggU 4.67e-01 4.08e-02 NA NA
5. P B6YUU2 UPF0235 protein TON_0641 3.59e-01 7.57e-03 NA NA
5. P Q8TZV1 DNA/RNA-binding protein Alba 7.64e-02 2.53e-02 NA NA
5. P Q1CB83 UPF0235 protein YPA_0321 4.55e-01 1.34e-02 NA NA
5. P A3N228 UPF0235 protein APL_1380 4.61e-01 3.61e-02 NA NA
5. P B6JAU6 UPF0235 protein OCAR_4310/OCA5_c02140 5.87e-02 1.49e-03 NA NA
5. P A7FEY3 UPF0235 protein YpsIP31758_0827 4.48e-01 4.55e-03 NA NA
5. P B0R756 V-type ATP synthase subunit F 1.32e-01 3.22e-02 NA NA
5. P B4THI7 UPF0235 protein YggU 4.60e-01 3.37e-02 NA NA
5. P A8FSL7 UPF0235 protein Ssed_1229 4.84e-01 9.71e-03 NA NA
5. P Q8DCB7 UPF0235 protein VV1_1522 4.01e-01 2.91e-02 NA NA
5. P B5FUW5 UPF0235 protein YggU 4.50e-01 4.08e-02 NA NA
5. P Q2NRC0 UPF0235 protein SG2030 4.04e-01 1.65e-02 NA NA
5. P Q8ZM46 UPF0235 protein YggU 4.49e-01 1.45e-02 NA NA
5. P A9N4P8 UPF0235 protein YggU 4.70e-01 4.08e-02 NA NA
5. P Q0AE64 UPF0235 protein Neut_2146 4.24e-01 5.02e-04 NA NA
5. P B8GDF2 DNA/RNA-binding protein Alba 9.44e-02 8.82e-03 NA NA
5. P B1JNN7 UPF0235 protein YPK_0828 4.54e-01 9.18e-03 NA NA
5. P O32092 Uncharacterized protein YueI 6.56e-03 3.37e-05 NA NA
5. P B5F5M7 UPF0235 protein YggU 4.62e-01 3.37e-02 NA NA
5. P P48589 40S ribosomal protein S12 9.35e-08 1.39e-07 NA NA
5. P Q9D0T1 NHP2-like protein 1 2.31e-09 2.45e-08 NA NA
5. P Q5ANL6 13 kDa ribonucleoprotein-associated protein 1.74e-09 4.38e-08 NA NA
5. P A1RHL9 UPF0235 protein Sputw3181_1321 4.48e-01 1.39e-02 NA NA
5. P C4LCM6 UPF0235 protein Tola_0962 4.52e-01 9.81e-04 NA NA
5. P P63324 40S ribosomal protein S12 1.06e-08 5.98e-07 NA NA
5. P P63323 40S ribosomal protein S12 1.34e-08 5.98e-07 NA NA
5. P B5ZTD4 UPF0235 protein Rleg2_3707 7.23e-02 1.57e-02 NA NA
5. P A7H9D8 UPF0235 protein Anae109_1126 3.53e-01 4.24e-02 NA NA
5. P Q54ST0 NHP2-like protein 1 homolog 1.67e-09 7.64e-08 NA NA
5. P Q2J3Y9 UPF0235 protein RPB_0109 2.00e-01 1.59e-02 NA NA
5. P O14062 40S ribosomal protein S12-A 4.00e-08 2.03e-03 NA NA
5. P Q9S9P1 40S ribosomal protein S12-1 1.06e-08 1.22e-03 NA NA
5. P P32495 H/ACA ribonucleoprotein complex subunit NHP2 9.97e-09 1.76e-02 NA NA
5. P O26112 50S ribosomal protein L23 1.65e-01 3.58e-02 NA NA
5. P Q0HKZ7 UPF0235 protein Shewmr4_1190 4.51e-01 3.66e-02 NA NA
5. P A7MZ92 UPF0235 protein VIBHAR_03581 2.24e-01 1.18e-02 NA NA
5. P C3LRX5 UPF0235 protein VCM66_0443 4.49e-01 2.41e-03 NA NA
5. P A3CS70 V-type ATP synthase subunit F 9.39e-02 1.03e-02 NA NA
5. P Q9C8F7 Putative 60S ribosomal protein L30-1 1.40e-10 4.91e-15 NA NA
5. P Q3A6Y1 UPF0235 protein Pcar_0617 3.13e-01 3.10e-02 NA NA
5. P Q87LJ3 UPF0235 protein VP2619 4.79e-01 3.27e-02 NA NA
5. P Q21D99 UPF0235 protein RPC_0058 2.31e-01 3.12e-03 NA NA
5. P B1XFB3 UPF0235 protein YggU 4.65e-01 2.98e-02 NA NA
5. P B4TV71 UPF0235 protein YggU 4.49e-01 4.08e-02 NA NA
5. P Q1CEW2 UPF0235 protein YPN_3141 4.56e-01 1.34e-02 NA NA
5. P Q9HNE2 V-type ATP synthase subunit F 1.18e-01 3.22e-02 NA NA
5. P Q55BS9 60S ribosomal protein L30 2.15e-10 4.27e-18 NA NA
5. P A0KPB6 UPF0235 protein AHA_3661 4.69e-01 1.48e-02 NA NA
5. P Q0BVH7 UPF0235 protein GbCGDNIH1_0277 1.64e-01 3.45e-02 NA NA
5. P Q0HX95 UPF0235 protein Shewmr7_1261 4.51e-01 3.29e-02 NA NA
5. P A4Y8X6 UPF0235 protein Sputcn32_2690 4.50e-01 4.33e-02 NA NA
5. P Q8U052 UPF0235 protein PF1765 3.42e-01 3.53e-02 NA NA
5. P B3GYF9 UPF0235 protein APP7_1431 2.35e-01 2.55e-02 NA NA
5. P Q6LYD6 UPF0235 protein MMP1055 1.61e-01 3.22e-02 NA NA
5. P A3D6Z7 UPF0235 protein Sbal_3028 3.56e-01 1.74e-02 NA NA
5. P Q8Z3U7 UPF0235 protein YggU 4.53e-01 4.08e-02 NA NA
5. P P62889 60S ribosomal protein L30 1.07e-10 7.27e-17 NA NA
5. P Q9SDG6 60S ribosomal protein L30 4.29e-11 2.26e-16 NA NA
5. P B5XU96 UPF0235 protein KPK_0722 4.77e-01 3.65e-03 NA NA
5. P P0A0G6 Putative ribosomal protein L7Ae-like 8.88e-09 1.03e-09 NA NA
5. P Q8VZ19 60S ribosomal protein L30-2 1.66e-10 3.40e-17 NA NA
5. P Q82X93 UPF0235 protein NE0395 2.84e-01 8.08e-03 NA NA
5. P A9AAP2 UPF0235 protein MmarC6_1603 1.07e-01 1.02e-02 NA NA
5. P P54066 50S ribosomal protein L7Ae 3.63e-08 1.85e-15 NA NA
5. P B3QA92 UPF0235 protein Rpal_0418 2.26e-02 1.48e-02 NA NA
5. P A0KUF7 UPF0235 protein Shewana3_1191 4.46e-01 1.43e-02 NA NA
5. P Q6KZR7 DNA/RNA-binding protein Alba 5.12e-02 2.57e-02 NA NA
5. P Q9U3Z7 NHP2-like protein 1 homolog 2.10e-09 7.48e-08 NA NA
5. P A6WQT5 UPF0235 protein Shew185_3043 3.64e-01 1.74e-02 NA NA
5. P Q9LSA3 60S ribosomal protein L30-3 9.39e-11 2.35e-14 NA NA
5. P P52808 60S ribosomal protein L30-1 9.00e-11 1.75e-11 NA NA
5. P Q9SKZ3 40S ribosomal protein S12-2 1.35e-08 5.99e-03 NA NA
5. P P39990 13 kDa ribonucleoprotein-associated protein 1.74e-09 9.73e-09 NA NA
5. P A4SRR7 UPF0235 protein ASA_3628 5.02e-01 3.87e-02 NA NA
5. P B5RE62 UPF0235 protein YggU 4.55e-01 4.08e-02 NA NA
5. P Q3ATT3 UPF0235 protein Cag_0319 8.57e-02 3.22e-03 NA NA
5. P A6TDW3 UPF0235 protein KPN78578_33230 4.76e-01 3.65e-03 NA NA
5. P Q9LEY9 H/ACA ribonucleoprotein complex subunit 2-like protein 1.19e-08 1.94e-03 NA NA
5. P O97249 40S ribosomal protein S12 6.87e-09 1.03e-05 NA NA
5. P Q98EP2 UPF0235 protein msl4154 2.10e-01 3.78e-02 NA NA
5. P B4SES7 UPF0235 protein Ppha_2415 3.79e-01 1.44e-02 NA NA
5. P Q12WL2 V-type ATP synthase subunit F 4.12e-02 2.09e-02 NA NA
5. P A9KXP6 UPF0235 protein Sbal195_3186 3.58e-01 1.74e-02 NA NA
5. P P25398 40S ribosomal protein S12 6.94e-09 1.57e-06 NA NA
5. P A0LDU6 UPF0235 protein Mmc1_3654 3.13e-01 4.70e-03 NA NA
5. P Q21568 NHP2-like protein 1 homolog 2.73e-09 3.27e-06 NA NA
5. P P14120 60S ribosomal protein L30 2.10e-10 3.07e-25 NA NA
5. P P49196 40S ribosomal protein S12 1.47e-08 1.58e-07 NA NA
5. P Q9UTP0 60S ribosomal protein L30-2 1.91e-10 5.41e-06 NA NA
5. P O74322 40S ribosomal protein S12-B 4.71e-08 1.60e-02 NA NA
5. P O74690 13 kDa ribonucleoprotein-associated protein 1.74e-09 1.21e-07 NA NA
5. P Q54PX9 40S ribosomal protein S12 1.06e-08 3.13e-07 NA NA
5. P Q666N2 UPF0235 protein YPTB3216 4.48e-01 4.55e-03 NA NA
5. P P62888 60S ribosomal protein L30 7.97e-11 7.27e-17 NA NA
5. P A4TI69 UPF0235 protein YPDSF_0571 4.56e-01 1.34e-02 NA NA
5. P Q8ZHF5 UPF0235 protein YPO0944/y3330/YP_3498 4.54e-01 1.34e-02 NA NA
5. P P80455 40S ribosomal protein S12 1.65e-08 8.55e-05 NA NA
5. P O48558 60S ribosomal protein L30 1.25e-10 5.15e-17 NA NA
5. P A5F9H9 UPF0235 protein VC0395_A0010/VC395_0502 4.47e-01 4.47e-03 NA NA
5. P C5A0M2 UPF0235 protein YggU 4.68e-01 2.98e-02 NA NA
5. P P55770 NHP2-like protein 1 2.63e-09 2.45e-08 NA NA
5. P A1SZ30 UPF0235 protein Ping_3043 4.06e-01 2.76e-02 NA NA
5. P P52060 UPF0235 protein YggU 4.70e-01 2.98e-02 NA NA
6. F Q6NTV9 H/ACA ribonucleoprotein complex subunit 2-like protein 1.37e-08 NA NA 0.7435
6. F P32429 60S ribosomal protein L7a 3.87e-06 NA NA 0.7203
6. F Q90YW2 60S ribosomal protein L7a 4.11e-06 NA NA 0.7289
6. F Q2TBQ5 60S ribosomal protein L7a 4.19e-06 NA NA 0.7208
6. F Q5RC65 H/ACA ribonucleoprotein complex subunit 2 2.16e-08 NA NA 0.7977
6. F Q6P8C4 H/ACA ribonucleoprotein complex subunit 2-like protein 1.27e-08 NA NA 0.7443
6. F O76732 60S ribosomal protein L7a 6.66e-06 NA NA 0.6447
6. F Q8SSG1 60S ribosomal protein L7a 1.14e-06 NA NA 0.7028
6. F Q6XIP0 H/ACA ribonucleoprotein complex subunit 2-like protein 2.10e-08 NA NA 0.7466
6. F P0DJ14 60S ribosomal protein L7a 3.07e-06 NA NA 0.6713
6. F Q5E950 H/ACA ribonucleoprotein complex subunit 2 2.28e-08 NA NA 0.7892
6. F Q4R5C2 60S ribosomal protein L7a 5.27e-06 NA NA 0.7193
6. F Q32LC1 Ribonuclease P protein subunit p38 3.06e-03 NA NA 0.7192
6. F Q8I7X7 H/ACA ribonucleoprotein complex subunit 2-like protein 3.24e-08 NA NA 0.7979
6. F Q60YI3 Putative H/ACA ribonucleoprotein complex subunit 2-like protein 4.68e-08 NA NA 0.7852