Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54709.1
JCVISYN3A_0300
Transcription termination/antitermination protein NusA.
M. mycoides homolog: Q6MTP7.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 13
Unique PROST Go: 4
Unique BLAST Go: 0
Unique Foldseek Go: 1
Total Homologs: 33
Unique PROST Homologs: 9
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q9KA74
(Transcription termination/antitermination protein NusA) with a FATCAT P-Value: 0 and RMSD of 3.08 angstrom. The sequence alignment identity is 26.2%.
Structural alignment shown in left. Query protein AVX54709.1 colored as red in alignment, homolog Q9KA74 colored as blue.
Query protein AVX54709.1 is also shown in right top, homolog Q9KA74 showed in right bottom. They are colored based on secondary structures.
AVX54709.1 MLNGTELLESIKLIEKEKGISKESIINGLKEGLQKAYERFYDTDAIIKIDIN-ENTGLITMHQELKVVDDEQLDDDWLEITLSKAK-LKNPDIQIGDTIY 98 Q9KA74 M-N-SEFMDALTTLEKEKGISKEVIIEAIEAALISGYKRNFNQAQNVRVDVNREN-GSIRVFARKEVVEE--VFDARLEISLDEAKGI-NPNYEVDDVV- 93 AVX54709.1 KPIEFS-EEFSRMVVNQVRQIFQQKIREAERARIYEQFVSLEGEVVQAKVVG-MNR-ENNYV-LDINGTT-AYLWKSKTINNEIFQINEIIDVYIEVVEK 193 Q9KA74 -EIEVTPKDFGRIAAQTAKQVVTQRVREAERGIIYADFIDREEDI----MTGIVQRQDNRFIYVDL-GKVEALLPLSEQMPNESYRHNDRIKAYITKVEK 187 AVX54709.1 ESKLSQISISRTAPNFLTKLIEREVPEVRMGIVEIKAVSREPGKRSKVAVITHNNNVEPIGAIIGVGGNRINRISDILKGEKIDIIRWDEDQITYLINAM 293 Q9KA74 TTKGPQIMISRTHPGLLKRLFELEVPEIYDGTVELKSVAREAGDRSKISVHAENPEVDPVGACVGPKGSRVQTIVNELKGEKIDIVRWSEDPVEYVANAL 287 AVX54709.1 TPVKVISINKIGDE---YDIVVPDTQLSLAIGKQGVAAKLIASLLKTKINIFSYSTALKENMDILWNGDTTIQEVETNTYTPKTKATKKE--EKPVITTT 388 Q9KA74 SPSKVVKVN-VNEEEKTTQVIVPDYQLSLAIGKRGQNARLAAKLTGWKIDIKSES----EAQEL---G---LLEDEAASH--ETLALDQETADQPEATV- 373 AVX54709.1 KKPIKQTTKKEENQIDVDALIAFQAEVEHEQELKDQEELLKQESMYKEYENNFNDFENEKEILLAEKQLETQNQIIKEPVVEVQEFEIEKQSKIEDQITE 488 Q9KA74 -----ETSKNHEEE-------------------------------------------------------------------------------------- 382 AVX54709.1 NKQPEIKTEVETKPNIVEQVNKLNTNKPNNKFEQNRFNYKKQKQKEEELELDFDIKNEPDIDEIDANLKAFNDAILKQEDDEDLDIDLDDYDKYYD 584 Q9KA74 ------------------------------------------------------------------------------------------------ 382
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006353 | DNA-templated transcription, termination |
| 1. PBF | GO:0003723 | RNA binding |
| 1. PBF | GO:0031564 | transcription antitermination |
| 1. PBF | GO:0005829 | cytosol |
| 1. PBF | GO:0003700 | DNA-binding transcription factor activity |
| 1. PBF | GO:0000166 | nucleotide binding |
| 4. PB | GO:0001000 | bacterial-type RNA polymerase core enzyme binding |
| 4. PB | GO:0001125 | |
| 5. P | GO:0008143 | poly(A) binding |
| 5. P | GO:0000178 | exosome (RNase complex) |
| 5. P | GO:0006401 | RNA catabolic process |
| 5. P | GO:0015935 | small ribosomal subunit |
| 6. F | GO:0005737 | cytoplasm |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0006353 | DNA-templated transcription, termination |
| GO:0003723 | RNA binding |
| GO:0031564 | transcription antitermination |
| GO:0031554 | regulation of DNA-templated transcription, termination |
| GO:0003700 | DNA-binding transcription factor activity |
| GO:0005737 | cytoplasm |
| GO:0006355 | regulation of transcription, DNA-templated |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | O51740 | Transcription termination/antitermination protein NusA | 2.70e-09 | 9.35e-11 | 5.60e-26 | 0.7017 |
| 1. PBF | P47387 | Transcription termination/antitermination protein NusA | 7.20e-11 | 9.74e-18 | 1.52e-50 | 0.5528 |
| 1. PBF | Q8K9H0 | Transcription termination/antitermination protein NusA | 1.92e-11 | 8.35e-06 | 4.94e-46 | 0.8112 |
| 1. PBF | P75591 | Transcription termination/antitermination protein NusA | 1.42e-11 | 6.33e-31 | 1.14e-47 | 0.5606 |
| 1. PBF | P0AFF7 | Transcription termination/antitermination protein NusA | 1.80e-11 | 5.54e-08 | 1.63e-49 | 0.851 |
| 1. PBF | Q9KA74 | Transcription termination/antitermination protein NusA | 0.00e+00 | 9.24e-03 | 1.11e-71 | 0.7814 |
| 1. PBF | Q83BS0 | Transcription termination/antitermination protein NusA | 1.55e-11 | 3.50e-08 | 2.26e-57 | 0.8074 |
| 1. PBF | P0AFF8 | Transcription termination/antitermination protein NusA | 1.41e-11 | 5.54e-08 | 1.63e-49 | 0.8528 |
| 1. PBF | P57459 | Transcription termination/antitermination protein NusA | 1.79e-11 | 6.86e-05 | 2.70e-48 | 0.8115 |
| 1. PBF | Q9ZCZ7 | Transcription termination/antitermination protein NusA | 8.38e-14 | 2.83e-08 | 4.37e-53 | 0.9046 |
| 1. PBF | Q92HF4 | Transcription termination/antitermination protein NusA | 3.61e-14 | 1.42e-07 | 2.66e-54 | 0.9088 |
| 1. PBF | P37430 | Transcription termination/antitermination protein NusA | 1.02e-11 | 3.04e-06 | 2.56e-48 | 0.8196 |
| 1. PBF | P0AFF9 | Transcription termination/antitermination protein NusA | 4.15e-11 | 5.54e-08 | 1.63e-49 | 0.7954 |
| 1. PBF | P43915 | Transcription termination/antitermination protein NusA | 1.91e-13 | 5.95e-07 | 6.89e-47 | 0.8283 |
| 1. PBF | Q89AF4 | Transcription termination/antitermination protein NusA | 6.32e-12 | 3.88e-05 | 2.24e-40 | 0.8233 |
| 3. BF | Q9Z5J1 | Transcription termination/antitermination protein NusA | 3.93e-14 | NA | 7.92e-45 | 0.7878 |
| 3. BF | P32727 | Transcription termination/antitermination protein NusA | 0.00e+00 | NA | 2.93e-64 | 0.8076 |
| 3. BF | P55977 | Transcription termination/antitermination protein NusA | 1.11e-16 | NA | 1.24e-26 | 0.6141 |
| 3. BF | P48514 | Transcription termination/antitermination protein NusA | 0.00e+00 | NA | 4.66e-60 | 0.819 |
| 3. BF | P9WIV2 | Transcription termination/antitermination protein NusA | 0.00e+00 | NA | 1.18e-35 | 0.764 |
| 3. BF | Q9ZJA6 | Transcription termination/antitermination protein NusA | 1.11e-16 | NA | 9.73e-27 | 0.6093 |
| 3. BF | P0A5M3 | Transcription termination/antitermination protein NusA | 0.00e+00 | NA | 1.18e-35 | 0.7617 |
| 4. PB | P0AFF6 | Transcription termination/antitermination protein NusA | 1.78e-11 | 5.54e-08 | 1.63e-49 | NA |
| 5. P | Q18GF5 | 30S ribosomal protein S3 | 1.74e-01 | 1.47e-04 | NA | NA |
| 5. P | Q3IMY2 | 30S ribosomal protein S3 | 1.76e-01 | 1.06e-02 | NA | NA |
| 5. P | Q8U0L8 | Exosome complex component Rrp4 | 1.87e-01 | 1.74e-02 | NA | NA |
| 5. P | P20281 | 30S ribosomal protein S3 | 1.81e-01 | 1.61e-06 | NA | NA |
| 5. P | Q9V120 | Exosome complex component Rrp4 | 1.71e-01 | 5.13e-03 | NA | NA |
| 5. P | O26780 | Exosome complex component Rrp4 | 1.76e-01 | 6.02e-09 | NA | NA |
| 5. P | P15009 | 30S ribosomal protein S3 | 2.15e-02 | 8.49e-04 | NA | NA |
| 5. P | A5UJS0 | Exosome complex component Rrp4 | 6.27e-02 | 1.67e-05 | NA | NA |
| 5. P | O59221 | Exosome complex component Rrp4 | 2.21e-01 | 1.27e-02 | NA | NA |
| 7. B | P9WIV3 | Transcription termination/antitermination protein NusA | 0.00e+00 | NA | 1.18e-35 | NA |