Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54711.1

JCVISYN3A_0302

Flavin reductase.
M. mycoides homolog: Q6MTP5.
TIGRfam Classification: 1=Unknown.
Category: Essential.

Statistics

Total GO Annotation: 40
Unique PROST Go: 6
Unique BLAST Go: 2
Unique Foldseek Go: 10

Total Homologs: 141
Unique PROST Homologs: 8
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 32

Literature

Danchin and Fang [1]: water forming NADH oxidase|important for resolving the final step of fermentation
Yang and Tsui [2]: Na+ ABC transporter, ATP-binding component
Antczak et al. [3]: Oxygen-insensitive NAD(P)H nitroreductase
Zhang et al. [4]: GO:0046256|2,4,6-trinitrotoluene catabolic process
Bianchi et al. [5]: NADPH flavin oxidoreductase - (fre-like)

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q1CSR7 (Oxygen-insensitive NADPH nitroreductase) with a FATCAT P-Value: 0 and RMSD of 2.19 angstrom. The sequence alignment identity is 24.3%.
Structural alignment shown in left. Query protein AVX54711.1 colored as red in alignment, homolog Q1CSR7 colored as blue. Query protein AVX54711.1 is also shown in right top, homolog Q1CSR7 showed in right bottom. They are colored based on secondary structures.

  AVX54711.1 ---MQKEYIKELMLN-RKSARDFDLNKSISDQDLEIILTSMRMSPSAFNLMNLRLLIIDRNCSFKTELSP-LFYNQLNFI-NADKVILFVSDKTNKILNH 94
      Q1CSR7 MKFLDQEKRRRL-LNERHSCKMFDSHYEFSSTELEEIAEIARLSPSSYNTQPWHFVMV-TNKDLKKQIAAHSYFNE-EMIKSASALMVVCSLRPSELLPH 97

  AVX54711.1 TIDKTVNKMFNETQAEIANKFKKNVVSATSQL--AQIN----ELDNWSKTTAHITAG-IATIAAASL-NIDSCIIGGFN-AK---VLETFFIQKNYLSED 182
      Q1CSR7 --GHYMQNLYPES-------YKVRVIPSFAQMLGVRFNHSMQRLESYILEQCYIAVGQIC--MGVSLMGLDSCIIGGFDPLKVGEVLE-ERINK------ 179

  AVX54711.1 EQIVLTMSFGYMSKSI-----KPKPKIRIDENEYITFVK 216
      Q1CSR7 PKIACLIALG---KRVAEASQKSR-KSKVDA---ITWL- 210

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0018545	NAD(P)H nitroreductase activity
1. PBF	GO:0016491	oxidoreductase activity
1. PBF	GO:0008218	bioluminescence
1. PBF	GO:0019439	aromatic compound catabolic process
1. PBF	GO:0009636	response to toxic substance
1. PBF	GO:0046256	2,4,6-trinitrotoluene catabolic process
2. PF	GO:0016634	oxidoreductase activity, acting on the CH-CH group of donors, oxygen as acceptor
2. PF	GO:0030659	cytoplasmic vesicle membrane
2. PF	GO:2001039	negative regulation of cellular response to drug
2. PF	GO:0140616	iodotyrosine deiodinase activity
2. PF	GO:0006212	uracil catabolic process
2. PF	GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
2. PF	GO:0019740	nitrogen utilization
2. PF	GO:0018546	nitrobenzene nitroreductase activity
2. PF	GO:0009236	cobalamin biosynthetic process
2. PF	GO:0006570	tyrosine metabolic process
2. PF	GO:0010181	FMN binding
2. PF	GO:0102919	5,6-dimethylbenzimidazole synthase activity
2. PF	GO:0035527	3-hydroxypropionate dehydrogenase (NADP+) activity
2. PF	GO:0000166	nucleotide binding
2. PF	GO:0042403	thyroid hormone metabolic process
4. PB	GO:0004155	6,7-dihydropteridine reductase activity
5. P	GO:0004447	iodide peroxidase activity
5. P	GO:0006208	pyrimidine nucleobase catabolic process
5. P	GO:0005887	integral component of plasma membrane
5. P	GO:0016657	oxidoreductase activity, acting on NAD(P)H, nitrogenous group as acceptor
5. P	GO:0045922	negative regulation of fatty acid metabolic process
5. P	GO:0034599	cellular response to oxidative stress
6. F	GO:0052874	FMN reductase (NADH) activity
6. F	GO:0052873	FMN reductase (NADPH) activity
6. F	GO:0052619	coenzyme F420-1:gamma-L-glutamate ligase activity
6. F	GO:0052618	coenzyme F420-0:L-glutamate ligase activity
6. F	GO:0052645	F420-0 metabolic process
6. F	GO:0008752	FMN reductase activity
6. F	GO:0008152	metabolic process
6. F	GO:0052890	oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor
6. F	GO:0008641	ubiquitin-like modifier activating enzyme activity
6. F	GO:0005525	GTP binding
7. B	GO:0005829	cytosol
7. B	GO:0009635	response to herbicide

Uniprot GO Annotations

GO	Description
GO:0016491	oxidoreductase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	O25608	Oxygen-insensitive NADPH nitroreductase	0.00e+00	2.37e-57	6.27e-07	0.7996
1. PBF	Q01234	Oxygen-insensitive NAD(P)H nitroreductase	0.00e+00	2.12e-44	1.92e-06	0.816
1. PBF	P81102	Putative NAD(P)H nitroreductase YodC	0.00e+00	2.97e-51	2.57e-11	0.834
1. PBF	Q1CSR7	Oxygen-insensitive NADPH nitroreductase	0.00e+00	2.83e-58	6.72e-07	0.8054
1. PBF	Q4L920	Putative NAD(P)H nitroreductase SH0546	0.00e+00	2.13e-57	3.77e-10	0.8293
1. PBF	Q99RB2	Putative NAD(P)H nitroreductase SAV2523	0.00e+00	6.10e-56	6.65e-10	0.8654
1. PBF	Q5HD30	Putative NAD(P)H nitroreductase SACOL2534	0.00e+00	6.60e-56	6.85e-10	0.8635
1. PBF	Q55233	Protein DrgA	0.00e+00	1.80e-38	1.05e-04	0.819
1. PBF	Q4A087	Putative NAD(P)H nitroreductase SSP0379	0.00e+00	7.09e-58	2.68e-12	0.874
1. PBF	Q9ZKP7	Oxygen-insensitive NADPH nitroreductase	0.00e+00	3.15e-59	4.11e-06	0.8037
1. PBF	Q57431	Putative NAD(P)H nitroreductase	0.00e+00	4.96e-56	8.30e-16	0.8614
1. PBF	Q5HLA1	Putative NAD(P)H nitroreductase SERP2086	0.00e+00	8.86e-55	3.11e-10	0.8628
1. PBF	Q2YW87	Putative NAD(P)H nitroreductase SAB2397c	0.00e+00	6.10e-56	6.65e-10	0.8642
1. PBF	Q17X32	Oxygen-insensitive NADPH nitroreductase	0.00e+00	7.93e-54	0.003	0.8443
1. PBF	Q79ZZ6	Putative NAD(P)H nitroreductase MW2443	0.00e+00	6.10e-56	6.65e-10	0.8639
1. PBF	Q6G6F2	Putative NAD(P)H nitroreductase SAS2409	0.00e+00	6.10e-56	6.65e-10	0.8622
1. PBF	P96692	Putative NAD(P)H nitroreductase MhqN	0.00e+00	3.73e-56	0.043	0.7866
1. PBF	Q8CN23	Putative NAD(P)H nitroreductase SE_2073	0.00e+00	3.52e-54	8.40e-10	0.8596
1. PBF	O34475	Putative NAD(P)H nitroreductase YfkO	0.00e+00	1.18e-52	7.67e-14	0.8641
1. PBF	Q2FDY2	Putative NAD(P)H nitroreductase SAUSA300_2462	0.00e+00	6.60e-56	6.85e-10	0.8615
1. PBF	P46072	Major NAD(P)H-flavin oxidoreductase	0.00e+00	1.18e-46	1.64e-08	0.8086
1. PBF	P96707	Putative NAD(P)H nitroreductase YdgI	0.00e+00	2.14e-50	1.27e-05	0.7513
1. PBF	Q7A3H8	Putative NAD(P)H nitroreductase SA2311	0.00e+00	6.10e-56	6.65e-10	0.8617
2. PF	B7LFB8	Probable malonic semialdehyde reductase RutE	5.55e-16	1.45e-38	NA	0.7496
2. PF	O31571	Putative NAD(P)H nitroreductase YfhC	1.65e-06	2.76e-24	NA	0.6417
2. PF	O28017	Putative NADH dehydrogenase/NAD(P)H nitroreductase AF_2267	4.49e-11	8.03e-18	NA	0.7606
2. PF	B3Q6V6	Putative NADH dehydrogenase/NAD(P)H nitroreductase Rpal_4764	1.11e-15	5.53e-36	NA	0.7949
2. PF	B7M8Z3	Probable malonic semialdehyde reductase RutE	6.66e-16	2.22e-35	NA	0.7749
2. PF	B1W2E1	Putative NADH dehydrogenase/NAD(P)H nitroreductase SGR_2476	3.77e-15	4.11e-36	NA	0.7458
2. PF	Q92PC8	5,6-dimethylbenzimidazole synthase	7.32e-11	9.19e-32	NA	0.6432
2. PF	Q0TJ59	Probable malonic semialdehyde reductase RutE	5.55e-16	4.42e-35	NA	0.749
2. PF	A7HZ77	Putative NADH dehydrogenase/NAD(P)H nitroreductase Plav_3612	5.00e-15	2.79e-35	NA	0.745
2. PF	A1JMW8	Probable malonic semialdehyde reductase RutE	6.66e-16	2.29e-38	NA	0.7412
2. PF	B1Y654	Putative NADH dehydrogenase/NAD(P)H nitroreductase Lcho_1290	2.56e-14	4.26e-43	NA	0.7763
2. PF	B0RN85	Putative NADH dehydrogenase/NAD(P)H nitroreductase xcc-b100_0585	1.55e-15	4.96e-41	NA	0.7445
2. PF	Q471I1	Putative NADH dehydrogenase/NAD(P)H nitroreductase Reut_A1586	5.00e-15	1.95e-43	NA	0.7325
2. PF	B1X9C9	Probable malonic semialdehyde reductase RutE	7.77e-16	3.94e-38	NA	0.7744
2. PF	A7MFX7	Probable malonic semialdehyde reductase RutE	4.44e-16	1.36e-42	NA	0.7506
2. PF	Q5XW77	Chloronitrobenzene nitroreductase	2.78e-07	5.66e-29	NA	0.6073
2. PF	Q32HQ3	Probable malonic semialdehyde reductase RutE	4.44e-16	4.50e-37	NA	0.75
2. PF	Q3Z3A5	Probable malonic semialdehyde reductase RutE	4.44e-16	7.27e-36	NA	0.7868
2. PF	Q60049	NADH dehydrogenase	0.00e+00	2.40e-56	NA	0.8539
2. PF	Q5REW1	Iodotyrosine deiodinase 1	1.08e-10	1.66e-02	NA	0.691
2. PF	B8GXF0	Putative NADH dehydrogenase/NAD(P)H nitroreductase CCNA_00059	6.77e-15	9.91e-37	NA	0.7836
2. PF	Q3BY45	Putative NADH dehydrogenase/NAD(P)H nitroreductase XCV0587	3.33e-15	2.90e-41	NA	0.7438
2. PF	Q4UZ74	Putative NADH dehydrogenase/NAD(P)H nitroreductase XC_0568	8.88e-16	4.96e-41	NA	0.7619
2. PF	A4SXD4	Putative NADH dehydrogenase/NAD(P)H nitroreductase Pnuc_0932	9.99e-16	1.44e-41	NA	0.7973
2. PF	B5YU50	Probable malonic semialdehyde reductase RutE	4.44e-16	3.71e-37	NA	0.8135
2. PF	Q2RNG5	5,6-dimethylbenzimidazole synthase	2.87e-11	8.06e-38	NA	0.6348
2. PF	P58792	Putative NADH dehydrogenase/NAD(P)H nitroreductase Atu2496	8.88e-16	3.55e-36	NA	0.7473
2. PF	A7ZYW3	Probable malonic semialdehyde reductase RutE	6.66e-16	3.71e-37	NA	0.743
2. PF	C4ZQD6	Probable malonic semialdehyde reductase RutE	5.55e-16	3.94e-38	NA	0.7861
2. PF	A6T798	Probable malonic semialdehyde reductase RutE	6.66e-16	2.83e-41	NA	0.7382
2. PF	Q8FJ44	Probable malonic semialdehyde reductase RutE	4.44e-16	1.02e-35	NA	0.7495
2. PF	Q6DLR9	Nitrobenzene nitroreductase	3.33e-07	8.71e-27	NA	0.6064
2. PF	B2SK49	Putative NADH dehydrogenase/NAD(P)H nitroreductase PXO_03909	3.55e-15	1.15e-41	NA	0.7444
2. PF	O26223	Putative NADH dehydrogenase/NAD(P)H nitroreductase	2.29e-11	2.54e-23	NA	0.6978
2. PF	B7UNZ1	Probable malonic semialdehyde reductase RutE	5.55e-16	3.26e-36	NA	0.8142
2. PF	B6I984	Probable malonic semialdehyde reductase RutE	5.55e-16	1.45e-38	NA	0.7478
2. PF	Q6TA49	Iodotyrosine deiodinase 1	1.02e-10	6.52e-03	NA	0.691
2. PF	B1LIZ7	Probable malonic semialdehyde reductase RutE	5.55e-16	1.46e-35	NA	0.8136
2. PF	A4W921	Probable malonic semialdehyde reductase RutE	6.66e-16	2.36e-39	NA	0.7556
2. PF	Q83RV4	Probable malonic semialdehyde reductase RutE	5.55e-16	1.27e-37	NA	0.7758
2. PF	O28082	Uncharacterized protein AF_2201	7.44e-07	4.11e-28	NA	0.518
2. PF	D5AV14	5,6-dimethylbenzimidazole synthase	2.42e-11	8.95e-40	NA	0.6091
2. PF	Q5GUV2	Putative NADH dehydrogenase/NAD(P)H nitroreductase XOO4267	3.66e-15	5.93e-41	NA	0.7556
2. PF	A4VQH8	Putative NADH dehydrogenase/NAD(P)H nitroreductase PST_3601	7.77e-16	4.61e-40	NA	0.7951
2. PF	B7NLB8	Probable malonic semialdehyde reductase RutE	5.55e-16	1.08e-36	NA	0.8138
2. PF	B2U8S6	Putative NADH dehydrogenase/NAD(P)H nitroreductase Rpic_0870	3.11e-15	5.46e-42	NA	0.788
2. PF	Q398D7	Putative NADH dehydrogenase/NAD(P)H nitroreductase Bcep18194_B1060	2.00e-15	5.34e-37	NA	0.7725
2. PF	Q8XAU9	Probable malonic semialdehyde reductase RutE	4.44e-16	3.71e-37	NA	0.7496
2. PF	A0R6D0	Nitroreductase NfnB	8.75e-07	1.92e-28	NA	0.5929
2. PF	A1A9R3	Probable malonic semialdehyde reductase RutE	5.55e-16	3.11e-38	NA	0.7481
2. PF	Q9AC08	Putative NADH dehydrogenase/NAD(P)H nitroreductase CC_0061	5.22e-15	9.91e-37	NA	0.7842
2. PF	Q8GED9	Albonoursin synthase	4.12e-12	5.51e-25	NA	0.6784
2. PF	P15888	Oxygen-insensitive NAD(P)H nitroreductase	0.00e+00	1.44e-41	NA	0.8146
2. PF	Q8PPX9	Putative NADH dehydrogenase/NAD(P)H nitroreductase XAC0554	5.22e-15	2.42e-41	NA	0.7363
2. PF	B2FKV6	Putative NADH dehydrogenase/NAD(P)H nitroreductase Smlt0482	3.66e-15	1.70e-40	NA	0.7501
2. PF	P0CY55	5,6-dimethylbenzimidazole synthase	8.86e-11	2.51e-35	NA	0.6075
2. PF	A7ZKB3	Probable malonic semialdehyde reductase RutE	5.55e-16	1.45e-38	NA	0.7484
2. PF	P45244	Putative NAD(P)H nitroreductase HI_1542	3.94e-11	2.64e-20	NA	0.6769
2. PF	Q8P4V1	Putative NADH dehydrogenase/NAD(P)H nitroreductase XCC3605	4.44e-15	4.96e-41	NA	0.7666
2. PF	O30013	Putative NADH dehydrogenase/NAD(P)H nitroreductase AF_0226	5.55e-16	3.97e-22	NA	0.8253
2. PF	Q9FBN0	Putative NADH dehydrogenase/NAD(P)H nitroreductase SCO5049	7.22e-15	1.84e-36	NA	0.7746
2. PF	B5XXN4	Probable malonic semialdehyde reductase RutE	7.77e-16	1.93e-41	NA	0.7401
2. PF	Q8Y0N9	Putative NADH dehydrogenase/NAD(P)H nitroreductase RSc1004	1.67e-15	1.89e-41	NA	0.788
2. PF	B1IV89	Probable malonic semialdehyde reductase RutE	6.66e-16	3.71e-37	NA	0.7705
2. PF	Q53009	Putative NADH dehydrogenase/NAD(P)H nitroreductase HadB	1.03e-13	4.35e-43	NA	0.7132
2. PF	P0ACY2	Putative NAD(P)H nitroreductase YdjA	1.10e-10	2.20e-21	NA	0.6663
2. PF	Q9FBV0	Putative NADH dehydrogenase/NAD(P)H nitroreductase SCO7141	2.02e-14	1.71e-42	NA	0.7551
2. PF	Q2NY49	Putative NADH dehydrogenase/NAD(P)H nitroreductase XOO4023	3.55e-15	1.98e-41	NA	0.7393
2. PF	Q1RDK9	Probable malonic semialdehyde reductase RutE	5.55e-16	3.11e-38	NA	0.8127
2. PF	Q0T626	Probable malonic semialdehyde reductase RutE	4.44e-16	1.27e-37	NA	0.7497
2. PF	B7MTF1	Probable malonic semialdehyde reductase RutE	5.55e-16	4.42e-35	NA	0.7876
2. PF	B4SHM0	Putative NADH dehydrogenase/NAD(P)H nitroreductase Smal_0358	4.22e-15	4.34e-41	NA	0.7508
2. PF	B7N3G4	Probable malonic semialdehyde reductase RutE	5.55e-16	1.08e-36	NA	0.758
2. PF	B7MIF5	Probable malonic semialdehyde reductase RutE	5.55e-16	3.11e-38	NA	0.7753
2. PF	Q5XCB9	Putative NAD(P)H nitroreductase Spy0809	0.00e+00	3.70e-54	NA	0.8324
2. PF	B0T152	Putative NADH dehydrogenase/NAD(P)H nitroreductase Caul_0018	4.22e-15	1.25e-38	NA	0.7846
4. PB	P38489	Oxygen-insensitive NAD(P)H nitroreductase	0.00e+00	2.42e-41	3.55e-04	NA
4. PB	Q2FVA4	Putative NAD(P)H nitroreductase SAOUHSC_02829	0.00e+00	6.60e-56	6.85e-10	NA
5. P	P75894	Probable malonic semialdehyde reductase RutE	7.77e-16	3.94e-38	NA	NA
5. P	Q9DCX8	Iodotyrosine deiodinase 1	1.50e-10	3.13e-03	NA	NA
5. P	P0ACY1	Putative NAD(P)H nitroreductase YdjA	1.32e-10	2.20e-21	NA	NA
5. P	Q6PHW0	Iodotyrosine deiodinase 1	1.05e-10	8.52e-03	NA	NA
5. P	Q5BK17	Iodotyrosine deiodinase 1	1.19e-10	1.71e-02	NA	NA
5. P	Q58779	Putative nitroreductase MJ1384	8.88e-12	2.05e-11	NA	NA
5. P	Q96VH4	Putative nitroreductase HBN1	1.30e-10	3.64e-25	NA	NA
5. P	P37261	Fatty acid repression mutant protein 2	2.49e-10	3.05e-19	NA	NA
6. F	Q7TWV3	Bifunctional F420 biosynthesis protein FbiB	1.16e-07	NA	NA	0.5964
6. F	P9WP78	Bifunctional F420 biosynthesis protein FbiB	1.15e-07	NA	NA	0.5968
6. F	Q6GC90	NADPH-dependent oxidoreductase	8.74e-13	NA	NA	0.7035
6. F	P23185	Microcin B17-processing protein McbC	1.00e-07	NA	NA	0.5243
6. F	Q56691	NADPH-flavin oxidoreductase	2.78e-13	NA	NA	0.6753
6. F	Q2FJN3	NADPH-dependent oxidoreductase	8.37e-13	NA	NA	0.6963
6. F	P9WM10	Uncharacterized protein MT1398	6.22e-02	NA	NA	0.3871
6. F	Q8CMQ4	NADPH-dependent oxidoreductase	9.87e-13	NA	NA	0.7111
6. F	Q75UN0	Bifunctional F420 biosynthesis protein FbiB	2.42e-08	NA	NA	0.57
6. F	Q9CCK2	Bifunctional F420 biosynthesis protein FbiB	1.18e-07	NA	NA	0.5728
6. F	Q49UU0	NADPH-dependent oxidoreductase	3.93e-13	NA	NA	0.7065
6. F	A5U7T6	Bifunctional F420 biosynthesis protein FbiB	1.11e-07	NA	NA	0.5966
6. F	A0QKC8	Bifunctional F420 biosynthesis protein FbiB	1.47e-07	NA	NA	0.5827
6. F	Q99WJ6	NADPH-dependent oxidoreductase	9.06e-13	NA	NA	0.6961
6. F	Q4L378	NADPH-dependent oxidoreductase	7.16e-13	NA	NA	0.6852
6. F	C1AH36	Bifunctional F420 biosynthesis protein FbiB	1.38e-07	NA	NA	0.5964
6. F	Q9KZK8	Bifunctional F420 biosynthesis protein FbiB	4.44e-08	NA	NA	0.5808
6. F	P39605	FMN reductase (NADPH)	2.35e-12	NA	NA	0.6311
6. F	Q5HRX9	NADPH-dependent oxidoreductase	9.32e-13	NA	NA	0.7184
6. F	P96977	CR(VI) reductase	2.95e-12	NA	NA	0.6635
6. F	Q2YVM4	NADPH-dependent oxidoreductase	8.44e-13	NA	NA	0.6948
6. F	Q8NY77	NADPH-dependent oxidoreductase	8.65e-13	NA	NA	0.7036
6. F	Q5YQS0	Bifunctional F420 biosynthesis protein FbiB	1.08e-07	NA	NA	0.5929
6. F	Q9Z5Z2	Oxygen-insensitive NADPH nitroreductase	1.20e-13	NA	NA	0.6038
6. F	Q5HIR4	NADPH-dependent oxidoreductase	8.26e-13	NA	NA	0.7035
6. F	Q6GJR6	NADPH-dependent oxidoreductase	8.62e-13	NA	NA	0.6866
6. F	A0QTG1	Bifunctional F420 biosynthesis protein FbiB	9.91e-08	NA	NA	0.6148
6. F	Q82DE3	Bifunctional F420 biosynthesis protein FbiB	4.57e-08	NA	NA	0.6158
6. F	P94424	FMN reductase [NAD(P)H]	2.57e-13	NA	NA	0.6601
6. F	A1KNR4	Bifunctional F420 biosynthesis protein FbiB	1.37e-07	NA	NA	0.5961
6. F	Q7A7J0	NADPH-dependent oxidoreductase	8.54e-13	NA	NA	0.6962
6. F	Q73UJ3	Bifunctional F420 biosynthesis protein FbiB	1.41e-07	NA	NA	0.5937