Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54713.1
JCVISYN3A_0304
Phosphatidate cytidylyltransferase.
M. mycoides homolog: Q6MTP3.
TIGRfam Classification: 3=Putative.
Category: Essential.
Statistics
Total GO Annotation: 32
Unique PROST Go: 3
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 68
Unique PROST Homologs: 9
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q9X1B7
(Phosphatidate cytidylyltransferase) with a FATCAT P-Value: 0 and RMSD of 3.02 angstrom. The sequence alignment identity is 31.9%.
Structural alignment shown in left. Query protein AVX54713.1 colored as red in alignment, homolog Q9X1B7 colored as blue.
Query protein AVX54713.1 is also shown in right top, homolog Q9X1B7 showed in right bottom. They are colored based on secondary structures.
AVX54713.1 MNTIITKDENKIKQIKKNLKTRLISATILVLLLGVYLAFPILYYFTNDSSSKLIIAYNVISLVLSSCVLFLSIRELLISFEIKNLDQKLFIEILTVILFW 100 Q9X1B7 ---------------MDDLKTRVITASVVAPF--VVLCF--VSY---ES---------LIGLV--SAILILAGYE-LITLEMKERDARFFYVIL-LALY- 64 AVX54713.1 IPFSNIETKIPVYNDLNLKEYWY-LTVIAI-GLYLF-LITFFLMKFCNKNIYQVTKII--F-VLLIMVLAFKAINFLGFLKAYNKILYGFSSIIWIWATI 194 Q9X1B7 -PV--------LYG-LVFEEPTQPLSILFITGV-VFSLIT-------DKDPSQVFKTVAAFSIALIYVTFF--LSF--FLPIYRD--FGAAN-----ALL 135 AVX54713.1 ILT-----DSFAYLFGIRFGRHKLAPTISPKKSWEGAIGGFFSSVIINLIWVLTIFFIPWTKSFAPFIGMYDLLLNKDDNLMLITYI-FLTVL-----VS 283 Q9X1B7 VLTSTWVFDSFAYFTGLKFGRTRISPRYSPRKSLEGVIGGFL-GVVI------------YT-----FL--YRLVVN-D--LLSVNVISFRTFLPFAATVA 212 AVX54713.1 LFTQFGDLIF-SYIKRSIDIKDFSNLIPGHGGILDRLDSFYFVFFIIYIILHISL-TFNRI 342 Q9X1B7 IMDTFGD-IFESALKRHYGVKDSGKTLPGHGGMLDRIDGLLFVAPVSYIVFKI-LEGVVR- 270
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0016024 | CDP-diacylglycerol biosynthetic process |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0004605 | phosphatidate cytidylyltransferase activity |
| 1. PBF | GO:0140042 | lipid droplet formation |
| 4. PB | GO:0031969 | chloroplast membrane |
| 4. PB | GO:0016056 | rhodopsin mediated signaling pathway |
| 4. PB | GO:0004142 | diacylglycerol cholinephosphotransferase activity |
| 4. PB | GO:0070319 | Golgi to plasma membrane transport vesicle |
| 4. PB | GO:0006658 | phosphatidylserine metabolic process |
| 4. PB | GO:0006661 | phosphatidylinositol biosynthetic process |
| 4. PB | GO:0009273 | peptidoglycan-based cell wall biogenesis |
| 4. PB | GO:0010868 | negative regulation of triglyceride biosynthetic process |
| 4. PB | GO:0007602 | phototransduction |
| 4. PB | GO:0008610 | lipid biosynthetic process |
| 4. PB | GO:0043052 | thermotaxis |
| 4. PB | GO:0007291 | sperm individualization |
| 4. PB | GO:0045600 | positive regulation of fat cell differentiation |
| 4. PB | GO:0005789 | endoplasmic reticulum membrane |
| 4. PB | GO:0070085 | glycosylation |
| 4. PB | GO:0006655 | phosphatidylglycerol biosynthetic process |
| 4. PB | GO:0016772 | transferase activity, transferring phosphorus-containing groups |
| 4. PB | GO:0005783 | endoplasmic reticulum |
| 4. PB | GO:0010883 | regulation of lipid storage |
| 4. PB | GO:0010513 | positive regulation of phosphatidylinositol biosynthetic process |
| 4. PB | GO:0009536 | plastid |
| 4. PB | GO:0007430 | terminal branching, open tracheal system |
| 4. PB | GO:0046488 | phosphatidylinositol metabolic process |
| 4. PB | GO:0080186 | developmental vegetative growth |
| 5. P | GO:0006825 | copper ion transport |
| 5. P | GO:0047409 | alkenylglycerophosphoethanolamine hydrolase activity |
| 5. P | GO:0047408 | alkenylglycerophosphocholine hydrolase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0016772 | transferase activity, transferring phosphorus-containing groups |
| GO:0016779 | nucleotidyltransferase activity |
| GO:0016024 | CDP-diacylglycerol biosynthetic process |
| GO:0016021 | integral component of membrane |
| GO:0004605 | phosphatidate cytidylyltransferase activity |
| GO:0016020 | membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P75160 | Putative phosphatidate cytidylyltransferase | 1.67e-15 | 5.01e-38 | 1.95e-16 | 0.6577 |
| 1. PBF | Q7A121 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.29e-23 | 3.86e-25 | 0.7403 |
| 1. PBF | Q4L5W3 | Phosphatidate cytidylyltransferase | 0.00e+00 | 6.61e-24 | 2.51e-24 | 0.7837 |
| 1. PBF | Q5HPT0 | Phosphatidate cytidylyltransferase | 0.00e+00 | 2.07e-21 | 7.83e-23 | 0.7808 |
| 1. PBF | Q9Z7Y6 | Phosphatidate cytidylyltransferase | 3.28e-12 | 1.20e-32 | 9.45e-05 | 0.7135 |
| 1. PBF | Q8YHH2 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.98e-20 | 1.23e-11 | 0.7451 |
| 1. PBF | Q2YRP9 | Phosphatidate cytidylyltransferase | 0.00e+00 | 8.17e-21 | 2.03e-10 | 0.7114 |
| 1. PBF | O25004 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.68e-23 | 4.46e-15 | 0.7668 |
| 1. PBF | Q7A5Y4 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.29e-23 | 3.86e-25 | 0.7836 |
| 1. PBF | Q6GHH4 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.29e-23 | 3.86e-25 | 0.761 |
| 1. PBF | P0ABG3 | Phosphatidate cytidylyltransferase | 1.13e-11 | 3.61e-30 | 2.63e-22 | 0.6381 |
| 1. PBF | Q5HGH0 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.29e-23 | 3.86e-25 | 0.7544 |
| 1. PBF | Q9PJU1 | Phosphatidate cytidylyltransferase | 8.89e-14 | 2.28e-37 | 1.31e-08 | 0.7161 |
| 1. PBF | Q6G9V2 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.29e-23 | 3.86e-25 | 0.7409 |
| 1. PBF | P63759 | Phosphatidate cytidylyltransferase | 0.00e+00 | 6.57e-18 | 3.99e-19 | 0.6606 |
| 1. PBF | Q99UL1 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.29e-23 | 3.86e-25 | 0.7572 |
| 1. PBF | Q49X46 | Phosphatidate cytidylyltransferase | 0.00e+00 | 3.59e-22 | 1.33e-24 | 0.7715 |
| 1. PBF | P73548 | Phosphatidate cytidylyltransferase | 0.00e+00 | 7.08e-20 | 4.90e-14 | 0.6861 |
| 1. PBF | Q9CBU1 | Phosphatidate cytidylyltransferase | 0.00e+00 | 2.97e-19 | 4.20e-16 | 0.6222 |
| 1. PBF | A0JNC1 | Phosphatidate cytidylyltransferase 2 | 7.43e-08 | 2.75e-07 | 3.05e-16 | 0.5872 |
| 1. PBF | P44937 | Phosphatidate cytidylyltransferase | 5.83e-12 | 5.91e-27 | 3.56e-20 | 0.6866 |
| 1. PBF | Q9ZML7 | Phosphatidate cytidylyltransferase | 0.00e+00 | 1.88e-23 | 7.69e-15 | 0.7821 |
| 1. PBF | Q9ZDA8 | Phosphatidate cytidylyltransferase | 4.51e-10 | 1.53e-16 | 1.82e-14 | 0.6217 |
| 1. PBF | O84457 | Phosphatidate cytidylyltransferase | 1.67e-13 | 4.85e-31 | 3.95e-07 | 0.7676 |
| 1. PBF | O31752 | Phosphatidate cytidylyltransferase | 0.00e+00 | 2.74e-26 | 1.74e-21 | 0.7655 |
| 1. PBF | Q9X1B7 | Phosphatidate cytidylyltransferase | 0.00e+00 | 1.96e-29 | 1.36e-20 | 0.709 |
| 1. PBF | Q8CST9 | Phosphatidate cytidylyltransferase | 0.00e+00 | 2.07e-21 | 7.83e-23 | 0.7813 |
| 1. PBF | Q92I31 | Phosphatidate cytidylyltransferase | 7.69e-10 | 5.73e-14 | 7.79e-16 | 0.6024 |
| 1. PBF | Q68WV5 | Phosphatidate cytidylyltransferase | 4.92e-10 | 3.84e-15 | 2.90e-15 | 0.6032 |
| 1. PBF | P9WPF6 | Phosphatidate cytidylyltransferase | 0.00e+00 | 1.77e-14 | 3.48e-19 | 0.6181 |
| 1. PBF | Q59640 | Phosphatidate cytidylyltransferase | 8.13e-13 | 6.90e-22 | 8.63e-16 | 0.7241 |
| 1. PBF | P0C102 | Phosphatidate cytidylyltransferase | 0.00e+00 | 8.17e-21 | 2.03e-10 | 0.7645 |
| 1. PBF | Q49433 | Putative phosphatidate cytidylyltransferase | 7.77e-16 | 9.79e-42 | 3.67e-16 | 0.667 |
| 1. PBF | Q1RII7 | Phosphatidate cytidylyltransferase | 2.57e-10 | 6.99e-19 | 1.60e-15 | 0.6229 |
| 1. PBF | P0ABG2 | Phosphatidate cytidylyltransferase | 9.65e-12 | 3.61e-30 | 2.63e-22 | 0.6387 |
| 1. PBF | O04940 | Phosphatidate cytidylyltransferase 1 | 1.76e-07 | 8.61e-15 | 2.18e-05 | 0.5839 |
| 1. PBF | O67292 | Phosphatidate cytidylyltransferase | 0.00e+00 | 2.14e-19 | 5.35e-12 | 0.6973 |
| 1. PBF | Q8G0E0 | Phosphatidate cytidylyltransferase | 0.00e+00 | 6.72e-20 | 1.87e-10 | 0.7382 |
| 1. PBF | Q95ZE3 | Phosphatidate cytidylyltransferase | 1.55e-10 | 5.13e-23 | 3.53e-06 | 0.635 |
| 1. PBF | Q4ULR7 | Phosphatidate cytidylyltransferase | 4.74e-10 | 9.48e-16 | 1.95e-16 | 0.5504 |
| 4. PB | P98191 | Phosphatidate cytidylyltransferase 1 | 1.39e-07 | 2.59e-07 | 7.26e-17 | NA |
| 4. PB | Q55D90 | Probable phosphatidate cytidylyltransferase | 6.81e-07 | 3.35e-09 | 1.53e-08 | NA |
| 4. PB | P9WPF7 | Phosphatidate cytidylyltransferase | 0.00e+00 | 1.77e-14 | 3.48e-19 | NA |
| 4. PB | Q92903 | Phosphatidate cytidylyltransferase 1 | 1.47e-07 | 7.32e-07 | 2.28e-17 | NA |
| 4. PB | P53439 | Phosphatidate cytidylyltransferase | 1.35e-07 | 5.70e-09 | 8.02e-16 | NA |
| 4. PB | P56079 | Phosphatidate cytidylyltransferase, photoreceptor-specific | 8.19e-09 | 7.00e-09 | 2.65e-11 | NA |
| 4. PB | Q99L43 | Phosphatidate cytidylyltransferase 2 | 4.16e-08 | 7.28e-08 | 3.50e-17 | NA |
| 4. PB | O95674 | Phosphatidate cytidylyltransferase 2 | 3.97e-08 | 2.30e-07 | 3.55e-17 | NA |
| 4. PB | Q9P381 | Putative phosphatidate cytidylyltransferase | 1.28e-08 | 2.33e-09 | 1.81e-11 | NA |
| 4. PB | P76091 | Uncharacterized protein YnbB | 2.69e-10 | 7.41e-26 | 1.30e-13 | NA |
| 4. PB | Q9M001 | Phosphatidate cytidylyltransferase 5, chloroplastic | 2.80e-11 | 5.02e-04 | 9.72e-18 | NA |
| 4. PB | Q94A03 | Phosphatidate cytidylyltransferase 4, chloroplastic | 1.42e-11 | 6.31e-06 | 2.03e-17 | NA |
| 4. PB | Q1PE48 | Phosphatidate cytidylyltransferase 3 | 2.67e-08 | 1.32e-09 | 1.86e-11 | NA |
| 4. PB | O04928 | Phosphatidate cytidylyltransferase 1 | 7.24e-08 | 5.20e-13 | 2.00e-12 | NA |
| 4. PB | O35052 | Phosphatidate cytidylyltransferase 1 | 1.89e-08 | 7.32e-07 | 8.83e-17 | NA |
| 4. PB | P0ABG1 | Phosphatidate cytidylyltransferase | 1.36e-11 | 3.61e-30 | 2.63e-22 | NA |
| 4. PB | P38221 | Phosphatidate cytidylyltransferase | 2.96e-08 | 7.18e-09 | 8.33e-13 | NA |
| 4. PB | O49639 | Phosphatidate cytidylyltransferase 2 | 1.91e-07 | 4.29e-14 | 3.17e-11 | NA |
| 4. PB | Q91XU8 | Phosphatidate cytidylyltransferase 2 | 1.03e-07 | 9.72e-07 | 5.22e-17 | NA |
| 5. P | P9WG50 | Uncharacterized membrane protein MT1445 | 9.41e-05 | 4.46e-02 | NA | NA |
| 5. P | Q6IR76 | Transmembrane protein 19 | 1.52e-06 | 2.91e-03 | NA | NA |
| 5. P | G3Y418 | Polyprenyl transferase yanG | 1.53e-04 | 2.28e-02 | NA | NA |
| 5. P | Q47455 | Copper resistance protein D | 5.19e-05 | 3.24e-03 | NA | NA |
| 5. P | Q96HH6 | Transmembrane protein 19 | 1.08e-06 | 4.26e-03 | NA | NA |
| 5. P | Q5RF73 | Transmembrane protein 19 | 1.27e-06 | 4.97e-03 | NA | NA |
| 5. P | Q0P4L9 | Transmembrane protein 19 | 1.75e-06 | 3.00e-02 | NA | NA |
| 5. P | P64838 | Uncharacterized membrane protein Mb1436 | 9.01e-05 | 4.46e-02 | NA | NA |
| 5. P | P9WG51 | Uncharacterized membrane protein Rv1401 | 9.46e-05 | 4.46e-02 | NA | NA |