Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54714.1
JCVISYN3A_0305
Uncharacterized metallopeptidase.
M. mycoides homolog: Q6MTP2.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.
Statistics
Total GO Annotation: 60
Unique PROST Go: 3
Unique BLAST Go: 7
Unique Foldseek Go: 8
Total Homologs: 494
Unique PROST Homologs: 0
Unique BLAST Homologs: 26
Unique Foldseek Homologs: 95
Literature
Danchin and Fang [1]: aminopeptidase|the PapA (YqhT) and PapB (YkvY) peptidases are responsible for the hydrolysis of various types of Xaa-Pro dipeptides and Xaa-Pro-Xaa tripeptides; next to efp suggests cleaning for uncompleted peptides containing proline;
Yang and Tsui [2]: Xaa-Pro dipeptidase
Antczak et al. [3]: pepQ; Xaa-Pro dipeptidase
Zhang et al. [4]: GO:0102009|proline dipeptidase activity
Bianchi et al. [5]: Proline dipeptidase (Xaa-Pro)
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
A7MQN9
(Xaa-Pro dipeptidase) with a FATCAT P-Value: 0 and RMSD of 3.00 angstrom. The sequence alignment identity is 25.3%.
Structural alignment shown in left. Query protein AVX54714.1 colored as red in alignment, homolog A7MQN9 colored as blue.
Query protein AVX54714.1 is also shown in right top, homolog A7MQN9 showed in right bottom. They are colored based on secondary structures.
AVX54714.1 ---MT---K-H-EIINE----LLEKNNADAILLYSPE--N------RYWFSKFHSSL-GYLIITKT-QSHLFLDG-------RYITAA--RN-------- 61 A7MQN9 MDSLTTLYKNHLDTLQERTRNVLARFNLDALLIHSGELFNVFLDDHPYPF-KVNPQFKAWVPVTQVPNCWLLVDGVNKPKLWFYLPVDYWHNVEPLPSAF 99 AVX54714.1 -NKNIN-----K--DI--ELHHFSKN-----------LKQDL-IDILNQNNVKTLAFESDWTYFEQYQAYKNHWFKDFDLIGINCSKIRMIKDDWEIANI 139 A7MQN9 WTEEIDIIALPKADDIGGQLPAARGNIAYIGPVPERALKLDVPADKINPKGV--I----DYLHF--YRAYKT----DYELA---C----M-RE----AQ- 174 AVX54714.1 KKACDITDQVFQAALD-FIKPGITEKQLQRF-IDDKFL-EFGA-D-KISFDTIIASGVN--------GSMPHAVPSDKVINNNELITIDMGCFYNGYCSD 226 A7MQN9 KTA--VNGH--RAAHEAFLS-GMSE-----FDINLAYLTATGHRDTDVPYSNIVA--LNEHAAVLHYTRLDHRAPSE--MRS---FLLDAGAEYNGYAAD 257 AVX54714.1 QTRTIAL-GDVD-PKLVEIYNIVYEAQ-SLGISLVKEGV--IAGDIH--------K-----Q-VYD-----FIDKKGYGKYFDHGLGHGIGVEIHEEPSV 302 A7MQN9 LTRTWAADGDSDFAALIKDVN---EEQLAL-IGTMKAGVSYI--DYHIQFHQRIAKLLRRHQIVTDISEEAMVEADITGPFMPHGIGHPLGLQVHD--VA 349 AVX54714.1 G----STG--------------SEVLKENMTITIEPGIY------IP--D--------------L---GGVRIEDDVLVTKTGCKLLTSSPRILLKLQK 358 A7MQN9 GFMQDDTGTHLAAPAKYPYLRCTRVLQPRMVLTIEPGIYFIESLLVPWREGPFSKHFNWQKIEALKPFGGIRIEDNVVIHEHGVENMTRD----LKLA- 443
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0004177 | aminopeptidase activity |
| 1. PBF | GO:0004063 | aryldialkylphosphatase activity |
| 1. PBF | GO:0008235 | metalloexopeptidase activity |
| 1. PBF | GO:0008233 | peptidase activity |
| 1. PBF | GO:0070084 | protein initiator methionine removal |
| 1. PBF | GO:0016795 | phosphoric triester hydrolase activity |
| 1. PBF | GO:0046872 | metal ion binding |
| 1. PBF | GO:0016787 | hydrolase activity |
| 1. PBF | GO:0016980 | creatinase activity |
| 1. PBF | GO:0030145 | manganese ion binding |
| 1. PBF | GO:0016805 | dipeptidase activity |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0047869 | dimethylpropiothetin dethiomethylase activity |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0070006 | metalloaminopeptidase activity |
| 1. PBF | GO:0047862 | diisopropyl-fluorophosphatase activity |
| 1. PBF | GO:0008237 | metallopeptidase activity |
| 1. PBF | GO:0035551 | protein initiator methionine removal involved in protein maturation |
| 1. PBF | GO:0042400 | ectoine catabolic process |
| 1. PBF | GO:0102009 | proline dipeptidase activity |
| 1. PBF | GO:0016812 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides |
| 1. PBF | GO:0010815 | bradykinin catabolic process |
| 3. BF | GO:0034724 | DNA replication-independent chromatin organization |
| 3. BF | GO:0006334 | nucleosome assembly |
| 3. BF | GO:0045899 | positive regulation of RNA polymerase II transcription preinitiation complex assembly |
| 3. BF | GO:0031298 | replication fork protection complex |
| 3. BF | GO:0006368 | transcription elongation from RNA polymerase II promoter |
| 3. BF | GO:0031491 | nucleosome binding |
| 3. BF | GO:0005886 | plasma membrane |
| 3. BF | GO:0006281 | DNA repair |
| 3. BF | GO:0035101 | FACT complex |
| 3. BF | GO:0006338 | chromatin remodeling |
| 3. BF | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 3. BF | GO:0007063 | regulation of sister chromatid cohesion |
| 4. PB | GO:0030574 | collagen catabolic process |
| 4. PB | GO:0042803 | protein homodimerization activity |
| 4. PB | GO:0010013 | N-1-naphthylphthalamic acid binding |
| 4. PB | GO:0016485 | protein processing |
| 4. PB | GO:0003094 | glomerular filtration |
| 4. PB | GO:0034396 | negative regulation of transcription from RNA polymerase II promoter in response to iron |
| 4. PB | GO:0031365 | N-terminal protein amino acid modification |
| 4. PB | GO:0006508 | proteolysis |
| 5. P | GO:0009926 | auxin polar transport |
| 5. P | GO:0070573 | metallodipeptidase activity |
| 5. P | GO:0034982 | mitochondrial protein processing |
| 6. F | GO:0044843 | cell cycle G1/S phase transition |
| 6. F | GO:0006261 | DNA-dependent DNA replication |
| 6. F | GO:0051984 | positive regulation of chromosome segregation |
| 6. F | GO:0005634 | nucleus |
| 6. F | GO:0005524 | ATP binding |
| 6. F | GO:0042393 | histone binding |
| 6. F | GO:0004592 | pantoate-beta-alanine ligase activity |
| 6. F | GO:0060465 | pharynx development |
| 7. B | GO:0006260 | DNA replication |
| 7. B | GO:0006555 | methionine metabolic process |
| 7. B | GO:0005739 | mitochondrion |
| 7. B | GO:0005703 | polytene chromosome puff |
| 7. B | GO:0018206 | peptidyl-methionine modification |
| 7. B | GO:0001672 | regulation of chromatin assembly or disassembly |
| 7. B | GO:0031225 | anchored component of membrane |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0004177 | aminopeptidase activity |
| GO:0016805 | dipeptidase activity |
| GO:0046914 | transition metal ion binding |
| GO:0046872 | metal ion binding |
| GO:0016787 | hydrolase activity |
| GO:0102009 | proline dipeptidase activity |
| GO:0008235 | metalloexopeptidase activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q2FG30 | Uncharacterized peptidase SAUSA300_1654 | 0.00e+00 | 1.05e-66 | 9.66e-64 | 0.9035 |
| 1. PBF | A1TXT7 | Xaa-Pro dipeptidase | 0.00e+00 | 2.21e-24 | 1.47e-12 | 0.6951 |
| 1. PBF | B4SZ86 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7046 |
| 1. PBF | B8M0Z4 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 5.16e-17 | 3.88e-28 | 0.8022 |
| 1. PBF | Q4L749 | Uncharacterized peptidase SH1217 | 0.00e+00 | 4.51e-69 | 5.22e-65 | 0.9025 |
| 1. PBF | A1RDW7 | Xaa-Pro dipeptidase | 0.00e+00 | 6.10e-19 | 7.31e-11 | 0.7193 |
| 1. PBF | C5FUV0 | Probable Xaa-Pro aminopeptidase MCYG_06503 | 7.85e-09 | 4.36e-13 | 1.80e-16 | 0.4853 |
| 1. PBF | Q2P6N8 | Xaa-Pro dipeptidase | 0.00e+00 | 7.75e-21 | 1.34e-06 | 0.7031 |
| 1. PBF | Q31UE2 | Xaa-Pro dipeptidase | 0.00e+00 | 9.25e-21 | 6.45e-08 | 0.7206 |
| 1. PBF | A6TGM5 | Xaa-Pro dipeptidase | 0.00e+00 | 3.41e-19 | 9.84e-09 | 0.7037 |
| 1. PBF | Q1C2C5 | Xaa-Pro dipeptidase | 0.00e+00 | 2.25e-18 | 1.60e-07 | 0.692 |
| 1. PBF | A1S1I9 | Xaa-Pro dipeptidase | 0.00e+00 | 1.21e-17 | 5.87e-11 | 0.7189 |
| 1. PBF | Q99TF5 | Uncharacterized peptidase SAV1708 | 0.00e+00 | 3.07e-66 | 1.27e-64 | 0.9032 |
| 1. PBF | B2VUU7 | Probable Xaa-Pro aminopeptidase P | 0.00e+00 | 1.73e-05 | 0.004 | 0.7474 |
| 1. PBF | A1DG66 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 9.15e-15 | 1.84e-22 | 0.8022 |
| 1. PBF | A2QAW7 | Probable Xaa-Pro aminopeptidase An01g13040 | 0.00e+00 | 1.39e-13 | 2.14e-26 | 0.8103 |
| 1. PBF | Q2UQH9 | Probable Xaa-Pro aminopeptidase AO090005001240 | 0.00e+00 | 4.59e-12 | 3.81e-23 | 0.8099 |
| 1. PBF | E1V7W1 | Ectoine hydrolase | 0.00e+00 | 3.11e-23 | 4.48e-14 | 0.8395 |
| 1. PBF | C1H9Q9 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 1.20e-15 | 1.50e-25 | 0.7941 |
| 1. PBF | C0Q3F4 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7046 |
| 1. PBF | B1JP62 | Xaa-Pro dipeptidase | 0.00e+00 | 2.49e-18 | 4.63e-08 | 0.689 |
| 1. PBF | E9CY14 | Probable Xaa-Pro aminopeptidase CPSG_02684 | 0.00e+00 | 1.21e-17 | 3.67e-21 | 0.7692 |
| 1. PBF | A6QYF6 | Probable Xaa-Pro aminopeptidase HCAG_02413 | 0.00e+00 | 1.57e-14 | 6.28e-27 | 0.7889 |
| 1. PBF | Q2H8T2 | Probable Xaa-Pro aminopeptidase P | 3.33e-16 | 1.18e-07 | 3.21e-06 | 0.7769 |
| 1. PBF | B0DZL3 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 1.31e-03 | 2.04e-07 | 0.7868 |
| 1. PBF | A8FP64 | Xaa-Pro dipeptidase | 0.00e+00 | 2.09e-17 | 4.47e-09 | 0.7225 |
| 1. PBF | B2FT23 | Xaa-Pro dipeptidase | 0.00e+00 | 1.57e-20 | 2.13e-04 | 0.7033 |
| 1. PBF | B8E3R4 | Xaa-Pro dipeptidase | 0.00e+00 | 7.21e-20 | 4.52e-11 | 0.7122 |
| 1. PBF | Q7MZ93 | Xaa-Pro dipeptidase | 0.00e+00 | 6.46e-18 | 2.89e-08 | 0.7231 |
| 1. PBF | E9E2J4 | Probable Xaa-Pro aminopeptidase MAC_04092 | 0.00e+00 | 1.57e-15 | 1.02e-22 | 0.7922 |
| 1. PBF | A1DF27 | Probable Xaa-Pro aminopeptidase P | 3.33e-16 | 1.97e-05 | 2.90e-05 | 0.7514 |
| 1. PBF | A6R035 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 5.08e-06 | 2.69e-05 | 0.7816 |
| 1. PBF | B8M9W2 | Probable Xaa-Pro aminopeptidase P | 6.66e-16 | 9.80e-04 | 2.64e-05 | 0.7548 |
| 1. PBF | Q0CFZ0 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 4.71e-16 | 5.04e-23 | 0.801 |
| 1. PBF | B5RFL5 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7034 |
| 1. PBF | Q32A22 | Xaa-Pro dipeptidase | 0.00e+00 | 3.12e-20 | 8.89e-08 | 0.7206 |
| 1. PBF | B7L9A5 | Xaa-Pro dipeptidase | 1.11e-16 | 6.97e-21 | 3.45e-08 | 0.7125 |
| 1. PBF | Q6DAP4 | Xaa-Pro dipeptidase | 0.00e+00 | 1.60e-19 | 5.11e-07 | 0.6797 |
| 1. PBF | A8G8D3 | Xaa-Pro dipeptidase | 0.00e+00 | 9.02e-19 | 2.18e-08 | 0.6859 |
| 1. PBF | A2QKF6 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 5.66e-15 | 1.13e-21 | 0.797 |
| 1. PBF | B1LM33 | Xaa-Pro dipeptidase | 0.00e+00 | 5.63e-21 | 2.96e-08 | 0.6888 |
| 1. PBF | B7UNH5 | Xaa-Pro dipeptidase | 0.00e+00 | 5.63e-21 | 2.96e-08 | 0.6893 |
| 1. PBF | B0Y3V7 | Probable Xaa-Pro aminopeptidase P | 2.22e-16 | 3.24e-05 | 3.64e-05 | 0.7386 |
| 1. PBF | A7ZU52 | Xaa-Pro dipeptidase | 1.11e-16 | 6.97e-21 | 3.45e-08 | 0.7163 |
| 1. PBF | E3QYP0 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 6.57e-18 | 2.49e-22 | 0.8249 |
| 1. PBF | B8NC10 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 3.04e-15 | 3.84e-24 | 0.7921 |
| 1. PBF | A6SL16 | Probable Xaa-Pro aminopeptidase BC1G_13431 | 0.00e+00 | 1.39e-13 | 6.81e-20 | 0.7737 |
| 1. PBF | P38487 | Creatinase | 0.00e+00 | 7.95e-33 | 5.98e-12 | 0.8512 |
| 1. PBF | P55667 | Uncharacterized hydrolase/peptidase y4tM | 0.00e+00 | 1.13e-26 | 5.52e-15 | 0.8468 |
| 1. PBF | C5G874 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 1.72e-16 | 4.27e-27 | 0.7914 |
| 1. PBF | P81535 | Xaa-Pro dipeptidase | 0.00e+00 | 3.33e-72 | 1.58e-70 | 0.9263 |
| 1. PBF | C5PAH2 | Probable Xaa-Pro aminopeptidase CPC735_009100 | 0.00e+00 | 6.79e-18 | 6.12e-21 | 0.7711 |
| 1. PBF | B0XW47 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 2.26e-15 | 3.62e-23 | 0.7923 |
| 1. PBF | B0XN37 | Probable Xaa-Pro aminopeptidase AFUB_014460 | 0.00e+00 | 6.82e-15 | 1.34e-22 | 0.8091 |
| 1. PBF | Q1JPJ2 | Xaa-Pro aminopeptidase 1 | 2.22e-16 | 4.19e-07 | 2.68e-10 | 0.7612 |
| 1. PBF | C6HSY3 | Probable Xaa-Pro aminopeptidase P | 1.22e-15 | 6.23e-06 | 6.33e-05 | 0.7288 |
| 1. PBF | E3Q897 | Probable Xaa-Pro aminopeptidase GLRG_02280 | 3.33e-16 | 1.25e-14 | 5.33e-17 | 0.778 |
| 1. PBF | B5YY94 | Xaa-Pro dipeptidase | 0.00e+00 | 1.07e-20 | 3.42e-08 | 0.7201 |
| 1. PBF | Q5H3T0 | Xaa-Pro dipeptidase | 0.00e+00 | 7.75e-21 | 1.34e-06 | 0.6864 |
| 1. PBF | C1GEY4 | Probable Xaa-Pro aminopeptidase P | 2.22e-16 | 1.32e-05 | 2.26e-07 | 0.7551 |
| 1. PBF | Q8FBI1 | Xaa-Pro dipeptidase | 0.00e+00 | 5.63e-21 | 2.96e-08 | 0.689 |
| 1. PBF | D4D6B8 | Probable Xaa-Pro aminopeptidase TRV_02643 | 0.00e+00 | 1.36e-15 | 4.40e-21 | 0.7801 |
| 1. PBF | P0A3Z4 | Xaa-Pro aminopeptidase 2 | 0.00e+00 | 1.37e-16 | 1.80e-21 | 0.7303 |
| 1. PBF | P0A3Z3 | Xaa-Pro aminopeptidase 2 | 0.00e+00 | 1.37e-16 | 1.80e-21 | 0.7193 |
| 1. PBF | C5K0R2 | Probable Xaa-Pro aminopeptidase BDBG_08406 | 0.00e+00 | 1.70e-15 | 3.77e-24 | 0.8074 |
| 1. PBF | C5BCB6 | Xaa-Pro dipeptidase | 1.11e-16 | 3.15e-18 | 3.70e-09 | 0.6968 |
| 1. PBF | Q7RYL6 | Probable Xaa-Pro aminopeptidase P | 1.55e-15 | 4.75e-02 | 6.61e-09 | 0.7528 |
| 1. PBF | B5EZW1 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7044 |
| 1. PBF | Q8PH57 | Xaa-Pro dipeptidase | 0.00e+00 | 2.31e-20 | 2.35e-06 | 0.6772 |
| 1. PBF | Q8X8I1 | Xaa-Pro dipeptidase | 0.00e+00 | 1.07e-20 | 3.42e-08 | 0.6878 |
| 1. PBF | B6H2M0 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 1.05e-14 | 5.98e-27 | 0.7909 |
| 1. PBF | Q2YTD2 | Uncharacterized peptidase SAB1567 | 0.00e+00 | 1.64e-66 | 6.40e-65 | 0.9022 |
| 1. PBF | Q8P5S9 | Xaa-Pro dipeptidase | 1.11e-16 | 1.36e-20 | 1.56e-06 | 0.7058 |
| 1. PBF | Q5QVP2 | Xaa-Pro dipeptidase 2 | 1.11e-16 | 5.60e-19 | 1.28e-12 | 0.7175 |
| 1. PBF | A4RQ11 | Probable Xaa-Pro aminopeptidase MGG_05684 | 0.00e+00 | 4.84e-13 | 6.12e-20 | 0.7828 |
| 1. PBF | A7FDF3 | Xaa-Pro dipeptidase | 0.00e+00 | 2.49e-18 | 4.63e-08 | 0.6832 |
| 1. PBF | D5GHP2 | Probable Xaa-Pro aminopeptidase GSTUM_00008071001 | 0.00e+00 | 1.38e-18 | 1.30e-20 | 0.795 |
| 1. PBF | Q3YVC0 | Xaa-Pro dipeptidase | 0.00e+00 | 6.60e-21 | 1.57e-08 | 0.6894 |
| 1. PBF | A3Q8U5 | Xaa-Pro dipeptidase | 0.00e+00 | 3.59e-19 | 1.38e-09 | 0.7318 |
| 1. PBF | Q0I0T2 | Xaa-Pro dipeptidase | 0.00e+00 | 5.11e-18 | 2.13e-11 | 0.7237 |
| 1. PBF | E9DV56 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 4.88e-10 | 5.75e-24 | 0.8073 |
| 1. PBF | Q57HM5 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7066 |
| 1. PBF | Q166H0 | Dimethylsulfonioproprionate lyase DddP | 0.00e+00 | 4.64e-16 | 2.98e-05 | 0.816 |
| 1. PBF | C6DI64 | Xaa-Pro dipeptidase | 0.00e+00 | 4.48e-19 | 1.70e-06 | 0.6943 |
| 1. PBF | Q08A38 | Xaa-Pro dipeptidase | 0.00e+00 | 1.97e-19 | 4.39e-10 | 0.7053 |
| 1. PBF | C9SR45 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 1.19e-04 | 2.79e-06 | 0.7771 |
| 1. PBF | Q5QXH5 | Xaa-Pro dipeptidase 1 | 2.22e-16 | 1.22e-15 | 4.83e-07 | 0.7301 |
| 1. PBF | A9R755 | Xaa-Pro dipeptidase | 0.00e+00 | 2.25e-18 | 1.60e-07 | 0.6859 |
| 1. PBF | Q8CNW9 | Uncharacterized peptidase SE_1383 | 0.00e+00 | 1.07e-65 | 1.57e-62 | 0.9022 |
| 1. PBF | C4JF09 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 7.02e-16 | 1.66e-23 | 0.7961 |
| 1. PBF | Q96WX8 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 8.62e-16 | 4.48e-25 | 0.8004 |
| 1. PBF | D1ZQL9 | Probable Xaa-Pro aminopeptidase SMAC_04549 | 0.00e+00 | 7.27e-17 | 2.08e-21 | 0.8177 |
| 1. PBF | P75313 | Putative Xaa-Pro aminopeptidase | 0.00e+00 | 4.05e-65 | 6.97e-72 | 0.9204 |
| 1. PBF | B0TLC0 | Xaa-Pro dipeptidase | 0.00e+00 | 3.48e-16 | 1.39e-10 | 0.7211 |
| 1. PBF | C0SHQ0 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 1.32e-15 | 2.11e-26 | 0.8133 |
| 1. PBF | C1H3X3 | Probable Xaa-Pro aminopeptidase PAAG_05466 | 0.00e+00 | 1.84e-15 | 8.87e-23 | 0.7935 |
| 1. PBF | A2QGR5 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 3.14e-07 | 3.63e-06 | 0.7715 |
| 1. PBF | E4V1Q7 | Probable Xaa-Pro aminopeptidase MGYG_06974 | 0.00e+00 | 3.72e-18 | 8.84e-23 | 0.7791 |
| 1. PBF | P47566 | Putative Xaa-Pro aminopeptidase | 0.00e+00 | 1.26e-63 | 3.92e-77 | 0.9334 |
| 1. PBF | B0RP90 | Xaa-Pro dipeptidase | 1.11e-16 | 3.23e-20 | 7.02e-07 | 0.7111 |
| 1. PBF | B1IW60 | Xaa-Pro dipeptidase | 1.11e-16 | 6.97e-21 | 3.45e-08 | 0.6815 |
| 1. PBF | Q44238 | Xaa-Pro dipeptidase | 6.66e-16 | 2.47e-12 | 5.50e-10 | 0.7201 |
| 1. PBF | B4TNZ2 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7043 |
| 1. PBF | Q2U7S5 | Probable Xaa-Pro aminopeptidase P | 3.33e-16 | 3.43e-04 | 3.73e-06 | 0.75 |
| 1. PBF | Q5HF67 | Uncharacterized peptidase SACOL1756 | 0.00e+00 | 1.05e-66 | 9.66e-64 | 0.9026 |
| 1. PBF | E9CTR7 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 2.25e-06 | 6.92e-04 | 0.77 |
| 1. PBF | P55666 | Uncharacterized hydrolase/peptidase y4tL | 0.00e+00 | 9.90e-31 | 1.03e-18 | 0.8658 |
| 1. PBF | C7Z837 | Probable Xaa-Pro aminopeptidase NECHADRAFT_60613 | 0.00e+00 | 1.90e-17 | 1.12e-25 | 0.8192 |
| 1. PBF | C5GKT2 | Probable Xaa-Pro aminopeptidase BDCG_04966 | 0.00e+00 | 1.15e-15 | 1.59e-24 | 0.7971 |
| 1. PBF | E9EK74 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 1.97e-19 | 6.06e-23 | 0.8162 |
| 1. PBF | Q0CZM6 | Probable Xaa-Pro aminopeptidase ATEG_00858 | 0.00e+00 | 1.00e-13 | 1.43e-26 | 0.8144 |
| 1. PBF | P0A3Z1 | Xaa-Pro aminopeptidase 1 | 0.00e+00 | 1.47e-11 | 2.18e-19 | 0.7549 |
| 1. PBF | C7Z9Z7 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 8.95e-06 | 1.90e-06 | 0.7579 |
| 1. PBF | Q0SZ37 | Xaa-Pro dipeptidase | 0.00e+00 | 5.83e-21 | 2.41e-08 | 0.7193 |
| 1. PBF | B6HAN0 | Probable Xaa-Pro aminopeptidase Pc16g13390 | 0.00e+00 | 1.57e-09 | 5.66e-25 | 0.8318 |
| 1. PBF | B6QG01 | Probable Xaa-Pro aminopeptidase P | 5.55e-16 | 1.30e-03 | 3.19e-06 | 0.7522 |
| 1. PBF | E9DDK8 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 8.73e-14 | 2.60e-22 | 0.8082 |
| 1. PBF | B5FNX9 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7043 |
| 1. PBF | Q4X267 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 2.26e-15 | 3.62e-23 | 0.791 |
| 1. PBF | B3GZT0 | Xaa-Pro dipeptidase | 1.11e-16 | 3.83e-16 | 2.00e-07 | 0.6856 |
| 1. PBF | B2AFW1 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 1.10e-14 | 7.27e-21 | 0.8087 |
| 1. PBF | P53581 | Methionine aminopeptidase C | 2.13e-14 | 3.61e-04 | 5.29e-22 | 0.7969 |
| 1. PBF | A3SK19 | Dimethylsulfonioproprionate lyase DddP | 0.00e+00 | 5.70e-16 | 2.91e-06 | 0.8117 |
| 1. PBF | A9MIX1 | Xaa-Pro dipeptidase | 0.00e+00 | 4.50e-20 | 1.17e-09 | 0.71 |
| 1. PBF | C0NF18 | Probable Xaa-Pro aminopeptidase HCBG_01484 | 0.00e+00 | 4.11e-17 | 8.49e-27 | 0.7757 |
| 1. PBF | B2VFE3 | Xaa-Pro dipeptidase | 0.00e+00 | 5.09e-20 | 1.18e-06 | 0.7036 |
| 1. PBF | Q5PKQ1 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7043 |
| 1. PBF | B7NV19 | Xaa-Pro dipeptidase | 0.00e+00 | 1.46e-20 | 2.93e-08 | 0.6885 |
| 1. PBF | A4WFX3 | Xaa-Pro dipeptidase | 0.00e+00 | 2.27e-20 | 7.89e-10 | 0.7024 |
| 1. PBF | Q0WAP4 | Xaa-Pro dipeptidase | 0.00e+00 | 2.25e-18 | 1.60e-07 | 0.6802 |
| 1. PBF | C5PHM7 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 7.98e-14 | 6.12e-23 | 0.809 |
| 1. PBF | D1ZBF6 | Probable Xaa-Pro aminopeptidase PEPP | 5.55e-16 | 4.63e-13 | 2.08e-14 | 0.7778 |
| 1. PBF | B6I4I7 | Xaa-Pro dipeptidase | 0.00e+00 | 2.61e-21 | 6.11e-08 | 0.7202 |
| 1. PBF | B2AW39 | Probable Xaa-Pro aminopeptidase PODANS_7_5850 | 8.88e-16 | 9.63e-13 | 9.36e-15 | 0.7645 |
| 1. PBF | C5K105 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 2.65e-06 | 7.67e-05 | 0.7677 |
| 1. PBF | E5ABQ8 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 7.69e-05 | 0.002 | 0.7743 |
| 1. PBF | A6RK67 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 1.08e-03 | 2.45e-08 | 0.7739 |
| 1. PBF | B5BIZ1 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7043 |
| 1. PBF | E3S6N7 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 4.56e-13 | 2.02e-23 | 0.7781 |
| 1. PBF | B6Q8T5 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 3.98e-18 | 5.93e-28 | 0.8092 |
| 1. PBF | O58885 | Xaa-Pro dipeptidase | 0.00e+00 | 2.48e-74 | 2.29e-73 | 0.9165 |
| 1. PBF | C1H978 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 4.09e-06 | 1.12e-06 | 0.7529 |
| 1. PBF | C5P7J2 | Probable Xaa-Pro aminopeptidase P | 4.44e-16 | 3.06e-03 | 6.25e-04 | 0.7659 |
| 1. PBF | O25681 | Aminopeptidase HP_1037 | 0.00e+00 | 2.98e-57 | 1.24e-44 | 0.8679 |
| 1. PBF | Q4WUD3 | Probable Xaa-Pro aminopeptidase P | 2.22e-16 | 3.24e-05 | 3.64e-05 | 0.7214 |
| 1. PBF | P38488 | Creatinase | 0.00e+00 | 6.06e-29 | 9.08e-11 | 0.8338 |
| 1. PBF | A3CYJ5 | Xaa-Pro dipeptidase | 1.11e-16 | 3.12e-20 | 4.10e-11 | 0.7213 |
| 1. PBF | Q5R9W8 | Xaa-Pro aminopeptidase 3 | 0.00e+00 | 5.69e-08 | 4.82e-22 | 0.8205 |
| 1. PBF | E9F9J8 | Probable Xaa-Pro aminopeptidase MAA_08947 | 0.00e+00 | 2.09e-15 | 7.95e-22 | 0.7943 |
| 1. PBF | Q9L6L4 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7048 |
| 1. PBF | A0KR51 | Xaa-Pro dipeptidase | 0.00e+00 | 2.70e-18 | 1.56e-11 | 0.7159 |
| 1. PBF | A6WHA1 | Xaa-Pro dipeptidase | 0.00e+00 | 3.47e-19 | 4.73e-11 | 0.7121 |
| 1. PBF | Q2S6U2 | Xaa-Pro dipeptidase | 0.00e+00 | 4.05e-19 | 3.27e-07 | 0.7167 |
| 1. PBF | B5XYG9 | Xaa-Pro dipeptidase | 0.00e+00 | 4.12e-19 | 6.01e-09 | 0.7041 |
| 1. PBF | Q4WRV9 | Probable Xaa-Pro aminopeptidase AFUA_1G14920 | 0.00e+00 | 6.82e-15 | 1.34e-22 | 0.7978 |
| 1. PBF | E4ZHV7 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 1.34e-04 | 4.83e-23 | 0.7796 |
| 1. PBF | Q2HA12 | Probable Xaa-Pro aminopeptidase CHGG_02942 | 3.33e-15 | 3.98e-12 | 3.29e-18 | 0.7898 |
| 1. PBF | P65811 | Probable dipeptidase PepE | 0.00e+00 | 3.45e-61 | 2.03e-38 | 0.8496 |
| 1. PBF | B7N2F3 | Xaa-Pro dipeptidase | 0.00e+00 | 7.89e-21 | 3.15e-08 | 0.7207 |
| 1. PBF | B4SI11 | Xaa-Pro dipeptidase | 1.11e-16 | 1.54e-20 | 1.22e-04 | 0.6996 |
| 1. PBF | Q3BPR2 | Xaa-Pro dipeptidase | 0.00e+00 | 2.20e-20 | 2.22e-05 | 0.6716 |
| 1. PBF | A4STF0 | Xaa-Pro dipeptidase | 1.11e-16 | 3.13e-19 | 3.03e-05 | 0.729 |
| 1. PBF | Q9PL68 | Methionine aminopeptidase | 1.08e-11 | 3.00e-02 | 3.66e-17 | 0.7169 |
| 1. PBF | A4RAE9 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 1.60e-15 | 2.62e-24 | 0.8049 |
| 1. PBF | B4TBS6 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7043 |
| 1. PBF | Q7CPD4 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7047 |
| 1. PBF | A3MYG3 | Xaa-Pro dipeptidase | 1.11e-16 | 1.20e-15 | 3.54e-09 | 0.6959 |
| 1. PBF | Q49YD7 | Uncharacterized peptidase SSP1059 | 0.00e+00 | 3.49e-70 | 7.74e-64 | 0.8906 |
| 1. PBF | B2AWV6 | Probable Xaa-Pro aminopeptidase P | 1.11e-15 | 1.49e-02 | 4.86e-11 | 0.7735 |
| 1. PBF | P46545 | Xaa-Pro dipeptidase | 0.00e+00 | 2.60e-73 | 4.41e-51 | 0.9037 |
| 1. PBF | C5FHR9 | Probable Xaa-Pro aminopeptidase P | 1.71e-09 | 2.76e-04 | 9.73e-07 | 0.5746 |
| 1. PBF | A1D1S6 | Probable Xaa-Pro aminopeptidase NFIA_010500 | 0.00e+00 | 9.77e-13 | 3.96e-23 | 0.7887 |
| 1. PBF | B8CHA2 | Xaa-Pro dipeptidase | 0.00e+00 | 6.25e-18 | 2.96e-10 | 0.7182 |
| 1. PBF | B6QAW7 | Probable Xaa-Pro aminopeptidase PMAA_074180 | 2.22e-16 | 3.94e-05 | 6.33e-20 | 0.6752 |
| 1. PBF | Q4UY33 | Xaa-Pro dipeptidase | 1.11e-16 | 1.36e-20 | 1.56e-06 | 0.6991 |
| 1. PBF | A7MQN9 | Xaa-Pro dipeptidase | 0.00e+00 | 2.91e-21 | 4.43e-10 | 0.696 |
| 1. PBF | D4B0B2 | Probable Xaa-Pro aminopeptidase ARB_01886 | 0.00e+00 | 2.99e-15 | 5.11e-21 | 0.7916 |
| 1. PBF | B8MZI5 | Probable Xaa-Pro aminopeptidase AFLA_084750 | 0.00e+00 | 2.93e-13 | 3.31e-23 | 0.8078 |
| 1. PBF | P0A3Z2 | Xaa-Pro aminopeptidase 1 | 0.00e+00 | 1.47e-11 | 2.18e-19 | 0.7409 |
| 1. PBF | B1KCZ4 | Xaa-Pro dipeptidase | 0.00e+00 | 5.27e-20 | 2.78e-09 | 0.7103 |
| 1. PBF | B5QW86 | Xaa-Pro dipeptidase | 0.00e+00 | 1.69e-20 | 1.06e-09 | 0.7052 |
| 1. PBF | Q48AT5 | Xaa-Pro dipeptidase | 1.11e-16 | 2.49e-18 | 6.71e-10 | 0.7234 |
| 1. PBF | B4EWE3 | Xaa-Pro dipeptidase | 0.00e+00 | 6.68e-18 | 7.24e-06 | 0.7395 |
| 1. PBF | O84913 | Xaa-Pro dipeptidase | 0.00e+00 | 1.84e-73 | 1.11e-44 | 0.8989 |
| 1. PBF | A7ENP9 | Probable Xaa-Pro aminopeptidase SS1G_06948 | 0.00e+00 | 2.76e-14 | 1.88e-20 | 0.7721 |
| 1. PBF | Q6G8L9 | Uncharacterized peptidase SAS1635 | 0.00e+00 | 3.07e-66 | 1.27e-64 | 0.9045 |
| 1. PBF | B7NFE8 | Xaa-Pro dipeptidase | 1.11e-16 | 6.97e-21 | 3.45e-08 | 0.7182 |
| 1. PBF | C7YVN8 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 3.35e-19 | 1.86e-21 | 0.7888 |
| 1. PBF | A0KEL3 | Xaa-Pro dipeptidase | 0.00e+00 | 1.63e-20 | 7.41e-05 | 0.7296 |
| 1. PBF | O84859 | Methionine aminopeptidase | 1.41e-11 | 1.71e-02 | 2.25e-17 | 0.7044 |
| 1. PBF | P9WK18 | Methionine aminopeptidase 2 | 1.11e-16 | 1.23e-02 | 2.59e-10 | 0.7593 |
| 1. PBF | C9SDK8 | Probable Xaa-Pro aminopeptidase VDBG_02538 | 0.00e+00 | 3.20e-18 | 5.57e-19 | 0.8099 |
| 1. PBF | C5A021 | Xaa-Pro dipeptidase | 0.00e+00 | 6.97e-21 | 3.45e-08 | 0.7196 |
| 1. PBF | B2K0Z7 | Xaa-Pro dipeptidase | 0.00e+00 | 2.49e-18 | 4.63e-08 | 0.69 |
| 1. PBF | B7LTY8 | Xaa-Pro dipeptidase | 0.00e+00 | 2.03e-21 | 3.24e-08 | 0.6799 |
| 1. PBF | B2WMQ2 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 4.91e-13 | 5.33e-24 | 0.7826 |
| 1. PBF | D5GAC6 | Probable Xaa-Pro aminopeptidase P | 2.22e-16 | 2.75e-05 | 3.41e-07 | 0.7621 |
| 1. PBF | Q1CN98 | Xaa-Pro dipeptidase | 0.00e+00 | 2.25e-18 | 1.60e-07 | 0.7118 |
| 1. PBF | A4TR26 | Xaa-Pro dipeptidase | 1.11e-16 | 2.25e-18 | 1.60e-07 | 0.705 |
| 1. PBF | Q9S6S1 | Xaa-Pro dipeptidase | 0.00e+00 | 2.60e-73 | 2.98e-51 | 0.9033 |
| 1. PBF | Q0CDB3 | Probable Xaa-Pro aminopeptidase P | 4.44e-16 | 4.86e-04 | 2.29e-05 | 0.774 |
| 1. PBF | A8P5H7 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 3.24e-05 | 4.84e-09 | 0.7939 |
| 1. PBF | P44881 | Xaa-Pro aminopeptidase | 0.00e+00 | 7.75e-28 | 1.15e-29 | 0.8108 |
| 1. PBF | Q3IJ21 | Xaa-Pro dipeptidase | 0.00e+00 | 8.02e-18 | 1.06e-08 | 0.7071 |
| 1. PBF | C6HNY5 | Probable Xaa-Pro aminopeptidase HCDG_07916 | 0.00e+00 | 2.52e-16 | 5.69e-27 | 0.7803 |
| 1. PBF | A7UWH7 | Probable Xaa-Pro aminopeptidase NCU11288 | 0.00e+00 | 3.65e-16 | 2.43e-21 | 0.8097 |
| 1. PBF | A6SDE9 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 2.85e-15 | 1.75e-21 | 0.7657 |
| 1. PBF | Q5HNJ7 | Uncharacterized peptidase SERP1271 | 0.00e+00 | 1.07e-65 | 1.57e-62 | 0.9 |
| 1. PBF | P19213 | Creatinase | 0.00e+00 | 3.05e-31 | 1.08e-10 | 0.8326 |
| 1. PBF | C1GHS9 | Probable Xaa-Pro aminopeptidase PADG_06815 | 0.00e+00 | 4.08e-16 | 2.86e-24 | 0.7816 |
| 1. PBF | A8A6V2 | Xaa-Pro dipeptidase | 0.00e+00 | 6.97e-21 | 3.45e-08 | 0.7136 |
| 1. PBF | Q5RFB3 | Xaa-Pro dipeptidase | 0.00e+00 | 1.06e-16 | 2.02e-15 | 0.7618 |
| 1. PBF | A1CSI0 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | 4.77e-14 | 3.30e-20 | 0.7982 |
| 1. PBF | Q8EKR8 | Xaa-Pro dipeptidase | 1.11e-16 | 7.63e-18 | 6.14e-12 | 0.742 |
| 1. PBF | A4RF35 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 1.03e-06 | 1.88e-07 | 0.7766 |
| 1. PBF | A9KU92 | Xaa-Pro dipeptidase | 1.11e-16 | 7.73e-20 | 3.09e-11 | 0.713 |
| 1. PBF | C5JQ04 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 1.72e-16 | 4.27e-27 | 0.7988 |
| 1. PBF | C4JY72 | Probable Xaa-Pro aminopeptidase UREG_07123 | 0.00e+00 | 2.42e-09 | 1.17e-23 | 0.7387 |
| 1. PBF | C0NDZ7 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 8.85e-06 | 2.62e-05 | 0.7809 |
| 1. PBF | P0A5J3 | Methionine aminopeptidase | 1.11e-16 | 1.23e-02 | 2.59e-10 | 0.7596 |
| 1. PBF | B8M2W9 | Probable Xaa-Pro aminopeptidase TSTA_094700 | 0.00e+00 | 1.43e-12 | 1.25e-22 | 0.7828 |
| 1. PBF | B2TVJ6 | Xaa-Pro dipeptidase | 0.00e+00 | 9.25e-21 | 6.45e-08 | 0.7197 |
| 1. PBF | Q12TB3 | Xaa-Pro dipeptidase | 1.11e-16 | 6.84e-20 | 3.25e-08 | 0.7085 |
| 1. PBF | C9SEV5 | Probable Xaa-Pro aminopeptidase PEPP | 2.07e-14 | 7.73e-06 | 4.97e-19 | 0.6503 |
| 1. PBF | C5GXZ9 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 2.41e-06 | 7.67e-05 | 0.7661 |
| 1. PBF | Q5BF48 | Probable Xaa-Pro aminopeptidase AN0832 | 0.00e+00 | 2.21e-18 | 1.62e-30 | 0.7852 |
| 1. PBF | Q5AVF0 | Probable Xaa-Pro aminopeptidase P | 3.33e-16 | 1.25e-03 | 1.96e-06 | 0.7558 |
| 1. PBF | A9MYB1 | Xaa-Pro dipeptidase | 0.00e+00 | 1.63e-20 | 1.31e-09 | 0.7045 |
| 1. PBF | B8NEI6 | Probable Xaa-Pro aminopeptidase P | 3.33e-16 | 3.43e-04 | 3.73e-06 | 0.749 |
| 1. PBF | D1ZKF3 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 1.45e-06 | 4.42e-10 | 0.7595 |
| 1. PBF | Q0HPB6 | Xaa-Pro dipeptidase | 0.00e+00 | 1.38e-18 | 1.43e-11 | 0.7174 |
| 1. PBF | E3S7K9 | Probable Xaa-Pro aminopeptidase P | 2.22e-16 | 4.26e-03 | 0.003 | 0.7783 |
| 1. PBF | Q0UFY4 | Probable Xaa-Pro aminopeptidase P | 4.44e-16 | 3.79e-03 | 3.24e-07 | 0.7714 |
| 1. PBF | B6HQC9 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 3.50e-07 | 4.30e-06 | 0.7618 |
| 1. PBF | P9WHS6 | Probable dipeptidase PepE | 0.00e+00 | 3.45e-61 | 2.03e-38 | 0.8485 |
| 1. PBF | E4USI8 | Probable Xaa-Pro aminopeptidase P | 2.22e-16 | 1.35e-03 | 1.19e-06 | 0.7662 |
| 1. PBF | A1AI34 | Xaa-Pro dipeptidase | 0.00e+00 | 5.63e-21 | 2.96e-08 | 0.7211 |
| 1. PBF | Q15ZF7 | Xaa-Pro dipeptidase | 0.00e+00 | 6.25e-18 | 4.16e-08 | 0.7184 |
| 1. PBF | C0SCV1 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 1.55e-05 | 5.62e-08 | 0.7609 |
| 1. PBF | E3QCU0 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 4.61e-07 | 3.39e-08 | 0.7607 |
| 1. PBF | Q8NW55 | Uncharacterized peptidase MW1651 | 0.00e+00 | 7.28e-68 | 8.46e-65 | 0.9018 |
| 1. PBF | A1CAQ1 | Probable Xaa-Pro aminopeptidase P | 6.66e-16 | 1.24e-04 | 2.93e-05 | 0.7613 |
| 1. PBF | A7E4T8 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 6.88e-04 | 3.72e-08 | 0.7589 |
| 1. PBF | B7M650 | Xaa-Pro dipeptidase | 0.00e+00 | 2.61e-21 | 6.11e-08 | 0.6887 |
| 1. PBF | A8GYG1 | Xaa-Pro dipeptidase | 0.00e+00 | 2.07e-18 | 5.78e-11 | 0.7292 |
| 1. PBF | Q1R465 | Xaa-Pro dipeptidase | 0.00e+00 | 5.63e-21 | 2.96e-08 | 0.6894 |
| 1. PBF | C0SDW6 | Probable Xaa-Pro aminopeptidase PABG_05921 | 0.00e+00 | 4.08e-16 | 2.86e-24 | 0.7925 |
| 1. PBF | C0NIF0 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 5.58e-15 | 2.80e-24 | 0.8067 |
| 1. PBF | C6H7R7 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 6.93e-15 | 3.06e-24 | 0.8075 |
| 1. PBF | A4Y1B7 | Xaa-Pro dipeptidase | 1.11e-16 | 6.10e-19 | 7.31e-11 | 0.7136 |
| 1. PBF | Q83PG0 | Xaa-Pro dipeptidase | 0.00e+00 | 3.67e-21 | 3.12e-08 | 0.7236 |
| 1. PBF | A1CNW6 | Probable Xaa-Pro aminopeptidase ACLA_020440 | 0.00e+00 | 2.41e-13 | 4.89e-21 | 0.8204 |
| 1. PBF | Q7A552 | Uncharacterized peptidase SA1530 | 0.00e+00 | 3.07e-66 | 1.27e-64 | 0.9033 |
| 1. PBF | P77814 | Xaa-Pro dipeptidase | 0.00e+00 | 4.11e-18 | 3.25e-08 | 0.7019 |
| 1. PBF | B1XAK9 | Xaa-Pro dipeptidase | 1.11e-16 | 6.97e-21 | 3.45e-08 | 0.7183 |
| 1. PBF | P54518 | Uncharacterized peptidase YqhT | 0.00e+00 | 1.40e-78 | 3.75e-81 | 0.9586 |
| 1. PBF | Q66FR7 | Xaa-Pro dipeptidase | 0.00e+00 | 2.49e-18 | 4.63e-08 | 0.709 |
| 1. PBF | O31689 | Putative dipeptidase YkvY | 0.00e+00 | 1.20e-75 | 8.03e-55 | 0.9134 |
| 1. PBF | Q0TAK9 | Xaa-Pro dipeptidase | 0.00e+00 | 5.63e-21 | 2.96e-08 | 0.6881 |
| 1. PBF | P27875 | Agropine synthesis cyclase | 0.00e+00 | 2.96e-39 | 9.96e-20 | 0.8295 |
| 1. PBF | B8F8H3 | Xaa-Pro dipeptidase | 1.11e-16 | 1.58e-17 | 4.30e-06 | 0.7361 |
| 1. PBF | C1GD57 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 1.39e-15 | 4.43e-26 | 0.8181 |
| 1. PBF | Q2NWT2 | Xaa-Pro dipeptidase | 0.00e+00 | 7.59e-20 | 5.05e-08 | 0.6749 |
| 1. PBF | Q6GFZ9 | Uncharacterized peptidase SAR1786 | 0.00e+00 | 2.72e-66 | 3.77e-63 | 0.9027 |
| 1. PBF | Q0U6G5 | Probable Xaa-Pro aminopeptidase PEPP | 0.00e+00 | 5.00e-14 | 5.41e-21 | 0.793 |
| 1. PBF | B7MHD2 | Xaa-Pro dipeptidase | 0.00e+00 | 5.63e-21 | 2.96e-08 | 0.6881 |
| 1. PBF | A8ACZ6 | Xaa-Pro dipeptidase | 0.00e+00 | 7.59e-20 | 6.20e-11 | 0.7045 |
| 2. PF | E9EUE6 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 2.50e-06 | NA | 0.777 |
| 2. PF | A1JIG5 | Xaa-Pro dipeptidase | 1.11e-16 | 8.47e-15 | NA | 0.6672 |
| 2. PF | E9E9B2 | Probable Xaa-Pro aminopeptidase P | 1.11e-16 | 1.04e-06 | NA | 0.7677 |
| 3. BF | Q59509 | Methionine aminopeptidase | 0.00e+00 | NA | 3.07e-17 | 0.7761 |
| 3. BF | Q6CP80 | Methionine aminopeptidase 2 | 1.03e-06 | NA | 0.002 | 0.5547 |
| 3. BF | Q9Z6Q0 | Methionine aminopeptidase | 1.35e-11 | NA | 4.09e-15 | 0.7025 |
| 3. BF | D4D891 | Probable Xaa-Pro aminopeptidase P | 5.44e-15 | NA | 3.12e-05 | 0.7182 |
| 3. BF | P50614 | Methionine aminopeptidase | 0.00e+00 | NA | 2.25e-15 | 0.7706 |
| 3. BF | Q2GSJ7 | Methionine aminopeptidase 2-1 | 9.00e-08 | NA | 0.046 | 0.5263 |
| 3. BF | P99121 | Methionine aminopeptidase | 3.33e-16 | NA | 2.51e-14 | 0.749 |
| 3. BF | Q89AP3 | Methionine aminopeptidase | 0.00e+00 | NA | 1.03e-08 | 0.7023 |
| 3. BF | P0A1X7 | Methionine aminopeptidase | 0.00e+00 | NA | 3.55e-12 | 0.7627 |
| 3. BF | Q5I0A0 | Methionine aminopeptidase 1 | 6.14e-08 | NA | 3.16e-10 | 0.748 |
| 3. BF | P0AE21 | Methionine aminopeptidase | 0.00e+00 | NA | 7.20e-13 | 0.7511 |
| 3. BF | Q5HN46 | Methionine aminopeptidase | 6.66e-16 | NA | 1.63e-11 | 0.7421 |
| 3. BF | O34484 | Methionine aminopeptidase 2 | 0.00e+00 | NA | 7.68e-08 | 0.7516 |
| 3. BF | P0AE20 | Methionine aminopeptidase | 0.00e+00 | NA | 7.20e-13 | 0.764 |
| 3. BF | A5DR89 | Methionine aminopeptidase 2 | 3.18e-07 | NA | 0.049 | 0.7334 |
| 3. BF | P56218 | Methionine aminopeptidase | 1.56e-12 | NA | 4.07e-05 | 0.6304 |
| 3. BF | Q5ZIM5 | Methionine aminopeptidase 1 | 2.22e-07 | NA | 2.04e-10 | 0.7455 |
| 3. BF | Q2U6H2 | Methionine aminopeptidase 2 | 2.23e-09 | NA | 0.040 | 0.5298 |
| 3. BF | O52353 | Methionine aminopeptidase | 3.33e-16 | NA | 9.02e-12 | 0.7716 |
| 3. BF | P0AE19 | Methionine aminopeptidase | 0.00e+00 | NA | 7.20e-13 | 0.7638 |
| 3. BF | Q11132 | Methionine aminopeptidase | 1.11e-16 | NA | 3.15e-08 | 0.7903 |
| 3. BF | E3RD74 | Methionine aminopeptidase 2-2 | 2.35e-10 | NA | 0.036 | 0.5408 |
| 3. BF | B6YTG0 | Methionine aminopeptidase | 1.66e-12 | NA | 9.16e-06 | 0.621 |
| 3. BF | P19994 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 3.22e-13 | 0.786 |
| 3. BF | Q9ZJT0 | Methionine aminopeptidase | 0.00e+00 | NA | 1.66e-12 | 0.7836 |
| 3. BF | Q9Z9J4 | Methionine aminopeptidase | 0.00e+00 | NA | 9.28e-18 | 0.8041 |
| 3. BF | Q6FWT4 | FACT complex subunit SPT16 | 3.78e-11 | NA | 0.008 | 0.7526 |
| 3. BF | P0A080 | Methionine aminopeptidase | 3.33e-16 | NA | 2.51e-14 | 0.7486 |
| 3. BF | P0A1X6 | Methionine aminopeptidase | 0.00e+00 | NA | 3.55e-12 | 0.7648 |
| 3. BF | P0CQ23 | FACT complex subunit SPT16 | 4.31e-11 | NA | 1.60e-05 | 0.8057 |
| 3. BF | Q8X0X6 | FACT complex subunit ctc-2 | 4.31e-11 | NA | 4.88e-06 | 0.7895 |
| 3. BF | P69000 | Methionine aminopeptidase | 0.00e+00 | NA | 1.04e-19 | 0.7759 |
| 3. BF | P56102 | Methionine aminopeptidase | 0.00e+00 | NA | 7.11e-12 | 0.7875 |
| 3. BF | P53580 | Methionine aminopeptidase B | 2.22e-16 | NA | 7.02e-12 | 0.7325 |
| 3. BF | O51132 | Methionine aminopeptidase | 0.00e+00 | NA | 1.29e-15 | 0.7928 |
| 3. BF | Q9UYT4 | Methionine aminopeptidase | 1.30e-12 | NA | 6.61e-06 | 0.6338 |
| 3. BF | Q5HEN6 | Methionine aminopeptidase | 3.33e-16 | NA | 2.51e-14 | 0.7489 |
| 3. BF | Q8K9T1 | Methionine aminopeptidase | 0.00e+00 | NA | 6.08e-11 | 0.7273 |
| 3. BF | B6H5L5 | Methionine aminopeptidase 2-1 | 2.49e-09 | NA | 0.050 | 0.5281 |
| 3. BF | Q0V147 | Probable Xaa-Pro aminopeptidase SNOG_02267 | 1.27e-13 | NA | 1.10e-25 | 0.7085 |
| 3. BF | Q9W603 | FACT complex subunit SPT16 | 2.27e-11 | NA | 2.31e-05 | 0.7875 |
| 3. BF | E3RNJ5 | Probable Xaa-Pro aminopeptidase PTT_10145 | 4.05e-13 | NA | 1.66e-24 | 0.787 |
| 3. BF | P0CQ22 | FACT complex subunit SPT16 | 4.96e-11 | NA | 1.60e-05 | 0.8087 |
| 3. BF | O27355 | Methionine aminopeptidase | 9.99e-15 | NA | 8.97e-10 | 0.6433 |
| 3. BF | Q7ZWV9 | Methionine aminopeptidase 1 | 2.40e-08 | NA | 1.17e-10 | 0.734 |
| 3. BF | B8NLL0 | Methionine aminopeptidase 2-2 | 2.00e-09 | NA | 0.040 | 0.5263 |
| 3. BF | P0A079 | Methionine aminopeptidase | 3.33e-16 | NA | 2.51e-14 | 0.7487 |
| 3. BF | A7EUB3 | Probable Xaa-Pro aminopeptidase pepP | 0.00e+00 | NA | 7.76e-21 | 0.7707 |
| 3. BF | Q5JGD1 | Methionine aminopeptidase | 1.11e-12 | NA | 3.01e-07 | 0.6246 |
| 3. BF | P53579 | Methionine aminopeptidase A | 0.00e+00 | NA | 1.95e-10 | 0.7666 |
| 3. BF | Q8CRU9 | Methionine aminopeptidase | 5.55e-16 | NA | 1.91e-11 | 0.7513 |
| 3. BF | D4ARJ9 | Probable Xaa-Pro aminopeptidase P | 8.66e-15 | NA | 2.36e-05 | 0.7354 |
| 3. BF | B2WKR4 | Probable Xaa-Pro aminopeptidase PTRG_10574 | 8.88e-16 | NA | 1.90e-24 | 0.8061 |
| 3. BF | P57324 | Methionine aminopeptidase | 0.00e+00 | NA | 4.34e-12 | 0.7376 |
| 3. BF | O83814 | Methionine aminopeptidase | 0.00e+00 | NA | 1.07e-20 | 0.748 |
| 3. BF | Q95333 | Xaa-Pro aminopeptidase 2 | 1.67e-15 | NA | 2.42e-11 | 0.7424 |
| 3. BF | P22624 | Methionine aminopeptidase (Fragment) | 7.96e-13 | NA | 0.017 | 0.7599 |
| 3. BF | O28438 | Methionine aminopeptidase | 1.28e-13 | NA | 1.51e-09 | 0.6405 |
| 3. BF | C5M8M4 | Methionine aminopeptidase 2 | 6.46e-07 | NA | 0.007 | 0.7498 |
| 3. BF | P9WK20 | Methionine aminopeptidase 1 | 4.44e-16 | NA | 0.004 | 0.7215 |
| 3. BF | Q6GFG9 | Methionine aminopeptidase | 3.33e-16 | NA | 2.51e-14 | 0.749 |
| 3. BF | A1CCP2 | Methionine aminopeptidase 2-1 | 3.65e-05 | NA | 0.029 | 0.5044 |
| 3. BF | Q9ZCD3 | Methionine aminopeptidase | 0.00e+00 | NA | 9.00e-18 | 0.7759 |
| 3. BF | O66489 | Methionine aminopeptidase | 0.00e+00 | NA | 4.49e-17 | 0.7186 |
| 3. BF | P0A078 | Methionine aminopeptidase | 3.33e-16 | NA | 2.51e-14 | 0.7487 |
| 3. BF | P47418 | Methionine aminopeptidase | 2.22e-16 | NA | 2.83e-12 | 0.7793 |
| 3. BF | O58362 | Methionine aminopeptidase | 1.32e-12 | NA | 6.09e-06 | 0.6209 |
| 3. BF | Q6G846 | Methionine aminopeptidase | 3.33e-16 | NA | 2.51e-14 | 0.7487 |
| 3. BF | Q5RBF3 | Methionine aminopeptidase 1 | 3.06e-07 | NA | 7.86e-12 | 0.7186 |
| 3. BF | P44421 | Methionine aminopeptidase | 0.00e+00 | NA | 3.84e-16 | 0.7255 |
| 3. BF | A6QLA4 | Methionine aminopeptidase 1 | 1.90e-07 | NA | 1.95e-12 | 0.7185 |
| 4. PB | Q55E60 | Xaa-Pro dipeptidase | 0.00e+00 | 2.32e-18 | 1.62e-21 | NA |
| 4. PB | Q9NQH7 | Xaa-Pro aminopeptidase 3 | 0.00e+00 | 3.29e-08 | 2.06e-22 | NA |
| 4. PB | O44750 | Xaa-Pro aminopeptidase app-1 | 0.00e+00 | 1.94e-07 | 1.80e-11 | NA |
| 4. PB | Q5I0D7 | Xaa-Pro dipeptidase | 0.00e+00 | 1.26e-15 | 6.21e-16 | NA |
| 4. PB | Q10439 | Intermediate cleaving peptidase 55 | 0.00e+00 | 1.33e-13 | 1.37e-16 | NA |
| 4. PB | P15034 | Xaa-Pro aminopeptidase | 0.00e+00 | 4.46e-25 | 3.72e-33 | NA |
| 4. PB | P21165 | Xaa-Pro dipeptidase | 1.11e-16 | 6.97e-21 | 3.45e-08 | NA |
| 4. PB | Q9FV51 | Methionine aminopeptidase 1C, chloroplastic/mitochondrial | 6.91e-09 | 3.88e-04 | 3.44e-22 | NA |
| 4. PB | P76524 | Aminopeptidase YpdF | 0.00e+00 | 5.09e-66 | 7.28e-67 | NA |
| 4. PB | P9WK19 | Methionine aminopeptidase 2 | 1.11e-16 | 1.23e-02 | 2.59e-10 | NA |
| 4. PB | P9WHS7 | Probable dipeptidase PepE | 0.00e+00 | 3.45e-61 | 2.03e-38 | NA |
| 4. PB | Q2FXL9 | Uncharacterized peptidase SAOUHSC_01816 | 0.00e+00 | 1.05e-66 | 9.66e-64 | NA |
| 4. PB | P12955 | Xaa-Pro dipeptidase | 0.00e+00 | 1.95e-16 | 4.02e-17 | NA |
| 4. PB | Q9UUD8 | Uncharacterized peptidase C18A7.01 | 0.00e+00 | 6.28e-12 | 6.23e-32 | NA |
| 4. PB | B7ZMP1 | Xaa-Pro aminopeptidase 3 | 0.00e+00 | 3.09e-08 | 1.21e-22 | NA |
| 4. PB | Q6P1B1 | Xaa-Pro aminopeptidase 1 | 1.11e-16 | 2.62e-07 | 9.45e-11 | NA |
| 4. PB | Q9VJG0 | Xaa-Pro aminopeptidase ApepP | 0.00e+00 | 4.78e-07 | 9.04e-11 | NA |
| 4. PB | P43590 | Uncharacterized peptidase YFR006W | 0.00e+00 | 8.88e-15 | 2.81e-20 | NA |
| 4. PB | Q99MA2 | Xaa-Pro aminopeptidase 2 | 1.33e-15 | 1.22e-02 | 4.59e-10 | NA |
| 4. PB | Q54G06 | Xaa-Pro aminopeptidase 1 | 2.22e-16 | 4.78e-08 | 3.88e-07 | NA |
| 4. PB | Q9CPW9 | Methionine aminopeptidase 1D, mitochondrial | 6.89e-14 | 2.86e-02 | 5.73e-13 | NA |
| 4. PB | B5DEQ3 | Xaa-Pro aminopeptidase 3 | 0.00e+00 | 1.40e-07 | 5.80e-22 | NA |
| 4. PB | F4HZG9 | Intermediate cleaving peptidase 55, mitochondrial | 0.00e+00 | 2.00e-19 | 5.35e-21 | NA |
| 4. PB | Q58216 | Uncharacterized peptidase MJ0806 | 0.00e+00 | 4.27e-63 | 1.64e-46 | NA |
| 4. PB | F4JQH3 | Aminopeptidase P1 | 1.11e-16 | 5.20e-06 | 2.91e-09 | NA |
| 4. PB | O43895 | Xaa-Pro aminopeptidase 2 | 1.33e-15 | 2.86e-02 | 1.88e-10 | NA |
| 4. PB | P40051 | Intermediate cleaving peptidase 55 | 0.00e+00 | 1.49e-10 | 1.79e-19 | NA |
| 4. PB | Q09795 | Uncharacterized peptidase C22G7.01c | 2.22e-16 | 7.50e-07 | 5.64e-08 | NA |
| 4. PB | O54975 | Xaa-Pro aminopeptidase 1 | 2.22e-16 | 5.99e-07 | 8.04e-11 | NA |
| 4. PB | Q11136 | Xaa-Pro dipeptidase | 0.00e+00 | 3.85e-17 | 3.97e-16 | NA |
| 4. PB | Q9NQW7 | Xaa-Pro aminopeptidase 1 | 2.22e-16 | 1.59e-06 | 1.15e-10 | NA |
| 4. PB | Q54T46 | Xaa-Pro aminopeptidase 3 | 0.00e+00 | 6.14e-05 | 1.63e-20 | NA |
| 6. F | P95963 | Methionine aminopeptidase | 1.63e-12 | NA | NA | 0.6343 |
| 6. F | Q4HYB8 | FACT complex subunit SPT16 | 2.68e-11 | NA | NA | 0.7773 |
| 6. F | D4DE65 | Methionine aminopeptidase 2 | 8.86e-07 | NA | NA | 0.6717 |
| 6. F | Q4WJ02 | FACT complex subunit spt16 | 3.34e-11 | NA | NA | 0.7618 |
| 6. F | Q756A7 | FACT complex subunit SPT16 | 2.59e-11 | NA | NA | 0.7304 |
| 6. F | Q4WAY7 | Methionine aminopeptidase 2-1 | 1.10e-06 | NA | NA | 0.6069 |
| 6. F | Q6XMH6 | Methionine aminopeptidase 2 | 1.49e-10 | NA | NA | 0.5535 |
| 6. F | D1ZEN1 | Methionine aminopeptidase 2 | 2.87e-07 | NA | NA | 0.7228 |
| 6. F | Q00976 | FACT complex subunit SPT16 | 5.64e-11 | NA | NA | 0.7309 |
| 6. F | D4B2G3 | Methionine aminopeptidase 2 | 6.84e-07 | NA | NA | 0.6745 |
| 6. F | Q8SR45 | Methionine aminopeptidase 2 | 1.39e-10 | NA | NA | 0.5461 |
| 6. F | C0SIM8 | Methionine aminopeptidase 2 | 8.71e-07 | NA | NA | 0.5046 |
| 6. F | B2VW14 | Methionine aminopeptidase 2-1 | 1.47e-09 | NA | NA | 0.5328 |
| 6. F | Q2GYA8 | Methionine aminopeptidase 2-2 | 3.20e-07 | NA | NA | 0.5413 |
| 6. F | B8M990 | Methionine aminopeptidase 2-2 | 1.75e-07 | NA | NA | 0.5196 |
| 6. F | B6QD96 | Methionine aminopeptidase 2-2 | 3.43e-10 | NA | NA | 0.5617 |
| 6. F | C5JYZ5 | Methionine aminopeptidase 2-2 | 9.99e-06 | NA | NA | 0.5262 |
| 6. F | C5P8Q4 | Methionine aminopeptidase 2 | 9.91e-07 | NA | NA | 0.5066 |
| 6. F | E5R3Z8 | Methionine aminopeptidase 2-2 | 8.27e-07 | NA | NA | 0.492 |
| 6. F | Q4WNT9 | Methionine aminopeptidase 2-3 | 2.38e-06 | NA | NA | 0.688 |
| 6. F | B0Y5N4 | Methionine aminopeptidase 2-2 | 2.36e-06 | NA | NA | 0.6883 |
| 6. F | E3L3Q8 | Methionine aminopeptidase 2 | 4.29e-07 | NA | NA | 0.5486 |
| 6. F | Q0C838 | Methionine aminopeptidase 2-1 | 1.66e-04 | NA | NA | 0.4624 |
| 6. F | C1HAB2 | Methionine aminopeptidase 2 | 8.11e-07 | NA | NA | 0.6033 |
| 6. F | B0CRL4 | Methionine aminopeptidase 2 | 6.41e-08 | NA | NA | 0.7332 |
| 6. F | Q2UBF1 | FACT complex subunit spt16 | 5.86e-11 | NA | NA | 0.7524 |
| 6. F | A8QBZ2 | Methionine aminopeptidase 2 | 2.31e-06 | NA | NA | 0.5029 |
| 6. F | M1CZC0 | ERBB-3 BINDING PROTEIN 1 | 4.52e-10 | NA | NA | 0.5589 |
| 6. F | B2W1N6 | Methionine aminopeptidase 2-2 | 3.76e-07 | NA | NA | 0.4986 |
| 6. F | A2QHX0 | Methionine aminopeptidase 2-2 | 2.58e-07 | NA | NA | 0.6955 |
| 6. F | Q6BXE5 | FACT complex subunit SPT16 | 3.01e-11 | NA | NA | 0.7665 |
| 6. F | B3LNM2 | Methionine aminopeptidase 2 | 1.95e-07 | NA | NA | 0.5457 |
| 6. F | Q6C931 | FACT complex subunit SPT16 | 5.24e-12 | NA | NA | 0.8099 |
| 6. F | Q0CL94 | Methionine aminopeptidase 2-2 | 3.94e-07 | NA | NA | 0.626 |
| 6. F | C5FEJ1 | Methionine aminopeptidase 2-1 | 1.58e-09 | NA | NA | 0.5331 |
| 6. F | C5JW60 | Methionine aminopeptidase 2-1 | 8.28e-07 | NA | NA | 0.4917 |
| 6. F | C7YS77 | Methionine aminopeptidase 2-1 | 1.15e-06 | NA | NA | 0.6105 |
| 6. F | C4Y1F8 | Methionine aminopeptidase 2 | 1.08e-06 | NA | NA | 0.664 |
| 6. F | C4YSA9 | Methionine aminopeptidase 2 | 2.82e-07 | NA | NA | 0.7443 |
| 6. F | B9WJA2 | Methionine aminopeptidase 2 | 2.99e-07 | NA | NA | 0.7387 |
| 6. F | C5DE35 | Methionine aminopeptidase 2 | 3.00e-06 | NA | NA | 0.7019 |
| 6. F | C4R2P3 | Methionine aminopeptidase 2 | 5.90e-06 | NA | NA | 0.6438 |
| 6. F | Q3ZC89 | Methionine aminopeptidase 2 | 1.83e-05 | NA | NA | 0.5156 |
| 6. F | A1DA84 | Methionine aminopeptidase 2-3 | 4.42e-07 | NA | NA | 0.7264 |
| 6. F | C0NIQ4 | Methionine aminopeptidase 2-1 | 7.95e-07 | NA | NA | 0.5014 |
| 6. F | E5R4J3 | Methionine aminopeptidase 2-2 | 4.58e-07 | NA | NA | 0.5168 |
| 6. F | C1GLM4 | Methionine aminopeptidase 2 | 7.89e-07 | NA | NA | 0.492 |
| 6. F | Q6CCY2 | Probable metalloprotease ARX1 | 1.80e-07 | NA | NA | 0.5014 |
| 6. F | C7GSF3 | Methionine aminopeptidase 2 | 2.04e-07 | NA | NA | 0.5101 |
| 6. F | Q5BGG1 | Methionine aminopeptidase 2-2 | 2.48e-09 | NA | NA | 0.5299 |
| 6. F | Q6CA79 | Methionine aminopeptidase 2 | 8.44e-06 | NA | NA | 0.4892 |
| 6. F | A5E5I9 | Methionine aminopeptidase 2 | 8.20e-07 | NA | NA | 0.6682 |
| 6. F | B8NA06 | Methionine aminopeptidase 2-1 | 4.23e-07 | NA | NA | 0.648 |
| 6. F | C5GLJ6 | Methionine aminopeptidase 2-2 | 2.25e-10 | NA | NA | 0.5261 |
| 6. F | A1CH02 | Methionine aminopeptidase 2-2 | 2.99e-07 | NA | NA | 0.7065 |
| 6. F | A1CXT5 | Methionine aminopeptidase 2-1 | 1.40e-06 | NA | NA | 0.7255 |
| 6. F | C8Z3V4 | Methionine aminopeptidase 2 | 3.36e-06 | NA | NA | 0.4924 |
| 6. F | C9SB49 | Methionine aminopeptidase 2 | 1.65e-06 | NA | NA | 0.4902 |
| 6. F | B6Q1N3 | Methionine aminopeptidase 2-1 | 3.52e-07 | NA | NA | 0.6347 |
| 6. F | D8PR70 | Methionine aminopeptidase 2 | 1.28e-06 | NA | NA | 0.7061 |
| 6. F | Q5B4X6 | Methionine aminopeptidase 2-1 | 1.15e-06 | NA | NA | 0.6238 |
| 6. F | A6RGC8 | Methionine aminopeptidase 2 | 1.48e-05 | NA | NA | 0.5435 |
| 6. F | Q4WII3 | Methionine aminopeptidase 2-2 | 3.36e-07 | NA | NA | 0.514 |
| 6. F | E3RCY7 | Methionine aminopeptidase 2-1 | 4.73e-07 | NA | NA | 0.4926 |
| 6. F | Q1GNR4 | Pantothenate synthetase | 7.52e-03 | NA | NA | 0.281 |
| 6. F | A6RTU0 | Methionine aminopeptidase 2 | 3.44e-07 | NA | NA | 0.5094 |
| 6. F | Q0C347 | Pantothenate synthetase | 3.51e-03 | NA | NA | 0.4584 |
| 6. F | B8LUH2 | Methionine aminopeptidase 2-1 | 3.67e-07 | NA | NA | 0.7081 |
| 6. F | A6ZKL2 | Methionine aminopeptidase 2 | 2.09e-07 | NA | NA | 0.5101 |
| 6. F | A7EZ86 | Methionine aminopeptidase 2 | 4.99e-06 | NA | NA | 0.5627 |
| 6. F | Q7S7L7 | Methionine aminopeptidase 2 | 1.06e-06 | NA | NA | 0.6188 |
| 6. F | E3QW41 | Methionine aminopeptidase 2-2 | 1.57e-06 | NA | NA | 0.6119 |
| 6. F | B2B738 | Methionine aminopeptidase 2 | 1.21e-06 | NA | NA | 0.4911 |
| 6. F | Q6XMH7 | Methionine aminopeptidase 2 | 1.55e-10 | NA | NA | 0.5667 |
| 6. F | B6HTQ4 | Methionine aminopeptidase 2-2 | 1.54e-06 | NA | NA | 0.5444 |
| 6. F | E3QDQ4 | Methionine aminopeptidase 2-1 | 2.57e-09 | NA | NA | 0.5175 |
| 6. F | C0NX86 | Methionine aminopeptidase 2-2 | 9.58e-07 | NA | NA | 0.5421 |
| 6. F | C6HI66 | Methionine aminopeptidase 2 | 1.32e-10 | NA | NA | 0.5414 |
| 6. F | E5R278 | Methionine aminopeptidase 2-1 | 9.55e-07 | NA | NA | 0.5211 |
| 6. F | Q6BVB8 | Methionine aminopeptidase 2 | 6.65e-07 | NA | NA | 0.5608 |
| 6. F | Q61E63 | FACT complex subunit spt-16 | 1.25e-11 | NA | NA | 0.7906 |
| 6. F | Q4P2U5 | FACT complex subunit SPT16 | 2.61e-11 | NA | NA | 0.7838 |
| 6. F | B0XTJ7 | Methionine aminopeptidase 2-1 | 3.49e-07 | NA | NA | 0.5126 |
| 6. F | B0YAX5 | Methionine aminopeptidase 2-3 | 4.42e-07 | NA | NA | 0.6175 |
| 6. F | A2QAF9 | Methionine aminopeptidase 2-1 | 2.12e-07 | NA | NA | 0.5948 |
| 6. F | A1CYM1 | Methionine aminopeptidase 2-2 | 2.86e-05 | NA | NA | 0.4989 |
| 6. F | Q0UTI9 | Methionine aminopeptidase 2 | 8.60e-07 | NA | NA | 0.7178 |
| 6. F | Q5B2X8 | FACT complex subunit spt16 | 2.89e-11 | NA | NA | 0.73 |
| 6. F | A4RDI6 | Methionine aminopeptidase 2 | 3.47e-07 | NA | NA | 0.6953 |
| 6. F | C7Z7V7 | Methionine aminopeptidase 2-2 | 9.06e-08 | NA | NA | 0.4971 |
| 6. F | B5VDQ0 | Methionine aminopeptidase 2 | 1.62e-07 | NA | NA | 0.4967 |
| 6. F | C5FF46 | Methionine aminopeptidase 2-2 | 8.45e-07 | NA | NA | 0.5987 |
| 6. F | C5GCN0 | Methionine aminopeptidase 2-1 | 8.82e-07 | NA | NA | 0.4893 |
| 6. F | C4JSX6 | Methionine aminopeptidase 2 | 9.03e-07 | NA | NA | 0.5021 |
| 6. F | Q2VZ00 | Pantothenate synthetase | 4.68e-03 | NA | NA | 0.315 |
| 7. B | Q9Y5B9 | FACT complex subunit SPT16 | 2.68e-11 | NA | 2.49e-08 | NA |
| 7. B | P0AE18 | Methionine aminopeptidase | 0.00e+00 | NA | 7.20e-13 | NA |
| 7. B | Q07825 | Putative Xaa-Pro aminopeptidase FRA1 | 3.36e-14 | NA | 7.00e-07 | NA |
| 7. B | O94267 | FACT complex subunit spt16 | 2.41e-11 | NA | 1.03e-07 | NA |
| 7. B | P53582 | Methionine aminopeptidase 1 | 2.00e-07 | NA | 4.71e-12 | NA |
| 7. B | Q8BP48 | Methionine aminopeptidase 1 | 2.15e-07 | NA | 2.60e-11 | NA |
| 7. B | Q8IJP2 | Methionine aminopeptidase 1b | 1.27e-06 | NA | 4.60e-11 | NA |
| 7. B | Q8IRG6 | FACT complex subunit spt16 | 5.11e-11 | NA | 4.71e-07 | NA |
| 7. B | O82491 | FACT complex subunit SPT16 | 2.53e-11 | NA | 2.16e-04 | NA |
| 7. B | Q9FV50 | Methionine aminopeptidase 1D, chloroplastic/mitochondrial | 6.66e-16 | NA | 5.96e-16 | NA |
| 7. B | Q920B9 | FACT complex subunit SPT16 | 2.53e-11 | NA | 2.65e-08 | NA |
| 7. B | Q5A1D5 | FACT complex subunit SPT16 | 1.96e-11 | NA | 0.003 | NA |
| 7. B | O59730 | Methionine aminopeptidase 1 | 5.55e-07 | NA | 4.54e-13 | NA |
| 7. B | Q01662 | Methionine aminopeptidase 1 | 9.89e-08 | NA | 8.49e-12 | NA |
| 7. B | Q6UB28 | Methionine aminopeptidase 1D, mitochondrial | 1.63e-14 | NA | 4.98e-13 | NA |
| 7. B | Q54VU7 | Methionine aminopeptidase 1D, mitochondrial | 4.50e-09 | NA | 4.42e-14 | NA |
| 7. B | Q54S43 | FACT complex subunit SPT16 | 5.26e-11 | NA | 1.44e-04 | NA |
| 7. B | B1AVD1 | Xaa-Pro aminopeptidase 2 | 1.33e-15 | NA | 4.16e-10 | NA |
| 7. B | P9WK21 | Methionine aminopeptidase 1 | 1.44e-15 | NA | 0.004 | NA |
| 7. B | Q9SLN5 | Methionine aminopeptidase 1A | 4.08e-07 | NA | 2.38e-14 | NA |
| 7. B | Q4QRK0 | Methionine aminopeptidase 1 | 6.06e-08 | NA | 1.15e-11 | NA |
| 7. B | Q9FV52 | Methionine aminopeptidase 1B, chloroplastic | 4.26e-09 | NA | 3.23e-21 | NA |
| 7. B | E4ZYY3 | Methionine aminopeptidase 2-1 | 1.05e-09 | NA | 0.047 | NA |
| 7. B | Q54WU3 | Methionine aminopeptidase 1 | 9.65e-08 | NA | 5.63e-12 | NA |
| 7. B | Q4VBS4 | Methionine aminopeptidase 1D, mitochondrial | 1.55e-14 | NA | 4.50e-11 | NA |
| 7. B | Q8RY11 | Aminopeptidase P2 | 6.66e-16 | NA | 2.68e-09 | NA |