Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54716.1
JCVISYN3A_0314

Uncharacterized ECF transporter S component.
M. mycoides homolog: Q6MTM7.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 26
Unique PROST Go: 17
Unique BLAST Go: 7
Unique Foldseek Go: 0

Total Homologs: 164
Unique PROST Homologs: 162
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Aspartyl-tRNA /glutamyl-tRNA amidotransferase subunit C
Antczak et al. [3]: S component of ECF transporter with possible substrate vitamins, e.g. folate
Zhang et al. [4]: GO:0006935|chemotaxis
Bianchi et al. [5]: ECF transporter S-component

Structures and Sequence Alignment

The best structural homolog that predicted by 4. PB was A0Q1J7 (Folate transporter FolT) with a FATCAT P-Value: 5.46e-14 and RMSD of 2.96 angstrom. The sequence alignment identity is 23.8%.
Structural alignment shown in left. Query protein AVX54716.1 colored as red in alignment, homolog A0Q1J7 colored as blue. Query protein AVX54716.1 is also shown in right top, homolog A0Q1J7 showed in right bottom. They are colored based on secondary structures. 

  AVX54716.1 MLFFLTNGAAICVIILLFAIAYMMDPKFLKTITTTKI-TM--MAMQVALIVLLTNFLG-YSGVFGARLMLGNFI-LFLSGMLFGP-MGGALVGALSYTAG 94
      A0Q1J7 ----------------------------MK-----KVNVMIYMAFMITLEIVFTRFLSIQTPII--RIGFG-FIPVAMSGMMFGPLLAG-IVGATSDVLG 63

  AVX54716.1 -MVNP-GIFIHFSFMAAYMIYAMLGSL---VFIKKQKSRLSFMISV-FVLLFIASFTLTFISHPIAM----LAI--GKNA--YVYVT-LVKKFIVFPIDA 179
      A0Q1J7 MMIFPKG-----AYFPGFTLSAFVGAVIYGVFFYNKK------VSVKRVLLAVGIITV-LVN--LTMNTIWLQILTGK-AVKVLFVTRLVKEAIMFPIHA 148

  AVX54716.1 VIEPILIISTFEVSILVLKRVPNTWNQLWCTRFDSLEFLNKQEKKSKKDLKITQNEPIITSQASN 244
      A0Q1J7 IV------------------IYGAWKMV-----DRLEIMNKVAKFNK------------------ 172

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
4. PB GO:0022857 transmembrane transporter activity
4. PB GO:0005542 folic acid binding
5. P GO:0009372 quorum sensing
5. P GO:0015087 cobalt ion transmembrane transporter activity
5. P GO:0016021 integral component of membrane
5. P GO:0005886 plasma membrane
5. P GO:0015225 biotin transmembrane transporter activity
5. P GO:0005737 cytoplasm
5. P GO:0009236 cobalamin biosynthetic process
5. P GO:1990397 queuosine salvage
5. P GO:0032217 riboflavin transmembrane transporter activity
5. P GO:0032218 riboflavin transport
5. P GO:0015234 thiamine transmembrane transporter activity
5. P GO:0008233 peptidase activity
5. P GO:0015675 nickel cation transport
5. P GO:0043190 ATP-binding cassette (ABC) transporter complex
5. P GO:0000041 transition metal ion transport
5. P GO:0072531 pyrimidine-containing compound transmembrane transport
5. P GO:0006824 cobalt ion transport
7. B GO:0004169 dolichyl-phosphate-mannose-protein mannosyltransferase activity
7. B GO:0005783 endoplasmic reticulum
7. B GO:0097582 dolichyl-phosphate-mannose-protein mannosyltransferase Pmt1p-Pmt2p dimer complex
7. B GO:0006493 protein O-linked glycosylation
7. B GO:0035269 protein O-linked mannosylation
7. B GO:0005789 endoplasmic reticulum membrane
7. B GO:0071712 ER-associated misfolded protein catabolic process

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
4. PB A0Q1J7 Folate transporter FolT 5.46e-14 5.89e-10 0.008 NA
5. P A2RIQ0 Pantothenic acid transporter PanT 1.41e-08 1.78e-02 NA NA
5. P F2MNH8 Protein FsrB 7.00e-03 9.40e-03 NA NA
5. P Q8DV98 Folate transporter FolT 6.27e-13 4.31e-05 NA NA
5. P B1MWU5 UPF0397 protein LCK_00164 1.31e-12 3.49e-09 NA NA
5. P Q037U3 Thiamine transporter ThiT 3.96e-04 1.24e-02 NA NA
5. P B5E1T5 UPF0397 protein SPG_0438 1.07e-12 9.30e-10 NA NA
5. P A6LKX5 Cobalt transport protein CbiM 7.24e-09 6.51e-05 NA NA
5. P P50726 Riboflavin transporter FmnP 5.39e-08 1.55e-04 NA NA
5. P Q03WN0 Riboflavin transporter RibU 5.15e-11 4.10e-05 NA NA
5. P B0R611 Putative cobalt transport protein CbiM 7.07e-07 1.00e-12 NA NA
5. P B7JQN4 UPF0397 protein BCAH820_2657 3.45e-13 8.24e-09 NA NA
5. P A2SSE8 Putative cobalt transport protein CbiM 2 2.96e-09 1.38e-21 NA NA
5. P Q6HI77 UPF0397 protein BT9727_2423 4.11e-13 2.11e-08 NA NA
5. P Q2NKB3 UPF0397 protein AYWB_013 2.87e-13 4.37e-08 NA NA
5. P Q0SSN5 UPF0397 protein CPR_1556 1.45e-12 1.39e-09 NA NA
5. P Q50364 Uncharacterized protein MG313 homolog 9.16e-06 8.23e-05 NA NA
5. P E5QVT2 Riboflavin transporter RibU 2.85e-08 4.14e-04 NA NA
5. P A5VM74 Cobalt transport protein CbiM 1.20e-06 1.22e-02 NA NA
5. P P22819 Probable biotin transporter BioY 2.72e-09 1.51e-04 NA NA
5. P A5IWB2 UPF0397 protein SaurJH9_2709 1.66e-12 2.05e-09 NA NA
5. P Q7MFH2 UPF0397 protein VVA0348 4.47e-13 1.53e-07 NA NA
5. P Q2YZA7 UPF0397 protein SAB2561c 1.68e-12 7.59e-10 NA NA
5. P P75251 Uncharacterized protein MG350.1 homolog 1.92e-06 2.50e-08 NA NA
5. P Q9CIN2 UPF0397 protein YdcD 2.69e-12 7.20e-11 NA NA
5. P Q832R4 UPF0397 protein EF_2154 6.99e-13 7.40e-10 NA NA
5. P O54190 Cobalt transport protein CbiM 1.04e-07 2.98e-17 NA NA
5. P A1ANC7 Cobalt transport protein CbiM 1 8.76e-07 2.75e-17 NA NA
5. P B2IM88 UPF0397 protein SPCG_0463 1.06e-12 1.04e-09 NA NA
5. P A6QKH3 UPF0397 protein NWMN_2583 1.64e-12 9.90e-10 NA NA
5. P Q74I63 UPF0397 protein LJ_1703 1.78e-12 3.67e-09 NA NA
5. P Q97SA4 UPF0397 protein SP_0482 1.02e-12 1.07e-09 NA NA
5. P Q6LQ01 UPF0397 protein PBPRA2239 5.51e-13 3.35e-07 NA NA
5. P Q1G8W8 UPF0397 protein Ldb1710 8.75e-13 4.87e-08 NA NA
5. P B7GLU2 Cobalt transport protein CbiM 4.81e-07 2.69e-07 NA NA
5. P B6EH91 UPF0397 protein VSAL_I1988 2.37e-13 4.48e-06 NA NA
5. P Q8DG81 Cobalt transport protein CbiM 3.83e-07 6.79e-03 NA NA
5. P Q748J7 Cobalt transport protein CbiM 1.59e-06 4.53e-08 NA NA
5. P B5FEZ3 UPF0397 protein VFMJ11_1662 3.84e-13 8.66e-07 NA NA
5. P D9QVP6 Cobalt transport protein CbiM 3.58e-07 9.07e-04 NA NA
5. P P0DH69 Protein FsrB 2.88e-03 1.60e-02 NA NA
5. P Q6GDB9 UPF0397 protein SAR2767 1.66e-12 9.18e-10 NA NA
5. P Q18J48 Putative cobalt transport protein CbiM 4.94e-07 1.30e-11 NA NA
5. P B1IA22 UPF0397 protein SPH_0594 9.87e-13 1.66e-09 NA NA
5. P A2RMJ9 Biotin transporter BioY 1.63e-10 3.29e-05 NA NA
5. P A3CLI0 UPF0397 protein SSA_0592 9.76e-12 3.49e-08 NA NA
5. P E3PSD4 Cobalt transport protein CbiM 2.02e-08 8.18e-07 NA NA
5. P B9J1Z7 UPF0397 protein BCQ_2505 3.43e-13 1.14e-08 NA NA
5. P Q8DY59 UPF0397 protein SAG1634 1.56e-12 2.60e-07 NA NA
5. P O29530 Putative cobalt transport protein CbiM 1.66e-07 5.32e-11 NA NA
5. P Q03ZT0 Folate transporter FolT 1.83e-12 2.44e-09 NA NA
5. P A8FJA6 UPF0397 protein BPUM_3679 8.58e-13 4.69e-10 NA NA
5. P A0REM5 UPF0397 protein BALH_2375 6.23e-13 2.56e-09 NA NA
5. P B7IIF0 UPF0397 protein BCG9842_B2659 3.63e-13 1.20e-08 NA NA
5. P Q9ZB72 Uncharacterized protein MG350.1 1.69e-06 1.10e-08 NA NA
5. P Q04M08 UPF0397 protein SPD_0432 9.05e-13 1.07e-09 NA NA
5. P A4VZK9 UPF0397 protein SSU98_0390 1.06e-12 5.76e-11 NA NA
5. P Q7A341 UPF0397 protein SA2477 1.65e-12 2.05e-09 NA NA
5. P D8KIE9 Riboflavin transporter RibU 1.39e-07 3.47e-05 NA NA
5. P B9DTI6 UPF0397 protein SUB0313 1.11e-12 3.88e-07 NA NA
5. P P22821 Protein BioX 1.07e-11 2.34e-02 NA NA
5. P A2RKV5 Niacin transporter NiaX 3.70e-08 7.82e-05 NA NA
5. P D9S0S1 Cobalt transport protein CbiM 6.38e-07 2.03e-04 NA NA
5. P A2RIH3 Thiamine precursor transporter HmpT 1.15e-10 1.60e-03 NA NA
5. P Q03YI6 Pantothenate transporter PanT 4.05e-09 1.52e-05 NA NA
5. P Q46D59 Putative cobalt transport protein CbiM 1 3.24e-07 2.14e-22 NA NA
5. P A8AVH5 UPF0397 protein SGO_0469 3.86e-12 3.78e-11 NA NA
5. P Q9X1G6 Riboflavin transporter RibU 2.24e-09 1.57e-07 NA NA
5. P A2RI45 Biotin transporter BioY2 8.91e-08 2.76e-03 NA NA
5. P Q6F0N9 Putative riboflavin transporter RibV 2.12e-08 1.28e-04 NA NA
5. P C1C5K9 UPF0397 protein SP70585_0545 9.04e-13 9.30e-10 NA NA
5. P D5ARG8 Biotin transporter BioY 2.82e-10 6.67e-03 NA NA
5. P Q041L7 UPF0397 protein LGAS_1499 1.51e-12 8.04e-09 NA NA
5. P Q6G5Z0 UPF0397 protein SAS2570 1.67e-12 2.90e-09 NA NA
5. P A2SQF0 Putative cobalt transport protein CbiM 1 9.72e-08 5.02e-18 NA NA
5. P B7HSG9 UPF0397 protein BCAH187_A2708 6.57e-13 1.06e-08 NA NA
5. P A8YUY9 UPF0397 protein lhv_0999 2.01e-12 2.54e-10 NA NA
5. P Q897L1 Cobalt transport protein CbiM 9.16e-08 2.51e-04 NA NA
5. P B3W705 UPF0397 protein LCABL_04350 1.53e-12 5.05e-09 NA NA
5. P P44274 Putative metal transport protein HI_1621 2.90e-07 7.89e-11 NA NA
5. P Q2RJ53 Cobalt transport protein CbiM 2.54e-07 1.64e-13 NA NA
5. P Q81PZ9 UPF0397 protein BA_2640/GBAA_2640/BAS2460 4.31e-13 3.79e-08 NA NA
5. P Q2FUT1 UPF0397 protein SAOUHSC_03020 1.67e-12 9.90e-10 NA NA
5. P Q03US7 UPF0397 protein LEUM_1974 1.01e-08 3.90e-09 NA NA
5. P Q5E4I5 UPF0397 protein VF_1566 3.57e-13 8.66e-07 NA NA
5. P Q58333 Uncharacterized protein MJ0923 6.47e-05 1.89e-07 NA NA
5. P Q8DQY6 UPF0397 protein spr0429 1.03e-12 1.07e-09 NA NA
5. P Q5M1F2 UPF0397 protein str0306 1.42e-12 3.97e-07 NA NA
5. P D7GIS1 Cobalt transport protein CbiM 8.44e-07 1.69e-17 NA NA
5. P C1CIX7 UPF0397 protein SPP_0507 9.70e-13 1.04e-09 NA NA
5. P Q8Y5W0 Riboflavin transporter RibU 4.56e-09 5.11e-09 NA NA
5. P Q5HCL2 UPF0397 protein SACOL2709 1.64e-12 9.90e-10 NA NA
5. P O32104 Putative biotin transporter BioYB 8.06e-13 9.61e-04 NA NA
5. P B8GJG9 Putative cobalt transport protein CbiM 1 6.41e-08 1.72e-21 NA NA
5. P Q9P781 Golgi apparatus membrane protein tvp38 2.65e-04 3.80e-02 NA NA
5. P A5UQS9 Cobalt transport protein CbiM 2.86e-07 3.40e-04 NA NA
5. P C1CCN0 UPF0397 protein SPJ_0453 1.05e-12 1.04e-09 NA NA
5. P D1AFI6 Cobalt transport protein CbiM 3.37e-07 1.07e-02 NA NA
5. P Q87G36 UPF0397 protein VPA1481 4.08e-13 1.92e-08 NA NA
5. P B1V944 UPF0397 protein PA0141 9.13e-10 3.27e-13 NA NA
5. P D3UMA1 Cobalt transport protein CbiM 3.19e-07 7.37e-03 NA NA
5. P Q5M5Y6 UPF0397 protein stu0306/stu0307 2.13e-12 9.78e-05 NA NA
5. P C3LH78 UPF0397 protein BAMEG_1951 4.82e-13 3.79e-08 NA NA
5. P P0CI37 UPF0397 protein llmg_0343 1.48e-12 3.36e-10 NA NA
5. P A9KP98 Cobalt transport protein CbiM 1.28e-07 2.74e-03 NA NA
5. P Q18EC4 Putative metal transport protein HQ_3621A 1.93e-07 5.13e-12 NA NA
5. P Q58964 Putative metal transport protein MJ1569 8.71e-07 2.65e-14 NA NA
5. P Q8XK19 UPF0397 protein CPE1584 1.77e-12 3.20e-09 NA NA
5. P Q58491 Putative cobalt transport protein CbiM 3.87e-06 4.46e-17 NA NA
5. P A9VHJ1 UPF0397 protein BcerKBAB4_2500 3.75e-13 4.87e-09 NA NA
5. P Q5FKJ5 UPF0397 protein LBA0922 2.10e-12 1.66e-10 NA NA
5. P C3PC02 UPF0397 protein BAA_2707 3.83e-13 3.79e-08 NA NA
5. P A2RI47 Thiamine transporter ThiT 3.47e-06 4.88e-05 NA NA
5. P Q737I1 UPF0397 protein BCE_2667 4.30e-13 2.78e-08 NA NA
5. P D8KFN3 UPF0397 protein LLNZ_01795 1.72e-12 3.36e-10 NA NA
5. P C9YID6 Cobalt transport protein CbiM 1.26e-06 7.38e-09 NA NA
5. P Q031Z8 UPF0397 protein LACR_0367 1.33e-12 6.16e-08 NA NA
5. P P50741 Uncharacterized protein YphA 1.49e-04 2.00e-02 NA NA
5. P Q048Q1 UPF0397 protein LBUL_1584 7.28e-13 4.87e-08 NA NA
5. P Q3AE25 Cobalt transport protein CbiM 3.77e-07 5.27e-03 NA NA
5. P C4L1J3 UPF0397 protein EAT1b_2102 1.08e-12 1.91e-13 NA NA
5. P Q035X6 Folate transporter FolT 5.75e-13 2.62e-05 NA NA
5. P C1CPZ1 UPF0397 protein SPT_0523 9.41e-13 1.07e-09 NA NA
5. P Q93D98 UPF0397 protein SMU_1935c 5.12e-13 1.99e-08 NA NA
5. P B8I0P7 Cobalt transport protein CbiM 1.69e-07 8.24e-04 NA NA
5. P A9GQ89 Cobalt transport protein CbiM 1.72e-07 1.36e-10 NA NA
5. P Q46AL8 Putative cobalt transport protein CbiM 2 7.19e-09 2.72e-21 NA NA
5. P O07620 Probable biotin transporter BioY 3.32e-11 6.98e-03 NA NA
5. P Q8YQ91 Cobalt transport protein CbiM 1.42e-06 3.53e-08 NA NA
5. P P37619 Queuosine precursor transporter 4.11e-10 4.62e-02 NA NA
5. P B7VQF8 UPF0397 protein VS_II0189 1.25e-09 2.44e-08 NA NA
5. P O28435 Putative fused nickel transport protein NikMN 2.85e-07 1.83e-02 NA NA
5. P D5AUZ9 Cobalt transport protein CbiM 1.52e-06 5.61e-15 NA NA
5. P A4J832 Cobalt transport protein CbiM 6.03e-07 1.52e-09 NA NA
5. P D9SNZ5 Cobalt transport protein CbiM 1.58e-07 1.78e-06 NA NA
5. P B8ZLW2 UPF0397 protein SPN23F04390 1.00e-12 1.04e-09 NA NA
5. P A8Z5I6 UPF0397 protein USA300HOU_2687 1.69e-12 9.90e-10 NA NA
5. P A6U570 UPF0397 protein SaurJH1_2766 1.61e-12 2.05e-09 NA NA
5. P B8GEB7 Putative cobalt transport protein CbiM 2 1.73e-08 2.15e-23 NA NA
5. P A1ANE2 Cobalt transport protein CbiM 2 1.24e-07 8.69e-17 NA NA
5. P A4VTD2 UPF0397 protein SSU05_0404 1.11e-12 5.76e-11 NA NA
5. P C1EWN1 UPF0397 protein BCA_2731 5.70e-13 2.56e-09 NA NA
5. P Q2NHA4 Putative cobalt transport protein CbiM 1.20e-07 1.13e-16 NA NA
5. P B7H7Y7 UPF0397 protein BCB4264_A2665 4.35e-13 1.06e-08 NA NA
5. P O32074 Thiamine transporter ThiT 1.18e-06 1.47e-02 NA NA
5. P A7X777 UPF0397 protein SAHV_2669 1.76e-12 2.05e-09 NA NA
5. P D7DR00 Putative cobalt transport protein CbiM 5.68e-07 2.45e-15 NA NA
5. P Q2FDH6 UPF0397 protein SAUSA300_2618 1.67e-12 9.90e-10 NA NA
5. P P0CI36 Riboflavin transporter RibU 2.96e-04 3.47e-05 NA NA
5. P Q99QV6 UPF0397 protein SAV2685 1.67e-12 2.05e-09 NA NA
5. P Q03MC3 UPF0397 protein STER_0346 2.11e-12 3.27e-07 NA NA
5. P Q8E3S5 UPF0397 protein gbs1681 1.69e-12 2.60e-07 NA NA
5. P Q0TQ20 UPF0397 protein CPF_1836 1.45e-12 3.20e-09 NA NA
5. P A7N6E0 UPF0397 protein VIBHAR_05109 3.73e-13 2.22e-08 NA NA
5. P Q6YRJ5 UPF0397 protein PAM_019 2.45e-13 1.05e-08 NA NA
5. P Q8D3Z8 UPF0397 protein VV2_1534 4.69e-13 1.53e-07 NA NA
5. P Q8NUH7 UPF0397 protein MW2604 1.65e-12 2.90e-09 NA NA
5. P Q63AU4 UPF0397 protein BCE33L2384 4.90e-13 9.77e-09 NA NA
5. P Q88ZZ1 UPF0397 protein lp_0150 2.19e-12 5.85e-09 NA NA
5. P B3EC54 Cobalt transport protein CbiM 2.31e-07 4.11e-03 NA NA
5. P D5WSC8 Cobalt transport protein CbiM 4.35e-07 1.35e-07 NA NA
5. P Q3JZQ2 UPF0397 protein SAK_1648 2.69e-12 2.60e-07 NA NA
5. P O34738 Putative HMP/thiamine permease protein YkoE 2.45e-07 5.64e-05 NA NA
7. B P42934 Dolichyl-phosphate-mannose--protein mannosyltransferase 6 6.99e-02 NA 0.042 NA