Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54720.1
JCVISYN3A_0325

Uncharacterized protein.
M. mycoides homolog: Q6MTM0.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 294
Unique PROST Go: 198
Unique BLAST Go: 0
Unique Foldseek Go: 34

Total Homologs: 2186
Unique PROST Homologs: 1459
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 196

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Multidrug resistance protein MdtK
Antczak et al. [3]: Transmembrane protein, likely a cation transporter from Major Facilitator Superfamily
Zhang et al. [4]: GO:0000455|enzyme-directed rRNA pseudouridine synthesis
Bianchi et al. [5]: "Unclear, Peptide/Amino Acid Transporter?"

Structures and Sequence Alignment

The best structural homolog that predicted by 2. PF was O34691 (Putative niacin/nicotinamide transporter NaiP) with a FATCAT P-Value: 0 and RMSD of 3.13 angstrom. The sequence alignment identity is 17.6%.
Structural alignment shown in left. Query protein AVX54720.1 colored as red in alignment, homolog O34691 colored as blue. Query protein AVX54720.1 is also shown in right top, homolog O34691 showed in right bottom. They are colored based on secondary structures. 

  AVX54720.1 MNKLFSWDLYIINPLLIVIWLIVASYLFYKNS-ISKQK-----GLFYLEISSFWI-VINFLIQIITNYID---SP-ILKSFSSSTLTILLFLSSYFLYAT 89
      O34691 ---------------------------MGKQQPISQRKLLGVAGLGWL-FDAMDVGILSFIIAAL--HVEWNLSPEEMKWIGS--VNSIGMAAGAFL--- 65

  AVX54720.1 ILNPFALWLTLKLQSRRIWIWISLFSCFLSV---MIAFLSNVNITSIIFISLFLAVGISAQ--IIYFLFFNEQFNERLFPVFSSIKAGFVISFATFISYE 184
      O34691 ----FGL-LADRIGRKKVFI-ITLL-CF-SIGSGISAFVT--SLSAFLILRFVIGMGLGGELPVASTL-----VSEAVVPE----KRGRVI--------- 137

  AVX54720.1 VYSLLNLNLISNHNNYTNWIIFSLSLVCLIICLVVSIFVKERKIKVIKYKEDIVEQLQRYGYKVLIGLIVMSFLITSVNVIIKSDIFELFLVSKLKQQ-S 283
      O34691 V--LL--------ESF--W-----AVGWLAAAL-ISYFV-----------------IPSFGWQAAL-------LLTAL-----TAFYALYLRTSLPDSPK 190

  AVX54720.1 YTSL-----NVWNYLQSF--RLSFVLGQLLLGYLFYKLVIKVIGI---VKSISILTSLTM---F-GVILITFIHNI--YLLTIMMWVF---GLFFFVMFY 364
      O34691 YESLSAKKRSMWENVKSVWAR-QYIRPTVMLSIVWFCVVFSYYGMFLWLPSVMLLKGFSMIQSFEYVLLMT-LAQLPGYF--SAAWLIEKAGRKWILVVY 286

  AVX54720.1 L--------WFGIALMWDYRSTKVSVLSTF-LTVTFLTLSIWYLVI--------SICKVNNIGLFSIF---KSVF-EVINNTDLNKNYLFIKKITEVYYI 443
      O34691 LIGTAGSAYFFGTA---D----SLSLLLTAGVLLSFFNLGAWGVLYAYTPEQYPTAIRATGSGTTAAFGRIGGIFGPLLVGT-LAARHI---SFSVIFSI 375

  AVX54720.1 CCILIFCLLGIYLTTFIWTANYIIAEYMDLKQIKLKMTSLAKSDIQSKMITRLIRE 499
      O34691 FCIAI--LLAV--------ACILI---MG-KE--TKQTELE--------------- 400

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
2. PF GO:0042910 xenobiotic transmembrane transporter activity
2. PF GO:0035873 lactate transmembrane transport
2. PF GO:0015294 solute:cation symporter activity
2. PF GO:0005351 carbohydrate:proton symporter activity
2. PF GO:0055085 transmembrane transport
2. PF GO:0005887 integral component of plasma membrane
2. PF GO:0015343 siderophore transmembrane transporter activity
2. PF GO:0005886 plasma membrane
2. PF GO:0015767 lactose transport
2. PF GO:0005829 cytosol
2. PF GO:0015098 molybdate ion transmembrane transporter activity
2. PF GO:0015231 5-formyltetrahydrofolate transmembrane transporter activity
2. PF GO:0030076 light-harvesting complex
2. PF GO:0070395 lipoteichoic acid biosynthetic process
2. PF GO:0015297 antiporter activity
2. PF GO:0015144 carbohydrate transmembrane transporter activity
2. PF GO:0015706 nitrate transport
2. PF GO:0046677 response to antibiotic
2. PF GO:0015535 fucose:proton symporter activity
2. PF GO:0015113 nitrite transmembrane transporter activity
2. PF GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane
2. PF GO:0046943 carboxylic acid transmembrane transporter activity
2. PF GO:0085042 periarbuscular membrane
2. PF GO:0030395 lactose binding
2. PF GO:0061462 protein localization to lysosome
2. PF GO:0008517 folic acid transmembrane transporter activity
2. PF GO:0005355 glucose transmembrane transporter activity
2. PF GO:1904659 glucose transmembrane transport
2. PF GO:0015538 sialic acid:proton symporter activity
2. PF GO:0005524 ATP binding
2. PF GO:0042128 nitrate assimilation
2. PF GO:0015169 glycerol-3-phosphate transmembrane transporter activity
2. PF GO:1901475 pyruvate transmembrane transport
2. PF GO:0022857 transmembrane transporter activity
2. PF GO:0015884 folic acid transport
2. PF GO:0005765 lysosomal membrane
2. PF GO:0015293 symporter activity
2. PF GO:0046624 sphingolipid transporter activity
2. PF GO:0016021 integral component of membrane
2. PF GO:0042931 enterobactin transmembrane transporter activity
2. PF GO:0071627 integral component of fungal-type vacuolar membrane
2. PF GO:0051978 lysophospholipid:sodium symporter activity
2. PF GO:0008643 carbohydrate transport
2. PF GO:0005737 cytoplasm
2. PF GO:0015885 5-formyltetrahydrofolate transport
2. PF GO:0097159 organic cyclic compound binding
2. PF GO:0006869 lipid transport
2. PF GO:0071702 organic substance transport
2. PF GO:0046942 carboxylic acid transport
2. PF GO:0015707 nitrite transport
2. PF GO:0015112 nitrate transmembrane transporter activity
2. PF GO:0006814 sodium ion transport
2. PF GO:0005354 galactose transmembrane transporter activity
2. PF GO:0051958 methotrexate transport
2. PF GO:0036448 cellular response to glucose-phosphate stress
2. PF GO:0015211 purine nucleoside transmembrane transporter activity
2. PF GO:0015350 methotrexate transmembrane transporter activity
2. PF GO:0034486 vacuolar transmembrane transport
2. PF GO:0015143 urate transmembrane transporter activity
2. PF GO:0006811 ion transport
2. PF GO:0015129 lactate transmembrane transporter activity
2. PF GO:0015528 lactose:proton symporter activity
5. P GO:0006119 oxidative phosphorylation
5. P GO:0015298 solute:cation antiporter activity
5. P GO:0060856 establishment of blood-brain barrier
5. P GO:0008028 monocarboxylic acid transmembrane transporter activity
5. P GO:0009243 O antigen biosynthetic process
5. P GO:0015031 protein transport
5. P GO:0005739 mitochondrion
5. P GO:0005634 nucleus
5. P GO:0015756 fucose transmembrane transport
5. P GO:0015149 hexose transmembrane transporter activity
5. P GO:0015212 cytidine transmembrane transporter activity
5. P GO:0034202 glycolipid floppase activity
5. P GO:0070469 respirasome
5. P GO:0098567 periplasmic side of plasma membrane
5. P GO:0042438 melanin biosynthetic process
5. P GO:0005477 pyruvate secondary active transmembrane transporter activity
5. P GO:0016324 apical plasma membrane
5. P GO:0005985 sucrose metabolic process
5. P GO:0015519 D-xylose:proton symporter activity
5. P GO:0048022 negative regulation of melanin biosynthetic process
5. P GO:0005308 creatine transmembrane transporter activity
5. P GO:0150178 regulation of phosphatidylserine metabolic process
5. P GO:0042908 xenobiotic transport
5. P GO:0007289 spermatid nucleus differentiation
5. P GO:0030382 sperm mitochondrion organization
5. P GO:0048039 ubiquinone binding
5. P GO:0090352 regulation of nitrate assimilation
5. P GO:0016328 lateral plasma membrane
5. P GO:0014731 spectrin-associated cytoskeleton
5. P GO:0035879 plasma membrane lactate transport
5. P GO:1903790 guanine nucleotide transmembrane transport
5. P GO:0008521 acetyl-CoA transmembrane transporter activity
5. P GO:1901480 oleate transmembrane transporter activity
5. P GO:0042907 xanthine transmembrane transporter activity
5. P GO:0036377 arbuscular mycorrhizal association
5. P GO:0015712 hexose phosphate transport
5. P GO:0008518 folate:anion antiporter activity
5. P GO:0098838 folate transmembrane transport
5. P GO:0015751 arabinose transmembrane transport
5. P GO:0042773 ATP synthesis coupled electron transport
5. P GO:0015518 arabinose:proton symporter activity
5. P GO:0060586 multicellular organismal iron ion homeostasis
5. P GO:0005267 potassium channel activity
5. P GO:0034379 very-low-density lipoprotein particle assembly
5. P GO:0015696
5. P GO:0035633 maintenance of blood-brain barrier
5. P GO:0015506 nucleoside:proton symporter activity
5. P GO:0071934 thiamine transmembrane transport
5. P GO:0008514 organic anion transmembrane transporter activity
5. P GO:0015753 D-xylose transmembrane transport
5. P GO:0016966 nitric oxide reductase activity
5. P GO:0015864 pyrimidine nucleoside transport
5. P GO:0016323 basolateral plasma membrane
5. P GO:0007049 cell cycle
5. P GO:0046658 anchored component of plasma membrane
5. P GO:0003723 RNA binding
5. P GO:0009535 chloroplast thylakoid membrane
5. P GO:1990379 lipid transport across blood-brain barrier
5. P GO:0015648 lipid-linked peptidoglycan transporter activity
5. P GO:0015147 L-arabinose transmembrane transporter activity
5. P GO:1903712 cysteine transmembrane transport
5. P GO:0034203 glycolipid translocation
5. P GO:0015860 purine nucleoside transmembrane transport
5. P GO:0015148 D-xylose transmembrane transporter activity
5. P GO:0010311 lateral root formation
5. P GO:0046872 metal ion binding
5. P GO:0051301 cell division
5. P GO:0070470 plasma membrane respirasome
5. P GO:0035442 dipeptide transmembrane transport
5. P GO:0015213 uridine transmembrane transporter activity
5. P GO:0042937 tripeptide transmembrane transporter activity
5. P GO:0015770 sucrose transport
5. P GO:0150175 regulation of phosphatidylethanolamine metabolic process
5. P GO:0034775 glutathione transmembrane transport
5. P GO:0006857 oligopeptide transport
5. P GO:0090482 vitamin transmembrane transporter activity
5. P GO:0015145 monosaccharide transmembrane transporter activity
5. P GO:0015487 melibiose:cation symporter activity
5. P GO:0051977 lysophospholipid transport
5. P GO:0140361 cyclic-GMP-AMP transmembrane import across plasma membrane
5. P GO:0030506 ankyrin binding
5. P GO:0051780 behavioral response to nutrient
5. P GO:0010907 positive regulation of glucose metabolic process
5. P GO:0009610 response to symbiotic fungus
5. P GO:0072488 ammonium transmembrane transport
5. P GO:0001406 glycerophosphodiester transmembrane transporter activity
5. P GO:0000324 fungal-type vacuole
5. P GO:0015234 thiamine transmembrane transporter activity
5. P GO:1904680 peptide transmembrane transporter activity
5. P GO:0140360 cyclic-GMP-AMP transmembrane transporter activity
5. P GO:0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system
5. P GO:0034219 carbohydrate transmembrane transport
5. P GO:0015809
5. P GO:0071916 dipeptide transmembrane transporter activity
5. P GO:0140329 lysophospholipid translocation
5. P GO:0008137 NADH dehydrogenase (ubiquinone) activity
5. P GO:0015843 methylammonium transport
5. P GO:0031999 negative regulation of fatty acid beta-oxidation
5. P GO:0072714 response to selenite ion
5. P GO:0009925 basal plasma membrane
5. P GO:0015931 nucleobase-containing compound transport
5. P GO:0033162 melanosome membrane
5. P GO:0150011 regulation of neuron projection arborization
5. P GO:0035443 tripeptide transmembrane transport
5. P GO:0010247 detection of phosphate ion
5. P GO:0005774 vacuolar membrane
5. P GO:1905039 carboxylic acid transmembrane transport
5. P GO:0015851 nucleobase transport
5. P GO:0031676 plasma membrane-derived thylakoid membrane
5. P GO:0008645 hexose transmembrane transport
5. P GO:0050833 pyruvate transmembrane transporter activity
5. P GO:1904447 folate import across plasma membrane
5. P GO:0006914 autophagy
5. P GO:0071249 cellular response to nitrate
5. P GO:0032974 amino acid transmembrane export from vacuole
5. P GO:0005576 extracellular region
5. P GO:0005506 iron ion binding
5. P GO:0072348 sulfur compound transport
5. P GO:0015526 hexose-phosphate:inorganic phosphate antiporter activity
5. P GO:0008594 photoreceptor cell morphogenesis
5. P GO:0015711 organic anion transport
5. P GO:0048038 quinone binding
5. P GO:0015891 siderophore transport
5. P GO:0090585 protein-phosphocysteine-L-ascorbate-phosphotransferase system transporter activity
5. P GO:0015333 peptide:proton symporter activity
5. P GO:0015908 fatty acid transport
5. P GO:0061507 2',3'-cyclic GMP-AMP binding
5. P GO:0015295 solute:proton symporter activity
5. P GO:0015835 peptidoglycan transport
5. P GO:0015881 creatine transmembrane transport
5. P GO:0042723 thiamine-containing compound metabolic process
5. P GO:0006488 dolichol-linked oligosaccharide biosynthetic process
5. P GO:0030659 cytoplasmic vesicle membrane
5. P GO:0140348 lysophosphatidylcholine flippase activity
5. P GO:0008506 sucrose:proton symporter activity
5. P GO:0015718 monocarboxylic acid transport
5. P GO:0006817 phosphate ion transport
5. P GO:0006855 xenobiotic transmembrane transport
5. P GO:1905165 regulation of lysosomal protein catabolic process
5. P GO:0005471 ATP:ADP antiporter activity
5. P GO:0048713 regulation of oligodendrocyte differentiation
5. P GO:0005542 folic acid binding
5. P GO:0015836 lipid-linked peptidoglycan transport
5. P GO:0030955 potassium ion binding
5. P GO:0015386 potassium:proton antiporter activity
5. P GO:0098688 parallel fiber to Purkinje cell synapse
5. P GO:0099061 integral component of postsynaptic density membrane
5. P GO:0005654 nucleoplasm
5. P GO:0015379 potassium:chloride symporter activity
5. P GO:0005277 acetylcholine transmembrane transporter activity
5. P GO:0015592 methylgalactoside transmembrane transporter activity
5. P GO:0033229 cysteine transmembrane transporter activity
5. P GO:1905103 integral component of lysosomal membrane
5. P GO:0001407 glycerophosphodiester transmembrane transport
5. P GO:0045272 plasma membrane respiratory chain complex I
5. P GO:0071805 potassium ion transmembrane transport
5. P GO:0004129 cytochrome-c oxidase activity
5. P GO:0015576 sorbitol transmembrane transporter activity
5. P GO:0005297 proline:proton symporter activity
5. P GO:0009060 aerobic respiration
5. P GO:0008515 sucrose transmembrane transporter activity
5. P GO:0015990 electron transport coupled proton transport
5. P GO:0015765 methylgalactoside transport
5. P GO:0015517 galactose:proton symporter activity
5. P GO:0019333 denitrification pathway
5. P GO:0035348 acetyl-CoA transmembrane transport
5. P GO:0019684 photosynthesis, light reaction
5. P GO:1902025 nitrate import
5. P GO:0043474 pigment metabolic process involved in pigmentation
5. P GO:0015747 urate transport
5. P GO:0015769 melibiose transport
5. P GO:0043562 cellular response to nitrogen levels
5. P GO:0034204 lipid translocation
5. P GO:0009237 siderophore metabolic process
5. P GO:0015575 mannitol transmembrane transporter activity
5. P GO:0070634 transepithelial ammonium transport
5. P GO:0045278 plasma membrane respiratory chain complex IV
5. P GO:0009705 plant-type vacuole membrane
5. P GO:1901682 sulfur compound transmembrane transporter activity
5. P GO:0048021 regulation of melanin biosynthetic process
5. P GO:0051453 regulation of intracellular pH
5. P GO:0015591 D-ribose transmembrane transporter activity
5. P GO:0042906 xanthine transport
5. P GO:0045056 transcytosis
5. P GO:0003406 retinal pigment epithelium development
5. P GO:0015553 xanthosine transmembrane transporter activity
5. P GO:0015819 lysine transport
5. P GO:0015355 secondary active monocarboxylate transmembrane transporter activity
5. P GO:0015245 fatty acid transmembrane transporter activity
5. P GO:0008519 ammonium transmembrane transporter activity
5. P GO:0030641 regulation of cellular pH
5. P GO:0061744 motor behavior
5. P GO:0150172 regulation of phosphatidylcholine metabolic process
5. P GO:0043887 melibiose:sodium symporter activity
5. P GO:0019411 aerobic respiration, using ferrous ions as electron donor
5. P GO:0015205 nucleobase transmembrane transporter activity
5. P GO:0015514 nitrite efflux transmembrane transporter activity
5. P GO:0016020 membrane
6. F GO:0110146 magnetosome membrane
6. F GO:0043249 erythrocyte maturation
6. F GO:0015755 fructose transmembrane transport
6. F GO:0010106 cellular response to iron ion starvation
6. F GO:0071311 cellular response to acetate
6. F GO:0055056 D-glucose transmembrane transporter activity
6. F GO:0006820 anion transport
6. F GO:0019534 toxin transmembrane transporter activity
6. F GO:0015746 citrate transport
6. F GO:0030864 cortical actin cytoskeleton
6. F GO:0019630 quinate metabolic process
6. F GO:0065003 protein-containing complex assembly
6. F GO:0015911 long-chain fatty acid import across plasma membrane
6. F GO:0015739 sialic acid transport
6. F GO:0061513 glucose 6-phosphate:inorganic phosphate antiporter activity
6. F GO:0030672 synaptic vesicle membrane
6. F GO:0015686 ferric triacetylfusarinine C import into cell
6. F GO:0005275 amine transmembrane transporter activity
6. F GO:0000023 maltose metabolic process
6. F GO:0022832 voltage-gated channel activity
6. F GO:0035445 borate transmembrane transport
6. F GO:0006836 neurotransmitter transport
6. F GO:0001917 photoreceptor inner segment
6. F GO:0046239 phthalate catabolic process
6. F GO:1990351 transporter complex
6. F GO:0036168 filamentous growth of a population of unicellular organisms in response to heat
6. F GO:0097037 heme export
6. F GO:0015513 high-affinity secondary active nitrite transmembrane transporter activity
6. F GO:0043621 protein self-association
6. F GO:0045494 photoreceptor cell maintenance
6. F GO:0006847 plasma membrane acetate transport
6. F GO:0033300 dehydroascorbic acid transmembrane transporter activity
6. F GO:0005353 fructose transmembrane transporter activity
6. F GO:0055072 iron ion homeostasis

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
2. PF B7L855 Multidrug resistance protein MdtL 2.26e-08 5.38e-03 NA 0.595
2. PF B4THV6 Probable sugar efflux transporter 3.49e-10 5.55e-06 NA 0.57
2. PF O07366 Melibiose carrier protein 5.35e-10 4.02e-09 NA 0.5743
2. PF O34691 Putative niacin/nicotinamide transporter NaiP 0.00e+00 5.57e-04 NA 0.639
2. PF A8GKP6 Protein TsgA homolog 1.51e-09 1.02e-07 NA 0.6122
2. PF A8Z415 Quinolone resistance protein NorB 1.76e-06 4.60e-03 NA 0.4728
2. PF Q8XEB7 Uncharacterized MFS-type transporter YcaD 1.60e-11 2.44e-05 NA 0.5242
2. PF B6IAT1 Probable sugar efflux transporter 3.49e-10 3.06e-06 NA 0.5592
2. PF P32482 Chloramphenicol resistance protein 1.15e-08 7.36e-06 NA 0.5216
2. PF A7ZSN9 Protein TsgA 1.70e-09 6.99e-08 NA 0.5842
2. PF A4WFG6 Protein TsgA homolog 1.48e-09 5.31e-07 NA 0.5602
2. PF Q8X9I3 Multidrug resistance protein MdtG 4.35e-12 3.64e-06 NA 0.6823
2. PF B1JQC2 Lysophospholipid transporter LplT 2.42e-09 1.21e-05 NA 0.5761
2. PF B7LNJ1 Lysophospholipid transporter LplT 4.18e-09 6.34e-05 NA 0.5781
2. PF B5FIR7 Sialic acid transporter NanT 1.14e-07 2.09e-05 NA 0.4907
2. PF B7LRJ2 Sialic acid transporter NanT 7.69e-08 5.20e-05 NA 0.4916
2. PF O34440 Uncharacterized MFS-type transporter YfmI 2.25e-09 1.33e-07 NA 0.6649
2. PF A8GII5 Lysophospholipid transporter LplT 6.42e-10 3.36e-05 NA 0.5424
2. PF Q99S97 Multidrug efflux pump SdrM 5.88e-07 2.17e-04 NA 0.609
2. PF A3MMF8 Uncharacterized MFS-type transporter BMA10247_1907 9.11e-11 2.81e-05 NA 0.638
2. PF P64954 Uncharacterized protein Mb2232 2.47e-07 3.06e-06 NA 0.5294
2. PF B7NIN3 Probable sugar efflux transporter 4.61e-10 3.06e-06 NA 0.5669
2. PF Q328Z8 Multidrug resistance protein MdtL 2.04e-09 2.60e-03 NA 0.5632
2. PF P44776 L-fucose-proton symporter 3.30e-10 9.98e-04 NA 0.574
2. PF Q5PLF0 Sialic acid transporter NanT 1.03e-06 2.19e-05 NA 0.5277
2. PF A7ZKF6 Multidrug resistance protein MdtG 1.64e-10 3.64e-06 NA 0.6779
2. PF B5F613 Probable sugar efflux transporter 3.75e-10 5.55e-06 NA 0.5891
2. PF Q9KWK6 Putative proline/betaine transporter 1.28e-08 1.43e-04 NA 0.5428
2. PF O51798 Probable 4-methylmuconolactone transporter 6.80e-11 1.10e-02 NA 0.6922
2. PF Q7CPG0 Purine ribonucleoside efflux pump NepI 7.36e-12 8.49e-05 NA 0.618
2. PF C1AN55 Probable triacylglyceride transporter JTY_1446 5.03e-08 9.58e-07 NA 0.4791
2. PF Q17YP7 Probable sugar efflux transporter 5.51e-10 5.76e-04 NA 0.6156
2. PF A4IH46 Major facilitator superfamily domain-containing protein 2B 1.37e-11 5.16e-03 NA 0.571
2. PF Q92I85 Putative transporter AmpG 4 1.24e-09 4.50e-03 NA 0.5371
2. PF B5FHN1 Probable sugar efflux transporter 3.82e-10 5.55e-06 NA 0.5876
2. PF Q8X9G8 Sialic acid transporter NanT 9.08e-08 4.62e-05 NA 0.4988
2. PF B5BIM0 Multidrug resistance protein MdtL 2.72e-09 3.86e-02 NA 0.591
2. PF C6DTH3 Probable triacylglyceride transporter TBMG_02570 5.55e-09 9.58e-07 NA 0.5342
2. PF Q8ZLE4 Uncharacterized MFS-type transporter YhhS 7.10e-09 1.42e-06 NA 0.6213
2. PF Q8FCN5 Uncharacterized MFS-type transporter YhhS 6.72e-09 6.78e-07 NA 0.6233
2. PF B1X838 Uncharacterized MFS-type transporter YcaD 1.53e-11 2.50e-05 NA 0.5226
2. PF B2TYQ6 Lysophospholipid transporter LplT 9.39e-10 4.79e-05 NA 0.5755
2. PF Q89A60 Protein TsgA homolog 4.31e-10 1.16e-06 NA 0.6502
2. PF Q5HDG7 Probable nitrate transporter NarT 9.20e-12 8.89e-05 NA 0.627
2. PF Q8X4N7 Lysophospholipid transporter LplT 5.64e-09 1.16e-05 NA 0.5542
2. PF A1JPE9 Lysophospholipid transporter LplT 7.29e-10 3.46e-06 NA 0.5909
2. PF Q8YB48 Glucose/galactose transporter 1.21e-14 3.92e-05 NA 0.631
2. PF C4ZYY8 Multidrug resistance protein MdtL 2.28e-08 5.38e-03 NA 0.5784
2. PF B7MMZ1 Probable sugar efflux transporter 3.59e-10 3.38e-06 NA 0.57
2. PF B1LHG5 Protein TsgA 1.41e-09 4.86e-08 NA 0.5693
2. PF Q3Z1R4 Probable sugar efflux transporter 3.81e-10 3.06e-06 NA 0.568
2. PF A7ZLY4 Probable sugar efflux transporter 3.65e-10 3.06e-06 NA 0.5692
2. PF A6X7E7 Riboflavin transporter RfnT 2.04e-09 3.30e-11 NA 0.5606
2. PF B4TD28 Uncharacterized MFS-type transporter YcaD 4.80e-14 3.48e-05 NA 0.5984
2. PF C4ZQ24 Uncharacterized MFS-type transporter YcaD 5.64e-12 2.50e-05 NA 0.5274
2. PF B5YXB4 Multidrug resistance protein MdtL 1.92e-09 2.47e-03 NA 0.5889
2. PF P45598 Arabinose-proton symporter 1.52e-11 1.89e-03 NA 0.5364
2. PF B7LF12 Lysophospholipid transporter LplT 5.35e-09 5.14e-05 NA 0.5353
2. PF B0KLJ7 Probable sugar efflux transporter 3.50e-14 3.09e-05 NA 0.5576
2. PF B7LY91 Lysophospholipid transporter LplT 8.94e-10 5.14e-05 NA 0.5354
2. PF P33027 Sugar efflux transporter B 3.44e-15 1.10e-07 NA 0.5898
2. PF P42112 Uncharacterized MFS-type transporter YxaM 7.61e-10 1.30e-03 NA 0.6412
2. PF Q1R5R8 Protein TsgA 1.69e-09 6.99e-08 NA 0.5729
2. PF A4WAE6 Probable sugar efflux transporter 3.57e-10 1.40e-06 NA 0.5809
2. PF P55705 Uncharacterized MFS-type transporter y4xM 3.57e-11 4.91e-07 NA 0.6162
2. PF Q0TCP2 Sialic acid transporter NanT 2.89e-07 4.06e-05 NA 0.5115
2. PF Q5RBM3 Solute carrier family 46 member 3 3.00e-08 4.54e-07 NA 0.5868
2. PF Q8NV31 Probable nitrate transporter NarT 1.17e-11 8.89e-05 NA 0.6207
2. PF Q8NXW9 Putative proline/betaine transporter 5.58e-09 1.71e-04 NA 0.522
2. PF B2U167 Probable sugar efflux transporter 3.99e-10 2.57e-06 NA 0.5676
2. PF B7NM77 Uncharacterized MFS-type transporter YcaD 1.11e-11 2.62e-05 NA 0.5259
2. PF Q8CN76 Probable nitrate transporter NarT 1.90e-09 2.63e-06 NA 0.6331
2. PF Q0T4K1 Probable sugar efflux transporter 3.47e-10 2.02e-06 NA 0.5691
2. PF Q8X6P4 Uncharacterized MFS-type transporter YhhS 6.17e-09 8.43e-07 NA 0.6034
2. PF Q57R33 Uncharacterized MFS-type transporter YcaD 4.29e-14 3.48e-05 NA 0.6022
2. PF B1LIV8 Multidrug resistance protein MdtG 7.84e-11 4.02e-06 NA 0.6739
2. PF B5FL11 Multidrug resistance protein MdtG 1.37e-12 8.43e-07 NA 0.674
2. PF B7UMY7 Uncharacterized MFS-type transporter YcaD 2.16e-14 2.44e-05 NA 0.5278
2. PF A9R2S0 Lysophospholipid transporter LplT 9.51e-10 1.21e-05 NA 0.5729
2. PF P94131 Cis,cis-muconate transport protein 1.57e-08 5.67e-03 NA 0.6086
2. PF A0QYL8 MFS-type efflux pump MSMEG_3705 1.11e-10 5.73e-03 NA 0.5399
2. PF O32084 Uncharacterized MFS-type transporter YubD 7.00e-07 1.17e-11 NA 0.5176
2. PF A6U1Q6 Quinolone resistance protein NorB 1.75e-06 4.90e-03 NA 0.4814
2. PF O33814 Lactose permease 7.55e-11 9.82e-09 NA 0.6575
2. PF Q6DCX5 Proton-coupled folate transporter 4.79e-09 6.97e-03 NA 0.4804
2. PF A4TLD2 Lysophospholipid transporter LplT 2.40e-09 1.21e-05 NA 0.5751
2. PF B1XHJ7 Sialic acid transporter NanT 4.73e-07 5.20e-05 NA 0.4802
2. PF A1AHK2 Purine ribonucleoside efflux pump NepI 5.07e-09 2.38e-04 NA 0.5314
2. PF P57788 Monocarboxylate transporter 4 7.51e-09 4.37e-03 NA 0.5179
2. PF B7NAS9 Multidrug resistance protein MdtG 1.72e-10 6.20e-06 NA 0.6725
2. PF A6U4B6 Probable nitrate transporter NarT 1.02e-11 6.34e-05 NA 0.6258
2. PF B4T749 Sialic acid transporter NanT 3.48e-07 2.09e-05 NA 0.4785
2. PF Q8ZK55 Uncharacterized MFS-type transporter STM4428 2.18e-10 4.97e-02 NA 0.5647
2. PF B1IW33 Uncharacterized MFS-type transporter YcaD 1.90e-14 2.50e-05 NA 0.5274
2. PF Q8FD59 Sialic acid transporter NanT 1 9.55e-07 4.96e-05 NA 0.4995
2. PF B7NL82 Multidrug resistance protein MdtG 2.41e-10 5.22e-06 NA 0.6734
2. PF P0CE45 Glucuronide carrier protein 2.29e-11 2.05e-07 NA 0.5408
2. PF A8GCZ5 Multidrug resistance protein MdtG 1.68e-09 7.04e-07 NA 0.6233
2. PF B7MUT7 Probable sugar efflux transporter 3.27e-10 3.38e-06 NA 0.5689
2. PF Q8X564 Uncharacterized MFS-type transporter YfcJ 2.79e-09 3.34e-04 NA 0.5807
2. PF O34597 Uncharacterized MFS-type transporter YfkL 2.48e-10 4.60e-07 NA 0.6133
2. PF P42432 Nitrate transporter 1.02e-08 4.16e-05 NA 0.6074
2. PF A8A5H1 Protein TsgA 9.00e-09 1.21e-08 NA 0.5724
2. PF A9MYZ7 Probable sugar efflux transporter 3.36e-10 5.55e-06 NA 0.5676
2. PF B7UMD5 Purine ribonucleoside efflux pump NepI 3.26e-10 1.21e-04 NA 0.5703
2. PF B7URQ4 Probable sugar efflux transporter 3.76e-10 3.38e-06 NA 0.5698
2. PF Q2FI61 Proton-coupled antiporter flippase LtaA 3.13e-09 4.11e-12 NA 0.6851
2. PF A2RJJ9 Uridine/deoxyuridine transporter 1.89e-08 1.56e-04 NA 0.4485
2. PF Q4WF31 MFS siderochrome iron transporter B 2.20e-05 4.74e-02 NA 0.466
2. PF P96792 Isoprimeverose transporter 5.16e-10 9.34e-07 NA 0.5862
2. PF B1LL36 Multidrug resistance protein MdtL 9.35e-11 4.80e-03 NA 0.5833
2. PF B5F7J8 Sialic acid transporter NanT 1.44e-07 1.51e-05 NA 0.4991
2. PF A0A0H3JTK0 Staphylopine export protein 3.21e-10 3.12e-03 NA 0.5577
2. PF B7NMD3 Protein TsgA 1.64e-09 7.48e-08 NA 0.573
2. PF P59194 Uncharacterized MFS-type transporter YfcJ 2.69e-09 5.96e-04 NA 0.6647
2. PF A6V6H6 Uncharacterized MFS-type transporter PSPA7_3302 2.94e-10 6.84e-06 NA 0.6478
2. PF P23462 Protein PucC 1.89e-09 1.21e-07 NA 0.5572
2. PF O34929 Uncharacterized MFS-type transporter YfkF 3.18e-14 8.87e-07 NA 0.571
2. PF B5RAE4 Probable sugar efflux transporter 4.13e-10 5.55e-06 NA 0.5896
2. PF Q9ZDS0 Uncharacterized protein RP255 7.16e-10 4.44e-12 NA 0.6663
2. PF Q0TAZ8 Multidrug resistance protein MdtL 1.81e-10 3.65e-03 NA 0.5859
2. PF A1V1V6 Uncharacterized MFS-type transporter BMASAVP1_A0869 1.02e-10 2.81e-05 NA 0.6387
2. PF B1IPA0 Protein TsgA 1.60e-09 1.21e-08 NA 0.5755
2. PF O33854 Probable nitrate transporter NarT 2.47e-09 3.74e-07 NA 0.5736
2. PF Q8ZNB8 Uncharacterized MFS-type transporter YfcJ 1.45e-08 1.16e-03 NA 0.5817
2. PF B7L8K7 Probable sugar efflux transporter 3.58e-10 3.06e-06 NA 0.5692
2. PF O07563 Glucose/mannose transporter GlcP 5.97e-09 2.80e-11 NA 0.6267
2. PF Q32B02 Protein TsgA 2.11e-09 4.14e-08 NA 0.5818
2. PF B4TKP8 Protein TsgA 1.67e-09 5.06e-08 NA 0.5422
2. PF Q6MYX6 Probable quinate permease 6.52e-09 3.71e-02 NA 0.5648
2. PF B7NF27 Multidrug resistance protein MdtL 1.99e-10 3.46e-03 NA 0.5836
2. PF A9MMF2 Protein TsgA 1.03e-09 1.93e-08 NA 0.5678
2. PF Q57HZ5 Multidrug resistance protein MdtL 1.49e-08 1.66e-02 NA 0.6226
2. PF A5IVG9 Probable nitrate transporter NarT 6.24e-11 6.34e-05 NA 0.6219
2. PF Q99U52 Quinolone resistance protein NorB 1.83e-06 4.90e-03 NA 0.4539
2. PF P0A2G6 Sialic acid transporter NanT 6.79e-07 2.09e-05 NA 0.5037
2. PF Q5HH70 Proton-coupled antiporter flippase LtaA 4.49e-09 4.11e-12 NA 0.5113
2. PF Q6CPY8 Probable transporter MCH1 6.15e-09 2.89e-03 NA 0.5709
2. PF Q6GJ96 Putative proline/betaine transporter 5.77e-09 2.41e-04 NA 0.5321
2. PF B1XEB5 Probable sugar efflux transporter 4.98e-10 3.06e-06 NA 0.586
2. PF B0XQS8 Probable quinate permease 5.10e-09 3.94e-02 NA 0.5433
2. PF O06481 Uncharacterized MFS-type transporter YfnC 3.52e-08 1.60e-04 NA 0.6201
2. PF Q5ZKJ5 Transmembrane protein 180 5.51e-09 3.99e-07 NA 0.5948
2. PF B5RG43 Purine ribonucleoside efflux pump NepI 2.04e-09 5.64e-05 NA 0.6189
2. PF Q6DIT7 UNC93-like protein MFSD11 2.81e-08 5.32e-05 NA 0.5441
2. PF Q31VS4 Protein TsgA 1.66e-09 1.21e-08 NA 0.5999
2. PF P94577 Uncharacterized MFS-type transporter YwoG 1.77e-14 8.73e-06 NA 0.6466
2. PF B7LT82 Multidrug resistance protein MdtG 5.73e-12 1.05e-05 NA 0.6668
2. PF Q91514 Vesicular acetylcholine transporter 2.79e-09 2.09e-02 NA 0.5522
2. PF B4EYY4 Multidrug resistance protein MdtG 7.70e-11 2.04e-05 NA 0.6499
2. PF P0A4K8 Tetracycline resistance protein 6.19e-09 3.12e-03 NA 0.5435
2. PF Q1JQC1 Major facilitator superfamily domain-containing protein 1 1.98e-08 4.01e-03 NA 0.5366
2. PF B4TJR2 Sialic acid transporter NanT 1.32e-07 2.30e-05 NA 0.5127
2. PF P58530 Probable sugar efflux transporter 3.89e-10 5.55e-06 NA 0.5902
2. PF B6I8X0 Uncharacterized MFS-type transporter YcaD 2.66e-14 2.19e-05 NA 0.5487
2. PF Q1RI01 Putative transporter AmpG 4 4.99e-09 7.30e-05 NA 0.5502
2. PF Q7A5M0 Quinolone resistance protein NorB 1.94e-06 4.90e-03 NA 0.4726
2. PF B5QUA4 Probable sugar efflux transporter 4.22e-10 5.55e-06 NA 0.5985
2. PF B1JIR6 Protein TsgA homolog 1.80e-09 2.16e-09 NA 0.5474
2. PF Q6GPQ3 Major facilitator superfamily domain-containing protein 8 3.26e-10 3.09e-04 NA 0.5408
2. PF Q6D108 Lysophospholipid transporter LplT 1.98e-09 3.44e-05 NA 0.6325
2. PF P39843 Multidrug resistance protein 2 4.70e-09 2.80e-03 NA 0.5891
2. PF B5RET6 Sialic acid transporter NanT 1.26e-07 2.09e-05 NA 0.5315
2. PF Q8Z810 Uncharacterized MFS-type transporter YcaD 0.00e+00 9.17e-06 NA 0.606
2. PF Q1IB51 Probable sugar efflux transporter 2.44e-09 3.28e-05 NA 0.6263
2. PF A0A345BJP3 MFS-type transporter clz4 8.01e-10 2.13e-02 NA 0.5884
2. PF B7N4V3 Probable sugar efflux transporter 3.22e-10 1.92e-06 NA 0.5689
2. PF A9MRQ2 Probable sugar efflux transporter 3.96e-10 3.88e-06 NA 0.553
2. PF P96517 Melibiose permease 1.18e-10 2.63e-07 NA 0.5216
2. PF B7MIJ4 Multidrug resistance protein MdtG 2.65e-10 4.84e-06 NA 0.6735
2. PF B5YSV1 Sialic acid transporter NanT 1.27e-07 4.62e-05 NA 0.4864
2. PF P96712 Multidrug resistance protein 3 3.61e-09 4.38e-02 NA 0.594
2. PF B5BGP4 Sialic acid transporter NanT 6.46e-07 2.19e-05 NA 0.5027
2. PF B6I9D0 Multidrug resistance protein MdtG 2.69e-10 3.64e-06 NA 0.6733
2. PF Q8Z7L7 Multidrug resistance protein MdtG 9.72e-13 1.10e-06 NA 0.6804
2. PF O34961 Uncharacterized symporter YjmB 6.49e-09 2.73e-07 NA 0.6111
2. PF A6QGY6 Quinolone resistance protein NorB 1.16e-07 4.60e-03 NA 0.4614
2. PF B1LGI9 Sialic acid transporter NanT 1.05e-07 2.78e-05 NA 0.4709
2. PF B1X9G6 Multidrug resistance protein MdtG 1.89e-10 3.64e-06 NA 0.6711
2. PF Q8Z4Z9 Uncharacterized MFS-type transporter YfcJ 2.18e-09 9.05e-04 NA 0.5761
2. PF Q02LE0 Uncharacterized MFS-type transporter PA14_38730 2.67e-12 7.63e-06 NA 0.6338
2. PF B5FN15 Multidrug resistance protein MdtL 4.23e-09 8.57e-03 NA 0.6176
2. PF A9MRL9 Lysophospholipid transporter LplT 5.92e-09 2.05e-06 NA 0.5485
2. PF A8AGR7 Probable sugar efflux transporter 3.31e-10 1.10e-06 NA 0.5936
2. PF P26176 Uncharacterized protein in puhA-bchM intergenic region 1.95e-09 1.52e-18 NA 0.529
2. PF A1A9E1 Uncharacterized MFS-type transporter YcaD 1.26e-11 2.88e-05 NA 0.5339
2. PF P02980 Tetracycline resistance protein, class B 7.27e-10 8.85e-04 NA 0.6405
2. PF Q9CM87 Probable sugar efflux transporter 1.63e-09 5.71e-05 NA 0.5603
2. PF Q2FEB0 Probable nitrate transporter NarT 1.20e-11 8.89e-05 NA 0.6167
2. PF C0Q135 Uncharacterized MFS-type transporter YhhS 6.64e-09 2.29e-06 NA 0.6185
2. PF Q4L523 Proton-coupled antiporter flippase LtaA 1.52e-12 1.02e-12 NA 0.632
2. PF A7FFD2 Lysophospholipid transporter LplT 2.41e-09 1.21e-05 NA 0.5723
2. PF Q5R542 Molybdate-anion transporter 6.86e-10 1.05e-11 NA 0.4959
2. PF C4ZSW2 Sialic acid transporter NanT 1.97e-07 5.20e-05 NA 0.4626
2. PF P39589 Uncharacterized transporter YwbF 9.77e-11 1.77e-11 NA 0.5416
2. PF A6T8Y8 Probable sugar efflux transporter 2.79e-10 4.84e-06 NA 0.5701
2. PF Q83PL6 Multidrug resistance protein MdtL 2.58e-08 7.19e-03 NA 0.6037
2. PF B7M0T6 Sialic acid transporter NanT 5.89e-07 4.41e-05 NA 0.4458
2. PF P42417 Minor myo-inositol transporter IolF 7.36e-10 6.90e-08 NA 0.6328
2. PF Q9ZK41 Putative glucose/galactose transporter 6.28e-11 5.83e-04 NA 0.6392
2. PF Q8ZQD2 Uncharacterized MFS-type transporter YcaD 3.91e-14 2.16e-05 NA 0.5624
2. PF Q07609 Membrane protein MosC 1.73e-09 3.78e-04 NA 0.5388
2. PF B5BBD5 Multidrug resistance protein MdtG 9.59e-13 1.22e-06 NA 0.6333
2. PF B1IV49 Multidrug resistance protein MdtG 1.61e-10 3.64e-06 NA 0.6737
2. PF Q4UL88 Putative transporter AmpG 1 6.79e-09 3.02e-03 NA 0.4988
2. PF B5QUQ6 Multidrug resistance protein MdtL 1.22e-10 8.57e-03 NA 0.6149
2. PF Q0TJF2 Uncharacterized MFS-type transporter YcaD 1.23e-11 2.16e-05 NA 0.5256
2. PF Q3YWE6 Purine ribonucleoside efflux pump NepI 4.41e-09 2.49e-04 NA 0.5663
2. PF P18817 Lactose permease 2.05e-10 8.84e-06 NA 0.4749
2. PF B5QY11 Multidrug resistance protein MdtG 1.33e-15 9.83e-07 NA 0.6746
2. PF D8MQN9 Multidrug resistance protein MdtG 5.90e-11 1.51e-06 NA 0.6532
2. PF A9MT38 Protein TsgA 1.53e-09 2.83e-08 NA 0.533
2. PF B7N2F5 Multidrug resistance protein MdtL 2.47e-08 2.55e-03 NA 0.5914
2. PF A7X618 Probable nitrate transporter NarT 1.27e-10 6.34e-05 NA 0.6252
2. PF Q6GBR4 Putative proline/betaine transporter 7.84e-09 1.71e-04 NA 0.559
2. PF A7ZZ10 Multidrug resistance protein MdtG 2.05e-12 3.69e-06 NA 0.675
2. PF B4TES5 Multidrug resistance protein MdtG 3.35e-12 6.27e-06 NA 0.6736
2. PF I3R635 Probable nitrate transporter 6.25e-09 4.06e-05 NA 0.5309
2. PF B1X712 Protein TsgA 9.86e-10 6.99e-08 NA 0.5551
2. PF B1LJW4 Uncharacterized MFS-type transporter YcaD 1.90e-14 2.44e-05 NA 0.5457
2. PF B5YTS2 Protein TsgA 9.91e-09 4.19e-08 NA 0.5742
2. PF A4TN28 Uncharacterized MFS-type transporter YPDSF_2315 0.00e+00 1.67e-06 NA 0.5865
2. PF B6I2S3 Protein TsgA 1.69e-09 6.99e-08 NA 0.5742
2. PF Q0SZV2 Protein TsgA 1.83e-09 8.79e-09 NA 0.573
2. PF Q6CSN0 MFS-type transporter PUL3 4.13e-09 4.25e-08 NA 0.5075
2. PF B7UJV7 Sialic acid transporter NanT 4.12e-07 2.78e-05 NA 0.492
2. PF P9WJX6 Chloramphenicol efflux pump MT0201 1.88e-14 2.40e-02 NA 0.6043
2. PF P96656 Uncharacterized MFS-type transporter YddS 2.48e-09 1.56e-04 NA 0.618
2. PF B2U1W0 Sialic acid transporter NanT 1.37e-07 4.41e-05 NA 0.5255
2. PF Q1R4M4 Multidrug resistance protein MdtL 2.03e-08 3.32e-03 NA 0.5853
2. PF A7FJX9 Uncharacterized MFS-type transporter YpsIP31758_2592 8.24e-14 1.67e-06 NA 0.5971
2. PF A7ZYK2 Uncharacterized MFS-type transporter YcaD 1.35e-11 2.50e-05 NA 0.5218
2. PF B7LFG4 Multidrug resistance protein MdtG 3.34e-12 3.88e-06 NA 0.6787
2. PF P59269 Protein TsgA 1.99e-09 7.44e-09 NA 0.5695
2. PF C0PZN3 Sialic acid transporter NanT 1.54e-07 2.53e-05 NA 0.5044
2. PF C4ZRZ3 Multidrug resistance protein MdtG 1.71e-10 3.64e-06 NA 0.6716
2. PF A1JSB0 Protein TsgA homolog 7.90e-11 1.18e-08 NA 0.5584
2. PF B6I6W0 Lysophospholipid transporter LplT 9.02e-10 4.57e-05 NA 0.595
2. PF Q0TB40 Purine ribonucleoside efflux pump NepI 4.95e-09 1.13e-04 NA 0.589
2. PF P94376 Uncharacterized MFS-type transporter YxlH 1.93e-10 2.81e-05 NA 0.6896
2. PF A1KIJ9 Probable triacylglyceride transporter BCG_1471c 5.26e-09 9.58e-07 NA 0.5461
2. PF Q57J00 Protein TsgA 1.65e-09 1.18e-07 NA 0.541
2. PF A0A3G1DJG1 MFS-type transporter M2 2.17e-09 5.67e-03 NA 0.5945
2. PF B5XQW2 Probable sugar efflux transporter 2.80e-10 2.15e-06 NA 0.548
2. PF Q8ZGC3 Uncharacterized MFS-type transporter YPO1380/y2792.1/YP_1213 4.56e-12 1.67e-06 NA 0.5368
2. PF P59195 Uncharacterized MFS-type transporter YhhS 6.45e-09 3.41e-07 NA 0.6208
2. PF A6TG19 Multidrug resistance protein MdtL 1.14e-10 3.15e-03 NA 0.5841
2. PF A7FNS4 Protein TsgA homolog 6.09e-11 4.25e-09 NA 0.5599
2. PF B4T132 Uncharacterized MFS-type transporter YcaD 3.10e-14 2.16e-05 NA 0.5992
2. PF B6JN25 Probable sugar efflux transporter 7.71e-10 3.39e-03 NA 0.6263
2. PF B5EYX7 Multidrug resistance protein MdtL 4.34e-09 1.55e-02 NA 0.5964
2. PF A5U2B2 Probable triacylglyceride transporter MRA_1419 5.60e-09 9.58e-07 NA 0.5466
2. PF B7M1R7 Protein TsgA 1.66e-09 6.99e-08 NA 0.5722
2. PF P58120 Multi-drug resistance efflux pump PmrA homolog 4.67e-12 2.22e-07 NA 0.6016
2. PF B7MCY1 Protein TsgA 1.73e-09 6.99e-08 NA 0.5842
2. PF C0PXT4 Uncharacterized MFS-type transporter YcaD 3.64e-14 3.48e-05 NA 0.6093
2. PF Q68W71 Putative transporter AmpG 2 7.81e-08 2.87e-08 NA 0.5926
2. PF P9WJX0 Uncharacterized MFS-type transporter MT2531 8.17e-10 8.10e-05 NA 0.5604
2. PF Q6GGX2 Quinolone resistance protein NorB 2.21e-06 8.06e-03 NA 0.479
2. PF P9WJY6 Probable nitrate/nitrite transporter NarK2 4.64e-10 6.60e-07 NA 0.5888
2. PF A1ABA7 Probable sugar efflux transporter 3.15e-10 3.38e-06 NA 0.5694
2. PF A5WM93 Probable triacylglyceride transporter TBFG_11439 5.23e-09 9.58e-07 NA 0.5448
2. PF Q2YZ45 Probable nitrate transporter NarT 1.46e-09 8.29e-05 NA 0.6315
2. PF Q5HRH0 Putative proline/betaine transporter 7.41e-10 1.22e-02 NA 0.5271
2. PF Q02443 Protein PucC 5.09e-09 4.19e-09 NA 0.5829
2. PF Q32E16 Uncharacterized MFS-type transporter YcaD 1.27e-11 2.44e-05 NA 0.5232
2. PF Q1C2Q4 Protein TsgA homolog 8.97e-11 2.16e-09 NA 0.5338
2. PF B5R0L1 Sialic acid transporter NanT 8.30e-08 2.09e-05 NA 0.5019
2. PF Q31UW4 Multidrug resistance protein MdtL 2.11e-08 5.16e-03 NA 0.5938
2. PF P40760 Uncharacterized MFS-type transporter YuxJ 9.35e-11 3.97e-08 NA 0.6968
2. PF B2TUR5 Multidrug resistance protein MdtL 2.23e-08 5.16e-03 NA 0.5769
2. PF Q8FBX9 Purine ribonucleoside efflux pump NepI 2.94e-10 2.43e-04 NA 0.5879
2. PF O52717 Ribitol transporter 4.70e-08 1.27e-11 NA 0.5572
2. PF A3NYL8 Uncharacterized MFS-type transporter BURPS1106A_3201 1.64e-11 5.58e-05 NA 0.5751
2. PF P55682 Uncharacterized transporter y4wD 1.40e-10 1.55e-02 NA 0.5611
2. PF P95656 Protein PucC 1.77e-08 1.27e-09 NA 0.5158
2. PF Q08B29 Molybdate-anion transporter 7.15e-09 1.09e-11 NA 0.5377
2. PF Q5PN95 Probable sugar efflux transporter 4.26e-10 7.01e-06 NA 0.5973
2. PF A9MNY7 Sialic acid transporter NanT 1.05e-07 4.26e-05 NA 0.4731
2. PF B7LZD1 Probable sugar efflux transporter 3.23e-10 3.06e-06 NA 0.5691
2. PF Q329F4 Purine ribonucleoside efflux pump NepI 4.79e-09 3.61e-04 NA 0.5355
2. PF Q5HHX4 Quinolone resistance protein NorA 1.25e-11 8.52e-06 NA 0.5667
2. PF G0KYA8 Trichothecene efflux pump TRI12 1.69e-05 6.80e-04 NA 0.5514
2. PF B2JZ74 Lysophospholipid transporter LplT 9.38e-10 1.21e-05 NA 0.5762
2. PF B4T5G1 Probable sugar efflux transporter 3.55e-10 2.38e-06 NA 0.5575
2. PF P54559 Uncharacterized MFS-type transporter YqjV 9.61e-10 4.78e-07 NA 0.6311
2. PF Q2FH03 Quinolone resistance protein NorB 1.77e-06 4.60e-03 NA 0.4515
2. PF O32182 Uncharacterized MFS-type transporter YusP 5.57e-09 7.26e-04 NA 0.4911
2. PF B5YT34 Uncharacterized MFS-type transporter YcaD 9.22e-12 2.44e-05 NA 0.5387
2. PF B7NKT5 Sialic acid transporter NanT 8.20e-08 2.78e-05 NA 0.5002
2. PF Q1RDV7 Uncharacterized MFS-type transporter YcaD 1.98e-14 2.88e-05 NA 0.5403
2. PF Q5HLK7 Probable nitrate transporter NarT 2.26e-09 5.97e-06 NA 0.6466
2. PF P0A4K5 Multi-drug resistance efflux pump PmrA 2.49e-10 7.13e-05 NA 0.6765
2. PF Q5PGY0 Multidrug resistance protein MdtG 4.55e-11 1.22e-06 NA 0.6598
2. PF Q31US4 Purine ribonucleoside efflux pump NepI 4.57e-09 5.96e-04 NA 0.5662
2. PF O34368 Probable glucitol transport protein GutA 1.79e-09 8.22e-06 NA 0.59
2. PF A1A9U9 Multidrug resistance protein MdtG 1.45e-10 4.84e-06 NA 0.6734
2. PF B7UP67 Multidrug resistance protein MdtG 6.27e-12 4.84e-06 NA 0.6737
2. PF E8XY75 Multidrug resistance protein MdtG 3.91e-12 2.47e-05 NA 0.6853
2. PF B4SZP4 Uncharacterized MFS-type transporter YfcJ 2.56e-10 5.83e-04 NA 0.576
2. PF B5BK54 Probable sugar efflux transporter 3.38e-10 7.01e-06 NA 0.5715
2. PF P9WJX4 Putative uncharacterized MFS-type transporter MT0872 4.14e-13 1.49e-08 NA 0.6194
2. PF Q0T066 Sialic acid transporter NanT 5.16e-07 4.41e-05 NA 0.483
2. PF B7UMH7 Multidrug resistance protein MdtL 2.52e-08 3.65e-03 NA 0.5703
2. PF Q5PKV6 Multidrug resistance protein MdtL 1.12e-10 3.86e-02 NA 0.605
2. PF B7MS16 Uncharacterized MFS-type transporter YcaD 2.08e-14 2.88e-05 NA 0.5343
2. PF A4W8S1 Uncharacterized MFS-type transporter Ent638_1421 1.72e-14 2.11e-05 NA 0.5282
2. PF B7VAB2 Uncharacterized MFS-type transporter PLES_33301 1.88e-10 7.01e-06 NA 0.6256
2. PF Q0VC03 Molybdate-anion transporter 7.19e-10 1.02e-10 NA 0.5297
2. PF Q9C1B3 Trichothecene efflux pump TRI12 7.34e-06 5.16e-04 NA 0.5723
2. PF C0Q4U6 Probable sugar efflux transporter 3.32e-10 1.51e-06 NA 0.5705
2. PF A9N5Q9 Multidrug resistance protein MdtG 1.03e-12 1.49e-06 NA 0.6776
2. PF A1JN04 Multidrug resistance protein MdtG 1.41e-09 2.84e-07 NA 0.657
2. PF Q1RDA5 Multidrug resistance protein MdtG 8.18e-11 4.84e-06 NA 0.6779
2. PF B2KA13 Uncharacterized MFS-type transporter YPTS_1506 4.59e-12 1.67e-06 NA 0.5144
2. PF Q9CCP7 Probable triacylglyceride transporter ML0556 4.53e-09 1.26e-04 NA 0.4928
2. PF Q664N1 Protein TsgA homolog 7.68e-11 4.25e-09 NA 0.5301
2. PF Q2W8R0 Magnetosome protein MamH 8.47e-11 9.01e-10 NA 0.5969
2. PF A4TGV3 Protein TsgA homolog 9.96e-11 2.16e-09 NA 0.6152
2. PF Q8NWQ5 Quinolone resistance protein NorB 1.99e-06 5.61e-03 NA 0.475
2. PF Q8ZKY1 Multidrug resistance protein MdtL 2.25e-08 1.12e-02 NA 0.6047
2. PF A7X2C6 Quinolone resistance protein NorB 1.93e-07 4.90e-03 NA 0.4631
2. PF P0A4K4 Multi-drug resistance efflux pump PmrA 2.73e-09 7.13e-05 NA 0.6621
2. PF Q4WGS5 Siderophore iron transporter 1 8.58e-06 5.05e-03 NA 0.5825
2. PF A9MJ53 Uncharacterized MFS-type transporter YfcJ 2.52e-11 1.18e-03 NA 0.572
2. PF P55647 Uncharacterized MFS-type transporter y4rN 7.03e-10 1.96e-04 NA 0.5351
2. PF C6DE42 Lysophospholipid transporter LplT 2.67e-09 1.24e-05 NA 0.5258
2. PF B4TN12 Multidrug resistance protein MdtL 2.46e-09 1.63e-02 NA 0.5904
2. PF Q6DDL7 Protein unc-93 homolog A 5.16e-09 3.81e-03 NA 0.481
2. PF Q1RKF6 Putative transporter AmpG 3 2.86e-09 9.82e-09 NA 0.5274
2. PF B7N1E7 Protein TsgA 1.69e-09 2.83e-08 NA 0.5757
2. PF A4WE10 Lysophospholipid transporter LplT 8.96e-10 5.96e-04 NA 0.5785
2. PF B7MHL0 Uncharacterized MFS-type transporter YcaD 1.23e-11 2.88e-05 NA 0.5527
2. PF A9MH10 Multidrug resistance protein MdtG 8.12e-13 7.73e-06 NA 0.691
2. PF B7LN63 Uncharacterized MFS-type transporter YcaD 8.19e-12 1.27e-05 NA 0.5384
2. PF Q8ZJE6 Protein TsgA homolog 6.17e-11 2.16e-09 NA 0.5631
2. PF Q31XF2 Lysophospholipid transporter LplT 5.21e-09 4.36e-05 NA 0.5358
2. PF Q8X4S4 Protein TsgA 1.41e-09 4.19e-08 NA 0.5709
2. PF A5ISW7 Quinolone resistance protein NorB 1.42e-07 4.90e-03 NA 0.4631
2. PF P45123 Bicyclomycin resistance protein homolog 1.11e-08 3.02e-02 NA 0.545
2. PF O34546 Uncharacterized MFS-type transporter YttB 2.65e-11 8.11e-07 NA 0.5733
2. PF B7LRC4 Probable sugar efflux transporter 4.01e-10 2.27e-06 NA 0.5764
2. PF Q92EE1 Lincomycin resistance protein LmrB 1.82e-06 1.81e-03 NA 0.6183
2. PF C0Q2L5 Multidrug resistance protein MdtL 1.64e-10 1.66e-02 NA 0.5891
2. PF Q8ZQ25 Multidrug resistance protein MdtG 1.78e-15 1.02e-06 NA 0.6753
2. PF B7LHS8 Sialic acid transporter NanT 1.12e-06 4.41e-05 NA 0.5078
2. PF A9MJT5 Multidrug resistance protein MdtL 1.17e-10 4.19e-03 NA 0.613
2. PF Q27115 Glucose transporter HT1 2.14e-07 1.75e-04 NA 0.5096
2. PF Q8Z257 Uncharacterized MFS-type transporter YhhS 6.66e-09 1.06e-06 NA 0.6313
2. PF Q9ZK31 Probable sugar efflux transporter 4.54e-10 9.66e-04 NA 0.6398
2. PF Q66CJ8 Uncharacterized MFS-type transporter YPTB1405 5.09e-12 1.67e-06 NA 0.5155
2. PF Q797E3 Purine efflux pump PbuE 5.35e-10 1.35e-04 NA 0.5466
2. PF Q57PB5 Probable sugar efflux transporter 3.30e-10 1.51e-06 NA 0.5911
2. PF P60779 Protein TsgA 1.60e-09 6.99e-08 NA 0.575
2. PF Q3JPB5 Uncharacterized MFS-type transporter BURPS1710b_3216 9.42e-11 2.81e-05 NA 0.6368
2. PF B7NVY1 Lysophospholipid transporter LplT 4.03e-09 4.16e-05 NA 0.5455
2. PF Q93SM8 Uncharacterized MFS-type transporter BPSL2729 6.56e-11 2.81e-05 NA 0.6407
2. PF Q0TJ20 Multidrug resistance protein MdtG 4.90e-12 3.64e-06 NA 0.6786
2. PF Q57JD0 Sialic acid transporter NanT 7.62e-08 2.53e-05 NA 0.5111
2. PF B4TAV4 Multidrug resistance protein MdtL 4.31e-09 2.26e-02 NA 0.6017
2. PF C4ZUM0 Protein TsgA 1.76e-09 6.99e-08 NA 0.5663
2. PF C0Q855 Multidrug resistance protein MdtG 1.04e-12 1.32e-06 NA 0.6749
2. PF B7LK52 Multidrug resistance protein MdtL 1.38e-10 7.04e-03 NA 0.5845
2. PF Q1CS80 Probable sugar efflux transporter 8.16e-10 2.89e-03 NA 0.6847
2. PF O25797 Probable sugar efflux transporter 9.33e-10 4.23e-03 NA 0.6404
2. PF O67513 Uncharacterized protein aq_1569 3.46e-10 1.26e-14 NA 0.6092
2. PF P23054 Tetracycline resistance protein 1.32e-08 1.38e-03 NA 0.5276
2. PF B1XDP1 Lysophospholipid transporter LplT 8.35e-10 5.14e-05 NA 0.5898
2. PF A2S9N6 Uncharacterized MFS-type transporter BMA10229_A2703 7.12e-11 2.81e-05 NA 0.6426
2. PF A6QJM8 Probable nitrate transporter NarT 1.36e-09 8.89e-05 NA 0.6362
2. PF C4ZXQ4 Purine ribonucleoside efflux pump NepI 5.27e-09 2.85e-04 NA 0.5358
2. PF B4TWI9 Sialic acid transporter NanT 1.22e-07 2.38e-05 NA 0.5137
2. PF Q51330 Oxalate:formate antiporter 1.15e-09 6.96e-05 NA 0.5551
2. PF B7MRM9 Enterobactin exporter EntS 3.35e-12 3.33e-08 NA 0.5032
2. PF B1LR33 Lysophospholipid transporter LplT 9.33e-10 4.16e-05 NA 0.5524
2. PF Q6PB15 UNC93-like protein MFSD11 1.83e-08 1.66e-03 NA 0.5248
2. PF P51564 Tetracycline resistance protein, class H 1.64e-12 2.56e-05 NA 0.5879
2. PF Q8FHE6 Probable sugar efflux transporter 3.24e-10 3.38e-06 NA 0.5696
2. PF P0AE25 Arabinose-proton symporter 5.02e-08 5.21e-03 NA 0.5645
2. PF Q6GIU7 Quinolone resistance protein NorA 2.05e-10 2.88e-05 NA 0.5721
2. PF Q8Z2N9 Multidrug resistance protein MdtL 3.80e-09 2.53e-02 NA 0.6203
2. PF Q9L7R4 Putative sulfoquinovose importer 2.13e-09 1.66e-07 NA 0.5748
2. PF P0A0J8 Antiseptic resistance protein 3.15e-10 4.13e-02 NA 0.5581
2. PF B5F150 Uncharacterized MFS-type transporter YcaD 2.13e-14 3.48e-05 NA 0.5998
2. PF Q62I47 Uncharacterized MFS-type transporter BMA2043 7.23e-11 2.81e-05 NA 0.6391
2. PF A8ACM0 Multidrug resistance protein MdtL 5.98e-09 7.81e-03 NA 0.5981
2. PF B7M928 Multidrug resistance protein MdtG 5.40e-12 3.64e-06 NA 0.6735
2. PF Q8FBV0 Multidrug resistance protein MdtL 2.30e-08 2.55e-03 NA 0.586
2. PF P96664 Uncharacterized MFS-type transporter YdeG 1.41e-09 3.60e-02 NA 0.6087
2. PF B7NAP9 Uncharacterized MFS-type transporter YcaD 2.15e-14 3.24e-05 NA 0.6169
2. PF B5F8I5 Protein TsgA 1.50e-09 1.42e-07 NA 0.539
2. PF O35018 Lincomycin resistance protein LmrB 4.49e-07 4.19e-03 NA 0.5893
2. PF Q99RP1 Probable nitrate transporter NarT 1.76e-09 6.34e-05 NA 0.6318
2. PF B6I1U2 Sialic acid transporter NanT 2.35e-07 2.78e-05 NA 0.49
2. PF A2VE54 Protein unc-93 homolog A 2.88e-10 2.99e-02 NA 0.5562
2. PF A8A081 Probable sugar efflux transporter 4.20e-10 3.06e-06 NA 0.5678
2. PF B5R2C3 Protein TsgA 1.40e-09 3.92e-08 NA 0.5329
2. PF B5FUB8 Lysophospholipid transporter LplT 9.89e-12 8.39e-05 NA 0.5818
2. PF P37498 Uncharacterized MFS-type transporter YybF 1.03e-10 2.09e-02 NA 0.5662
2. PF B1IRT2 Probable sugar efflux transporter 4.61e-10 3.06e-06 NA 0.5641
2. PF A9MHY5 Uncharacterized MFS-type transporter YcaD 3.42e-10 3.20e-05 NA 0.5498
2. PF Q667F2 Lysophospholipid transporter LplT 9.75e-10 1.21e-05 NA 0.5678
2. PF P40862 Proline/betaine transporter 5.44e-09 2.81e-05 NA 0.4821
2. PF Q8FIR9 Multidrug resistance protein MdtG 2.33e-10 3.64e-06 NA 0.6728
2. PF P9WJY0 Uncharacterized MFS-type transporter MT0042 4.92e-13 2.89e-03 NA 0.4391
2. PF Q8XB84 Multidrug resistance protein MdtM 1.12e-08 1.36e-04 NA 0.5387
2. PF B5BH18 Protein TsgA 1.44e-09 3.15e-08 NA 0.5405
2. PF P94488 Uncharacterized symporter YnaJ 4.98e-11 4.26e-07 NA 0.6351
2. PF A5D7V7 Solute carrier family 46 member 3 2.94e-09 1.01e-05 NA 0.5542
2. PF P58529 Probable sugar efflux transporter 3.31e-10 2.21e-06 NA 0.5691
2. PF Q2YY45 Quinolone resistance protein NorB 1.81e-07 1.03e-02 NA 0.4852
2. PF A1JMG4 Uncharacterized MFS-type transporter YE1530 1.73e-14 7.92e-06 NA 0.5373
2. PF A8AQR8 Protein TsgA homolog 1.39e-09 4.20e-07 NA 0.5656
2. PF A8AQB4 Sialic acid transporter NanT 1.90e-07 8.10e-05 NA 0.5011
2. PF Q0TC96 Protein TsgA 1.67e-09 2.83e-08 NA 0.5735
2. PF Q9I2B6 Uncharacterized MFS-type transporter PA1993 2.47e-10 7.01e-06 NA 0.615
2. PF A7MJD1 Sialic acid transporter NanT 5.50e-07 2.41e-05 NA 0.4955
2. PF C0Q212 Purine ribonucleoside efflux pump NepI 1.83e-10 8.49e-05 NA 0.6073
2. PF Q6G6T3 Probable nitrate transporter NarT 9.63e-12 8.89e-05 NA 0.6302
2. PF A7ZSB7 Sialic acid transporter NanT 4.80e-07 2.78e-05 NA 0.5128
2. PF B1LF85 Probable sugar efflux transporter 4.19e-10 3.14e-06 NA 0.5633
2. PF Q1CFA8 Lysophospholipid transporter LplT 1.93e-09 1.21e-05 NA 0.5697
2. PF Q8XC49 Purine ribonucleoside efflux pump NepI 4.98e-09 2.27e-04 NA 0.5357
2. PF C4ZWU5 Probable sugar efflux transporter 3.24e-10 3.06e-06 NA 0.5696
2. PF Q4L3Q4 Putative proline/betaine transporter 5.32e-09 1.13e-04 NA 0.5402
2. PF Q6GBD5 Quinolone resistance protein NorA 5.75e-11 1.23e-05 NA 0.5695
2. PF Q6G9C6 Quinolone resistance protein NorB 1.89e-06 5.61e-03 NA 0.4463
2. PF Q9L7R5 Putative 2,3-dihydroxypropane-1-sulfonate exporter 1.92e-09 9.59e-11 NA 0.6016
2. PF A7ZJW9 Uncharacterized MFS-type transporter YcaD 1.15e-11 2.19e-05 NA 0.5236
2. PF Q5HFY7 Quinolone resistance protein NorB 1.97e-06 6.49e-03 NA 0.5106
2. PF B1IX28 Multidrug resistance protein MdtL 2.76e-08 5.16e-03 NA 0.58
2. PF A0R5K5 Multidrug efflux pump LfrA 1.71e-09 1.44e-02 NA 0.447
2. PF B7MBY6 Sialic acid transporter NanT 6.54e-07 2.91e-05 NA 0.4388
2. PF Q8Y9K8 Lincomycin resistance protein LmrB 1.48e-07 2.10e-03 NA 0.6207
2. PF B2U3H0 Protein TsgA 9.83e-09 5.39e-09 NA 0.6002
2. PF Q8XB24 Multidrug resistance protein MdtL 1.78e-09 2.47e-03 NA 0.5852
2. PF A1AHP3 Multidrug resistance protein MdtL 2.00e-08 3.32e-03 NA 0.5944
2. PF A7ZTR5 Multidrug resistance protein MdtL 1.90e-10 4.14e-03 NA 0.5956
2. PF Q8X625 Inner membrane transport protein YdhP 5.16e-09 2.77e-03 NA 0.5882
2. PF Q7A3U8 Probable nitrate transporter NarT 6.35e-12 6.34e-05 NA 0.626
2. PF A8A6H2 Multidrug resistance protein MdtL 1.63e-10 5.16e-03 NA 0.5752
2. PF A8Z577 Probable nitrate transporter NarT 1.22e-10 8.89e-05 NA 0.6138
2. PF A6TDH1 Lysophospholipid transporter LplT 7.75e-10 4.23e-03 NA 0.5607
2. PF P9WJY2 Probable triacylglyceride transporter MT1454 7.19e-09 9.58e-07 NA 0.5492
2. PF Q0T8J4 Uncharacterized MFS-type transporter YcaD 6.51e-12 1.37e-05 NA 0.5306
2. PF B1JRE9 Uncharacterized MFS-type transporter YPK_2680 4.88e-12 8.63e-06 NA 0.5399
2. PF B7LLK9 Enterobactin exporter EntS 4.58e-12 3.37e-08 NA 0.5013
2. PF Q87FV4 Multidrug resistance protein MdtL 1.88e-09 1.82e-02 NA 0.5751
2. PF B5Z1Y4 Probable sugar efflux transporter 3.30e-10 1.92e-06 NA 0.5686
2. PF P0C105 Glucose/galactose transporter 6.99e-15 1.54e-05 NA 0.6159
2. PF B4T2Y5 Multidrug resistance protein MdtG 1.00e-12 1.49e-06 NA 0.6832
2. PF Q8FDU9 Sialic acid transporter NanT 2 1.01e-06 3.08e-03 NA 0.5437
2. PF Q92HQ3 Putative transporter AmpG 1 9.58e-09 6.96e-05 NA 0.5265
2. PF B7UK75 Protein TsgA 1.63e-09 6.99e-08 NA 0.5728
2. PF Q0SYK8 Purine ribonucleoside efflux pump NepI 3.71e-10 2.85e-04 NA 0.6069
2. PF Q92GV3 Putative transporter AmpG 2 1.30e-08 1.62e-07 NA 0.5347
2. PF B6I3U3 Multidrug resistance protein MdtL 2.89e-08 5.38e-03 NA 0.5846
2. PF P37482 Uncharacterized transporter YycB 9.05e-09 4.54e-11 NA 0.5643
2. PF A9MX86 Multidrug resistance protein MdtL 2.02e-08 1.08e-02 NA 0.6067
2. PF Q1R4R9 Purine ribonucleoside efflux pump NepI 3.50e-10 2.38e-04 NA 0.5514
2. PF Q5PGH4 Uncharacterized MFS-type transporter YcaD 2.85e-14 5.76e-06 NA 0.6063
2. PF P0ADL2 Purine ribonucleoside efflux pump NepI 3.94e-10 2.85e-04 NA 0.5364
2. PF Q43975 4-hydroxybenzoate transporter PcaK 5.16e-09 2.50e-02 NA 0.5426
2. PF Q9RUR0 Putative sugar efflux transporter DR_1322 9.89e-09 3.54e-03 NA 0.6097
2. PF P26171 Bacteriochlorophyll synthase 44.5 kDa chain 3.12e-09 8.23e-17 NA 0.6131
2. PF E3GC98 Multidrug resistance protein MdtG 2.74e-09 2.18e-08 NA 0.6512
2. PF A1AGP8 Protein TsgA 2.17e-09 6.99e-08 NA 0.5719
2. PF Q7U042 Probable triacylglyceride transporter Mb1445c 5.55e-09 9.58e-07 NA 0.5143
2. PF Q57QK4 Multidrug resistance protein MdtG 5.96e-10 1.28e-06 NA 0.5763
2. PF B1X9T9 Multidrug resistance protein MdtL 3.36e-10 5.38e-03 NA 0.5871
2. PF Q6NE63 Magnetosome protein MamH 1.81e-12 1.92e-10 NA 0.5962
2. PF P53988 Monocarboxylate transporter 2 9.36e-10 8.01e-05 NA 0.4521
2. PF B7MGD1 Multidrug resistance protein MdtL 3.19e-10 3.32e-03 NA 0.5948
2. PF B7LD90 Uncharacterized MFS-type transporter YcaD 1.25e-11 2.44e-05 NA 0.5258
2. PF P54585 Uncharacterized MFS-type transporter YhcA 3.64e-09 4.36e-05 NA 0.539
2. PF P46907 Nitrite extrusion protein 1.49e-09 1.01e-08 NA 0.5864
2. PF A7MR37 Lysophospholipid transporter LplT 7.52e-10 7.82e-05 NA 0.5668
2. PF Q3Z3M2 Uncharacterized MFS-type transporter YcaD 1.21e-11 2.19e-05 NA 0.5223
2. PF Q89A23 Uncharacterized transporter bbp_532 1.19e-10 4.43e-02 NA 0.5559
2. PF B7NR12 Multidrug resistance protein MdtL 2.21e-08 4.14e-03 NA 0.5659
2. PF Q0THR1 Probable sugar efflux transporter 3.85e-10 1.95e-06 NA 0.5687
2. PF A0KGK4 Multidrug resistance protein MdtH 1.04e-10 5.55e-06 NA 0.5905
2. PF P30878 Melibiose carrier protein 1.91e-10 6.95e-10 NA 0.6096
2. PF Q4UMU2 Putative transporter AmpG 2 1.37e-08 1.10e-07 NA 0.5626
2. PF P0A0J9 Antiseptic resistance protein 2.56e-10 4.13e-02 NA 0.5602
2. PF A8AII1 Uncharacterized MFS-type transporter CKO_02171 1.08e-11 2.11e-05 NA 0.5309
2. PF B7M562 Multidrug resistance protein MdtL 2.21e-10 4.14e-03 NA 0.5747
2. PF B5F954 Multidrug resistance protein MdtG 1.33e-15 1.49e-06 NA 0.6822
2. PF P39637 Uncharacterized MFS-type transporter YwfA 1.21e-09 7.91e-05 NA 0.5349
2. PF A9N832 Sialic acid transporter NanT 1.19e-07 2.09e-05 NA 0.4956
2. PF P0A2G5 Sialic acid transporter NanT 5.72e-07 2.09e-05 NA 0.4503
2. PF A8AI28 Multidrug resistance protein MdtG 9.94e-13 1.97e-06 NA 0.6768
2. PF P58531 Probable sugar efflux transporter 4.18e-10 4.12e-06 NA 0.5813
2. PF B4TVJ2 Probable sugar efflux transporter 3.24e-10 2.84e-06 NA 0.5913
2. PF Q3YWK3 Multidrug resistance protein MdtL 2.46e-08 5.16e-03 NA 0.5943
2. PF Q0GQS6 Purine efflux pump PbuE 3.39e-10 6.30e-04 NA 0.5686
2. PF Q57LY2 Uncharacterized MFS-type transporter YfcJ 1.75e-11 2.25e-04 NA 0.592
2. PF Q83RZ5 Uncharacterized MFS-type transporter YcaD 1.14e-11 1.37e-05 NA 0.5276
2. PF P0A0J7 Quinolone resistance protein NorA 2.30e-10 1.35e-05 NA 0.5904
2. PF Q7A771 Putative proline/betaine transporter 5.28e-09 1.43e-04 NA 0.5263
2. PF Q0SYP9 Multidrug resistance protein MdtL 1.51e-10 4.46e-03 NA 0.5985
2. PF Q8SUG7 ADP,ATP carrier protein 4 1.11e-06 1.02e-11 NA 0.4577
2. PF B4TSR5 Multidrug resistance protein MdtG 1.23e-12 2.73e-06 NA 0.6267
2. PF B7MTI5 Multidrug resistance protein MdtG 2.16e-10 5.55e-06 NA 0.6738
2. PF Q7CGZ2 Lysophospholipid transporter LplT 3.40e-10 1.21e-05 NA 0.5807
2. PF Q9S3K0 Sugar efflux transporter A 2.33e-15 1.97e-06 NA 0.5074
2. PF P9WJW6 Uncharacterized MFS-type transporter MT3072 2.01e-08 7.13e-05 NA 0.533
2. PF Q02581 Melibiose carrier protein 2.82e-10 5.55e-09 NA 0.6152
2. PF B5Z8H9 Probable sugar efflux transporter 4.63e-10 2.39e-03 NA 0.6755
2. PF B5XXK2 Multidrug resistance protein MdtG 6.03e-11 1.03e-06 NA 0.6624
2. PF A3NCV3 Uncharacterized MFS-type transporter BURPS668_3162 9.19e-11 2.81e-05 NA 0.6415
2. PF Q1CAS7 Lysophospholipid transporter LplT 2.63e-09 1.21e-05 NA 0.5806
2. PF Q8FJC1 Uncharacterized MFS-type transporter YcaD 1.65e-11 2.88e-05 NA 0.5324
2. PF Q55721 Folate-biopterin transporter 4.97e-08 1.52e-10 NA 0.5111
2. PF Q7N7A8 Lysophospholipid transporter LplT 3.72e-10 2.72e-03 NA 0.515
2. PF Q9ZCG7 Putative transporter AmpG 3 3.27e-10 1.27e-06 NA 0.5597
2. PF Q28E13 Molybdate-anion transporter 1.75e-08 8.02e-11 NA 0.5464
2. PF Q0TK80 Enterobactin exporter EntS 3.15e-12 3.61e-08 NA 0.475
2. PF Q6GE44 Probable nitrate transporter NarT 9.22e-12 8.89e-05 NA 0.6247
2. PF Q320K4 Probable sugar efflux transporter 3.73e-10 3.06e-06 NA 0.5673
2. PF B5R3Y2 Uncharacterized MFS-type transporter YhhS 7.45e-10 1.42e-06 NA 0.6292
2. PF B7L4N9 Protein TsgA 1.60e-09 6.99e-08 NA 0.5718
2. PF B7M826 Uncharacterized MFS-type transporter YcaD 5.66e-14 2.19e-05 NA 0.5252
2. PF A8A534 Sialic acid transporter NanT 8.58e-07 5.98e-05 NA 0.4838
2. PF B5R7P0 Protein TsgA 1.38e-09 1.21e-08 NA 0.5334
2. PF Q1RIL0 Putative transporter AmpG 1 3.60e-08 1.29e-07 NA 0.5348
2. PF Q492K8 Multidrug resistance protein MdtH 1.64e-09 4.67e-08 NA 0.5648
2. PF Q28FF3 Solute carrier family 49 member A3 1.68e-09 3.69e-04 NA 0.4811
2. PF B4SYB3 Multidrug resistance protein MdtL 3.77e-09 1.08e-02 NA 0.6498
2. PF P12681 Phosphoglycerate transporter protein 3.29e-12 1.99e-02 NA 0.5849
2. PF Q4WKX3 MFS-type transporter AFUA_1G00970 2.95e-09 8.19e-05 NA 0.6157
5. P P58163 Probable multidrug resistance protein NorM 2.99e-06 1.04e-02 NA NA
5. P O52351 Protein translocase subunit SecY 1.66e-03 2.45e-02 NA NA
5. P Q1RIG3 ADP,ATP carrier protein 4 2.50e-07 1.65e-04 NA NA
5. P Q5NYX9 Probable multidrug resistance protein NorM 4.38e-06 6.03e-03 NA NA
5. P Q8UDF5 Probable multidrug resistance protein NorM 4.02e-06 8.02e-06 NA NA
5. P B9KIT6 NADH-quinone oxidoreductase subunit N 9.09e-05 3.78e-04 NA NA
5. P B2TW57 NADH-quinone oxidoreductase subunit N 6.04e-05 7.13e-05 NA NA
5. P P67445 Xanthine permease XanQ 1.88e-03 3.50e-02 NA NA
5. P Q58CT4 Transmembrane protein 180 2.30e-09 8.66e-04 NA NA
5. P B7MF03 Enterobactin exporter EntS 3.32e-12 8.21e-08 NA NA
5. P B4SVH5 Protein TsgA 1.54e-09 1.42e-07 NA NA
5. P A0L190 Multidrug resistance protein MdtL 5.41e-09 4.51e-02 NA NA
5. P C6XJX0 NADH-quinone oxidoreductase subunit N 3.18e-05 3.45e-04 NA NA
5. P A0LEQ8 NADH-quinone oxidoreductase subunit N 1 3.81e-05 7.73e-05 NA NA
5. P P0CD00 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.50e-05 2.55e-04 NA NA
5. P B5E960 NADH-quinone oxidoreductase subunit N 3.36e-05 3.86e-02 NA NA
5. P P15578 NADH-ubiquinone oxidoreductase chain 2 1.46e-04 3.05e-02 NA NA
5. P A0A1D8PN14 Glycerophosphocholine permease GIT4 2.18e-08 7.11e-04 NA NA
5. P Q6D2S9 NADH-quinone oxidoreductase subunit N 3.16e-05 2.15e-04 NA NA
5. P Q4UN85 ADP,ATP carrier protein 1 4.31e-08 1.78e-08 NA NA
5. P Q669B2 NADH-quinone oxidoreductase subunit N 3.47e-05 7.38e-05 NA NA
5. P C0Z763 NADH-quinone oxidoreductase subunit N 1.47e-04 1.69e-04 NA NA
5. P Q67ID0 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 5.26e-05 3.53e-04 NA NA
5. P B7US04 Multidrug resistance protein MdtK 3.73e-06 4.04e-04 NA NA
5. P D0ZHC6 Multidrug transporter MdfA 2.10e-08 3.46e-02 NA NA
5. P Q8CPR4 Proton-coupled antiporter flippase LtaA 5.94e-10 9.76e-12 NA NA
5. P P0CC90 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 6.64e-05 3.53e-04 NA NA
5. P P72823 NAD(P)H-quinone oxidoreductase chain 4-2 9.27e-05 3.33e-02 NA NA
5. P Q3MB63 NAD(P)H-quinone oxidoreductase subunit 2 2.01e-05 2.63e-03 NA NA
5. P B9L178 NADH-quinone oxidoreductase subunit N 3.63e-05 1.06e-02 NA NA
5. P Q8G2I1 Probable multidrug resistance protein NorM 6.70e-06 2.55e-02 NA NA
5. P B4TET8 Multidrug resistance protein MdtH 3.11e-10 8.32e-06 NA NA
5. P Q1IS52 NADH-quinone oxidoreductase subunit N 1 2.80e-05 9.35e-04 NA NA
5. P Q6NUT3 Major facilitator superfamily domain-containing protein 12 2.38e-09 1.34e-03 NA NA
5. P B7MLI1 Lysophospholipid transporter LplT 6.53e-09 5.02e-05 NA NA
5. P A4TJL9 Multidrug resistance protein MdtH 1.19e-10 3.61e-05 NA NA
5. P Q2KUY6 NADH-quinone oxidoreductase subunit N 1.38e-05 3.17e-05 NA NA
5. P P0CC97 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.06e-05 2.55e-04 NA NA
5. P P69367 Multidrug resistance protein MdtH 5.84e-10 6.84e-06 NA NA
5. P Q60366 Ammonium transporter Amt1 1.62e-04 5.05e-03 NA NA
5. P Q9RY44 Probable multidrug resistance protein NorM 6.40e-06 1.13e-03 NA NA
5. P P59845 Probable vesicular acetylcholine transporter-B 2.35e-09 2.41e-06 NA NA
5. P B1NTR4 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 2.45e-05 1.67e-04 NA NA
5. P Q96JT2 Solute carrier family 45 member 3 6.49e-07 3.65e-05 NA NA
5. P Q68VW8 Putative transporter AmpG 3 2.48e-10 2.10e-07 NA NA
5. P Q6DEJ6 Sodium-dependent lysophosphatidylcholine symporter 1-B 2.25e-10 2.96e-03 NA NA
5. P Q4UN46 ADP,ATP carrier protein 5 2.06e-08 2.75e-08 NA NA
5. P O45166 Folate-like transporter 2 7.81e-11 1.21e-07 NA NA
5. P B7J7T2 NADH-quinone oxidoreductase subunit N 2.19e-05 9.42e-05 NA NA
5. P Q32S08 NAD(P)H-quinone oxidoreductase chain 4, chloroplastic 4.22e-05 2.05e-02 NA NA
5. P Q88CB9 Probable multidrug resistance protein NorM 2.97e-06 2.82e-02 NA NA
5. P P0CD57 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.12e-05 6.16e-04 NA NA
5. P Q7RTY0 Monocarboxylate transporter 13 2.55e-08 5.73e-03 NA NA
5. P Q9PR97 Uncharacterized protein UU048 1.40e-05 3.73e-06 NA NA
5. P P0AFF4 Nucleoside permease NupG 6.04e-12 4.37e-09 NA NA
5. P B5FKZ8 Multidrug resistance protein MdtH 6.10e-10 8.32e-06 NA NA
5. P B4TBI2 NADH-quinone oxidoreductase subunit N 6.09e-05 2.16e-05 NA NA
5. P B7MIK6 Multidrug resistance protein MdtH 5.45e-10 6.84e-06 NA NA
5. P A1AF46 Lysophospholipid transporter LplT 9.38e-10 5.02e-05 NA NA
5. P Q9XIQ7 Probable folate-biopterin transporter 7 1.01e-09 7.11e-04 NA NA
5. P Q2QWW7 Probable anion transporter 7 9.93e-10 2.93e-02 NA NA
5. P Q5QWR6 Probable multidrug resistance protein NorM 7.83e-06 3.65e-04 NA NA
5. P Q2JTD6 NAD(P)H-quinone oxidoreductase chain 4 2 1.95e-05 4.60e-02 NA NA
5. P Q48N46 Probable sugar efflux transporter 4.17e-10 1.90e-05 NA NA
5. P P9WLI2 Uncharacterized protein MT2265 5.19e-08 3.06e-06 NA NA
5. P P0CD06 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.29e-05 2.08e-03 NA NA
5. P B4U8I1 NADH-quinone oxidoreductase subunit N 1 2.00e-05 1.75e-04 NA NA
5. P Q07QW3 NADH-quinone oxidoreductase subunit N 1.04e-04 1.29e-04 NA NA
5. P Q9RGZ2 Na(+)/H(+) antiporter subunit D 2.76e-05 7.12e-03 NA NA
5. P P25568 Autophagy-related protein 22 1.09e-06 8.29e-04 NA NA
5. P Q63344 Monocarboxylate transporter 2 8.30e-10 1.75e-04 NA NA
5. P Q32RP6 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 1.85e-05 1.14e-03 NA NA
5. P B5QV34 Multidrug resistance protein MdtK 3.34e-06 4.27e-04 NA NA
5. P Q5YRP8 Probable cytochrome c oxidase subunit 1-alpha 9.80e-04 5.44e-03 NA NA
5. P Q608Y9 NADH-quinone oxidoreductase subunit N 5.36e-05 6.16e-04 NA NA
5. P Q67IG8 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 5.30e-05 4.27e-04 NA NA
5. P Q92GI5 ADP,ATP carrier protein 5 5.46e-09 1.34e-07 NA NA
5. P B8JAZ0 NADH-quinone oxidoreductase subunit N 2.12e-05 3.57e-02 NA NA
5. P Q98D15 Probable multidrug resistance protein NorM 1.50e-05 3.27e-02 NA NA
5. P Q36097 Cytochrome c oxidase subunit 1 5.16e-05 6.02e-04 NA NA
5. P Q8CF94 Blood group Rh(D) polypeptide 7.71e-05 2.03e-02 NA NA
5. P Q31D31 NAD(P)H-quinone oxidoreductase chain 4 4.26e-05 3.05e-03 NA NA
5. P B2J565 NAD(P)H-quinone oxidoreductase subunit 2 4.04e-05 2.34e-03 NA NA
5. P Q89W72 Probable multidrug resistance protein NorM 7.25e-06 3.54e-03 NA NA
5. P P0CD17 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.66e-05 1.10e-03 NA NA
5. P P0CD35 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.10e-05 9.53e-05 NA NA
5. P P0CC85 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.62e-05 2.92e-04 NA NA
5. P B2K5S2 Protein TsgA homolog 2.52e-09 2.16e-09 NA NA
5. P P50973 NADH-quinone oxidoreductase subunit N 3.51e-05 1.51e-03 NA NA
5. P C4ZZY8 Lysophospholipid transporter LplT 5.45e-09 5.14e-05 NA NA
5. P Q2FVN1 Probable nitrate transporter NarT 8.77e-12 8.89e-05 NA NA
5. P B5XWL3 Multidrug resistance protein MdtK 4.15e-06 2.35e-04 NA NA
5. P D0JUX5 Multidrug transporter MdfA 5.74e-08 7.97e-03 NA NA
5. P B7UFT4 NADH-quinone oxidoreductase subunit N 2.53e-04 3.92e-05 NA NA
5. P A2BNU4 NAD(P)H-quinone oxidoreductase chain 4 4.23e-05 5.38e-03 NA NA
5. P Q6NB79 Probable multidrug resistance protein NorM 4.52e-06 2.50e-02 NA NA
5. P Q8FH68 Multidrug resistance protein MdtK 3.73e-06 6.36e-04 NA NA
5. P P0CC24 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.29e-05 1.35e-03 NA NA
5. P A8ADW3 NADH-quinone oxidoreductase subunit N 5.95e-05 4.11e-05 NA NA
5. P P77389 Inner membrane transport protein YdhP 1.42e-11 9.77e-04 NA NA
5. P P31679 Putative metabolite transport protein YaaU 1.85e-11 2.06e-03 NA NA
5. P Q7N3V2 Multidrug resistance protein MdtK 7.89e-06 5.22e-06 NA NA
5. P D3Z5L6 MFS-type transporter SLC18B1 9.51e-11 1.47e-02 NA NA
5. P A5FQX9 NADH-quinone oxidoreductase subunit N 1.10e-05 4.04e-04 NA NA
5. P P9WJX9 Multidrug efflux pump Tap 2.43e-09 2.40e-07 NA NA
5. P C4ZV37 Enterobactin exporter EntS 3.65e-12 8.79e-09 NA NA
5. P Q6CUZ1 Autophagy-related protein 22 1.89e-08 1.62e-05 NA NA
5. P O84502 ADP,ATP carrier protein 2 1.69e-09 1.83e-11 NA NA
5. P Q8C3B8 Protein RFT1 homolog 2.13e-05 5.64e-04 NA NA
5. P Q68WZ7 ADP,ATP carrier protein 2 1.11e-07 1.40e-07 NA NA
5. P Q6FX92 Autophagy-related protein 22 7.28e-09 1.71e-02 NA NA
5. P Q2K9R9 NADH-quinone oxidoreductase subunit N 4.75e-05 2.07e-02 NA NA
5. P Q5PGW7 Multidrug resistance protein MdtH 3.43e-10 8.32e-06 NA NA
5. P Q31HC4 Probable inorganic carbon transporter subunit DabB 1.13e-04 1.92e-06 NA NA
5. P Q8GXM8 Protein DETOXIFICATION 2 7.30e-06 3.11e-02 NA NA
5. P P0ADL1 Purine ribonucleoside efflux pump NepI 3.03e-10 2.85e-04 NA NA
5. P O00400 Acetyl-coenzyme A transporter 1 1.07e-06 1.85e-02 NA NA
5. P Q94JG1 High-affinity nitrate transporter 2.3 5.49e-08 1.07e-03 NA NA
5. P P0CC86 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.95e-05 8.38e-04 NA NA
5. P Q9ZD13 NADH-quinone oxidoreductase subunit N 2.81e-05 1.34e-05 NA NA
5. P D0KWS8 Probable inorganic carbon transporter subunit DabB2 1.16e-04 1.69e-04 NA NA
5. P Q5FV41 Probable folate-biopterin transporter 2 8.55e-09 3.46e-03 NA NA
5. P Q1CCQ2 Protein TsgA homolog 8.69e-09 2.16e-09 NA NA
5. P B5XNW6 NADH-quinone oxidoreductase subunit N 5.95e-05 2.62e-05 NA NA
5. P B7N767 Lysophospholipid transporter LplT 6.67e-09 4.31e-05 NA NA
5. P A7FGR6 NADH-quinone oxidoreductase subunit N 3.48e-05 7.38e-05 NA NA
5. P A5FKK7 NADH-quinone oxidoreductase subunit N 3.45e-05 1.27e-04 NA NA
5. P B2K5I9 Multidrug resistance protein MdtK 4.72e-06 7.35e-04 NA NA
5. P Q3BCQ5 Ammonium transporter Rh type A 8.07e-05 4.34e-02 NA NA
5. P P0CC64 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.43e-05 2.76e-04 NA NA
5. P Q59Q30 Glycerophosphoinositol permease 1 2.87e-08 4.46e-03 NA NA
5. P Q67YF8 Sucrose transport protein SUC7 7.32e-10 5.79e-03 NA NA
5. P A6SSM3 Autophagy-related protein 22 3.13e-07 5.45e-04 NA NA
5. P A0A1C7E424 Na(+), Li(+), K(+)/H(+) antiporter 1.66e-12 3.12e-03 NA NA
5. P Q5A1L6 Major glycerophosphoinositol permease GIT3 6.74e-09 2.96e-02 NA NA
5. P B1ZUK1 NADH-quinone oxidoreductase subunit N 2 3.06e-05 3.65e-03 NA NA
5. P Q14CX5 Transmembrane protein 180 5.45e-09 5.45e-05 NA NA
5. P Q67ID9 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 2.73e-05 8.11e-04 NA NA
5. P B6IBA3 Multidrug resistance protein MdtK 3.74e-06 7.51e-04 NA NA
5. P Q8Z530 NADH-quinone oxidoreductase subunit N 6.08e-05 2.16e-05 NA NA
5. P Q3J841 NADH-quinone oxidoreductase subunit N 2 4.73e-05 5.16e-04 NA NA
5. P Q2NA79 NADH-quinone oxidoreductase subunit N 3.14e-05 4.77e-04 NA NA
5. P B0JPG4 NAD(P)H-quinone oxidoreductase chain 4 1 4.47e-05 1.29e-02 NA NA
5. P Q11VC5 NADH-quinone oxidoreductase subunit N 4.49e-05 4.27e-04 NA NA
5. P Q7MA37 NADH-quinone oxidoreductase subunit N 1.58e-05 3.36e-03 NA NA
5. P Q7NGP8 NAD(P)H-quinone oxidoreductase subunit 2 4.95e-05 2.73e-04 NA NA
5. P P05715 Uncharacterized 38 kDa protein in 23S RNA operon 1.18e-07 1.16e-06 NA NA
5. P Q9B8D2 NADH-ubiquinone oxidoreductase chain 2 1.18e-04 6.55e-03 NA NA
5. P B7M0M0 Multidrug resistance protein MdtK 3.59e-06 4.51e-04 NA NA
5. P P0CC20 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.33e-05 1.03e-03 NA NA
5. P P45562 Xanthosine permease 6.53e-12 3.07e-08 NA NA
5. P P77726 Inner membrane transport protein YajR 8.43e-09 8.11e-04 NA NA
5. P P0A0J6 Quinolone resistance protein NorA 1.42e-09 1.35e-05 NA NA
5. P Q81G28 Probable multidrug resistance protein NorM 2.79e-06 3.86e-02 NA NA
5. P P9WP71 Probable cytochrome c oxidase subunit 1 1.00e-04 3.90e-02 NA NA
5. P Q1RHK8 Putative transporter AmpG 2 4.53e-09 1.64e-08 NA NA
5. P A1ADC4 NADH-quinone oxidoreductase subunit N 5.81e-05 4.16e-05 NA NA
5. P Q83W27 ADP,ATP carrier protein 4 4.09e-07 1.04e-07 NA NA
5. P A8AJB3 Dipeptide permease D 5.06e-09 3.71e-08 NA NA
5. P Q9C8X2 Sucrose transport protein SUC5 4.63e-07 4.65e-02 NA NA
5. P Q2FYJ5 Quinolone resistance protein NorB 2.31e-06 4.60e-03 NA NA
5. P Q8NXC4 Proton-coupled antiporter flippase LtaA 1.64e-09 1.12e-12 NA NA
5. P Q32LQ6 Major facilitator superfamily domain-containing protein 1 9.70e-12 6.69e-03 NA NA
5. P Q8P4E6 Probable multidrug resistance protein NorM 3.77e-05 9.87e-04 NA NA
5. P Q95M74 Ammonium transporter Rh type B 1.05e-04 8.48e-03 NA NA
5. P B1IQ91 Multidrug resistance protein MdtK 4.45e-06 8.66e-04 NA NA
5. P Q3ASV8 NADH-quinone oxidoreductase subunit N 7.80e-05 1.46e-04 NA NA
5. P Q9H3U5 Major facilitator superfamily domain-containing protein 1 2.18e-09 3.90e-02 NA NA
5. P P39381 Uncharacterized protein YjiJ 2.86e-09 1.46e-04 NA NA
5. P Q8F7R0 NADH-quinone oxidoreductase subunit N 1.88e-05 9.40e-03 NA NA
5. P C5BDY7 Multidrug resistance protein MdtK 3.69e-06 1.74e-05 NA NA
5. P Q5AW93 Autophagy-related protein 22-1 3.03e-07 4.26e-02 NA NA
5. P B2K809 NADH-quinone oxidoreductase subunit N 6.49e-05 7.38e-05 NA NA
5. P Q8KWT2 Putative bacilysin exporter BacE 1.06e-10 1.10e-08 NA NA
5. P Q3AC87 NADH-quinone oxidoreductase subunit N 1.88e-05 3.58e-03 NA NA
5. P Q0Q2J7 Putative antiporter subunit mnhD2 1.40e-05 1.29e-05 NA NA
5. P B7IE18 Lipid II flippase MurJ 8.51e-06 2.32e-03 NA NA
5. P B7MZD4 Lysophospholipid transporter LplT 3.94e-09 5.02e-05 NA NA
5. P A0KJ55 NADH-quinone oxidoreductase subunit N 8.72e-05 3.23e-04 NA NA
5. P Q8ZEW3 Multidrug resistance protein MdtH 1.56e-10 3.61e-05 NA NA
5. P Q2RU27 NADH-quinone oxidoreductase subunit N 2.19e-05 2.24e-03 NA NA
5. P P0CC66 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.54e-05 2.20e-04 NA NA
5. P B5RDY5 Lysophospholipid transporter LplT 4.58e-10 7.92e-06 NA NA
5. P P0AEJ1 Multidrug export protein EmrB 7.52e-08 2.07e-02 NA NA
5. P Q8WNQ5 Ammonium transporter Rh type B 6.64e-05 6.69e-03 NA NA
5. P D0ZGL2 Dipeptide and tripeptide permease B 8.40e-08 2.96e-07 NA NA
5. P B1LLM9 NADH-quinone oxidoreductase subunit N 5.89e-05 3.92e-05 NA NA
5. P Q57M40 NADH-quinone oxidoreductase subunit N 5.64e-05 3.02e-05 NA NA
5. P O15375 Monocarboxylate transporter 6 9.61e-10 1.01e-03 NA NA
5. P Q6FWD4 Probable transporter MCH1 1.11e-09 2.33e-04 NA NA
5. P Q7WJR0 Probable multidrug resistance protein NorM 1.23e-05 1.14e-02 NA NA
5. P P0CD01 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.20e-05 2.55e-04 NA NA
5. P B5RCE1 NADH-quinone oxidoreductase subunit N 6.03e-05 1.37e-05 NA NA
5. P P0CC89 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 6.21e-05 7.26e-04 NA NA
5. P Q58467 Uncharacterized membrane protein MJ1068 1.72e-05 3.32e-03 NA NA
5. P A7FIE5 Multidrug resistance protein MdtH 9.82e-11 3.61e-05 NA NA
5. P Q4UMJ9 Uncharacterized transporter RF_0358 2.65e-08 2.60e-02 NA NA
5. P Q321C2 Multidrug resistance protein MdtK 3.57e-06 8.20e-04 NA NA
5. P F4I4Q3 Protein DETOXIFICATION 32 2.85e-06 1.48e-02 NA NA
5. P Q5SCY2 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 3.05e-05 1.73e-03 NA NA
5. P A9MJA9 NADH-quinone oxidoreductase subunit N 6.00e-05 2.14e-05 NA NA
5. P B5BBC3 Multidrug resistance protein MdtH 3.36e-10 8.32e-06 NA NA
5. P C4K3W3 NADH-quinone oxidoreductase subunit N 4.01e-05 1.71e-04 NA NA
5. P Q8WNQ6 Ammonium transporter Rh type B 6.37e-05 3.22e-03 NA NA
5. P P9WM63 Uncharacterized protein Rv0102 6.43e-05 1.78e-02 NA NA
5. P Q5EXK5 3-hydroxybenzoate transporter MhbT 1.72e-09 4.95e-03 NA NA
5. P P0CD56 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.17e-05 6.16e-04 NA NA
5. P P32136 Putative sulfoquinovose importer 2.07e-09 2.19e-09 NA NA
5. P Q5PC58 Purine ribonucleoside efflux pump NepI 2.16e-08 9.86e-05 NA NA
5. P Q1CIK5 Multidrug resistance protein MdtK 3.04e-06 7.35e-04 NA NA
5. P P51563 Tetracycline resistance protein, class G 1.79e-11 2.47e-05 NA NA
5. P Q2T9S6 Ammonium transporter Rh type C 1.59e-04 4.09e-02 NA NA
5. P A8GH04 NADH-quinone oxidoreductase subunit N 3.86e-05 1.05e-04 NA NA
5. P P0CD09 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.33e-05 9.98e-04 NA NA
5. P Q69T94 Probable inorganic phosphate transporter 1-10 5.76e-09 1.69e-02 NA NA
5. P Q05347 Putative O-antigen export protein 6.33e-06 7.04e-03 NA NA
5. P Q1QSU4 NADH-quinone oxidoreductase subunit N 5.43e-05 1.02e-02 NA NA
5. P Q5MZD9 Probable multidrug resistance protein NorM 8.97e-06 2.92e-04 NA NA
5. P Q8EES3 Probable multidrug resistance protein NorM 3.23e-06 5.57e-04 NA NA
5. P P43562 Probable metabolite transport protein YFL040W 8.67e-09 8.20e-04 NA NA
5. P Q2NTK5 Multidrug resistance protein MdtH 2.66e-09 5.66e-07 NA NA
5. P P76198 Inner membrane transport protein YdiN 3.05e-09 7.90e-11 NA NA
5. P P0CD33 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.42e-05 3.30e-04 NA NA
5. P P0CC69 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.37e-05 2.98e-04 NA NA
5. P Q92HV4 ADP,ATP carrier protein 4 6.19e-07 1.09e-06 NA NA
5. P D4GYG8 Probable flippase AglR 5.62e-05 5.96e-04 NA NA
5. P P77377 Lipopolysaccharide biosynthesis protein WzxC 5.64e-06 3.93e-03 NA NA
5. P P9WP70 Probable cytochrome c oxidase subunit 1 1.27e-03 3.90e-02 NA NA
5. P Q68WJ7 NADH-quinone oxidoreductase subunit N 2.13e-05 7.64e-05 NA NA
5. P Q3YZT4 NADH-quinone oxidoreductase subunit N 5.78e-05 2.21e-05 NA NA
5. P B7M5V5 NADH-quinone oxidoreductase subunit N 5.79e-05 3.92e-05 NA NA
5. P Q83LI8 Multidrug resistance protein MdtH 5.91e-10 4.44e-06 NA NA
5. P B7NTX0 Multidrug resistance protein MdtK 4.51e-06 4.51e-04 NA NA
5. P Q2G212 Putative antiporter subunit mnhD2 1.35e-05 2.50e-05 NA NA
5. P P0CD32 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.11e-05 3.30e-04 NA NA
5. P P31126 Uncharacterized MFS-type transporter YdeE 3.23e-10 4.37e-08 NA NA
5. P A8GDZ4 Dipeptide and tripeptide permease A 6.03e-09 2.30e-08 NA NA
5. P B1XLL7 Nitrate/nitrite transporter NrtP 1.24e-05 4.54e-07 NA NA
5. P A6QFF9 Na(+)/H(+) antiporter subunit D1 3.56e-05 2.88e-04 NA NA
5. P P26846 NADH-ubiquinone oxidoreductase chain 2 4.67e-05 2.50e-02 NA NA
5. P Q9CNC5 Uncharacterized membrane protein PM0507 8.52e-06 1.97e-02 NA NA
5. P P0CD18 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.56e-05 7.73e-03 NA NA
5. P Q323U7 Multidrug transporter MdfA 3.16e-08 2.82e-02 NA NA
5. P Q9D232 Protein spinster homolog 3 8.78e-10 4.47e-02 NA NA
5. P Q59647 Nitric oxide reductase subunit B 8.33e-06 7.63e-06 NA NA
5. P C5BC70 Multidrug transporter MdfA 1.45e-08 1.06e-02 NA NA
5. P Q8NCK7 Monocarboxylate transporter 11 2.78e-09 1.78e-02 NA NA
5. P B4E9G3 Lipid II flippase MurJ 2.78e-05 2.22e-04 NA NA
5. P Q1RIF2 NADH-quinone oxidoreductase subunit N 2.49e-05 1.19e-04 NA NA
5. P Q4L4W4 Na+/H+-antiporter, MnhD subunit 3.46e-05 6.65e-04 NA NA
5. P B6YQ48 NADH-quinone oxidoreductase subunit N 5.74e-05 4.12e-06 NA NA
5. P P0CC60 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.09e-05 4.22e-04 NA NA
5. P Q0T4A9 Multidrug resistance protein MdtK 3.61e-06 6.36e-04 NA NA
5. P Q5AVT9 Autophagy-related protein 22-2 1.27e-06 1.25e-02 NA NA
5. P Q5NC32 Monocarboxylate transporter 11 1.13e-09 4.51e-04 NA NA
5. P P0CC28 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 1.68e-05 2.22e-04 NA NA
5. P Q03064 Monocarboxylate transporter 1 4.08e-09 1.66e-02 NA NA
5. P Q47HG3 NADH-quinone oxidoreductase subunit N 1.75e-05 1.73e-03 NA NA
5. P Q94AA1 UNC93-like protein 3 2.21e-07 6.95e-07 NA NA
5. P Q62LW6 Probable multidrug resistance protein NorM 3.89e-06 3.33e-02 NA NA
5. P Q0TFH0 NADH-quinone oxidoreductase subunit N 6.05e-05 4.01e-05 NA NA
5. P A7HY36 NADH-quinone oxidoreductase subunit N 3.33e-05 9.21e-03 NA NA
5. P Q9DC26 Solute carrier family 46 member 3 2.39e-08 3.37e-07 NA NA
5. P P96675 Uncharacterized MFS-type transporter YdeR 2.38e-08 1.18e-03 NA NA
5. P P39352 Putative metabolite transport protein YjhB 1.46e-09 2.44e-03 NA NA
5. P Q944W2 Sucrose transport protein SUT3 1.33e-08 1.49e-03 NA NA
5. P P0CC37 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.98e-05 4.46e-04 NA NA
5. P P24077 Enterobactin exporter EntS 7.88e-15 8.79e-09 NA NA
5. P C4XGW8 NADH-quinone oxidoreductase subunit N 2 7.79e-05 3.15e-03 NA NA
5. P O34724 Uncharacterized MFS-type transporter YceJ 1.51e-12 2.14e-05 NA NA
5. P Q5N5T8 NAD(P)H-quinone oxidoreductase subunit 2 4.36e-05 3.02e-03 NA NA
5. P B5YKJ2 NADH-quinone oxidoreductase subunit N 1 5.64e-05 1.11e-02 NA NA
5. P A8Z147 Putative antiporter subunit mnhD2 1.31e-05 2.50e-05 NA NA
5. P P0CC91 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.36e-05 3.53e-04 NA NA
5. P B8J1C7 NADH-quinone oxidoreductase subunit N 2.23e-05 2.93e-02 NA NA
5. P P0AFZ8 Trk system potassium uptake protein TrkH 6.32e-04 4.37e-04 NA NA
5. P Q8CQ47 Putative antiporter subunit mnhD2 1.74e-05 1.68e-05 NA NA
5. P Q57KA8 Lysophospholipid transporter LplT 2.43e-11 8.39e-05 NA NA
5. P Q5PEN8 Lysophospholipid transporter LplT 4.77e-10 8.39e-05 NA NA
5. P Q92GA9 Putative transporter AmpG 3 2.76e-09 6.93e-09 NA NA
5. P A4W9T2 Multidrug resistance protein MdtK 7.77e-06 9.77e-04 NA NA
5. P P29926 NADH-quinone oxidoreductase subunit 14 5.72e-05 1.92e-05 NA NA
5. P B2IZT6 Nitrate/nitrite transporter NrtP 1.47e-05 2.30e-05 NA NA
5. P Q751W1 Autophagy-related protein 22 1.17e-08 5.90e-06 NA NA
5. P B1JJ53 Multidrug resistance protein MdtK 3.08e-06 7.35e-04 NA NA
5. P P75041 Major facilitator superfamily transporter MPN_076 3.83e-06 2.66e-10 NA NA
5. P A8ERK3 NADH-quinone oxidoreductase subunit N 6.80e-05 1.77e-04 NA NA
5. P P0CC43 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.90e-05 4.46e-04 NA NA
5. P A0LJL8 NADH-quinone oxidoreductase subunit N 2 4.28e-05 5.85e-03 NA NA
5. P Q9K015 Probable multidrug resistance protein NorM 3.94e-06 1.43e-03 NA NA
5. P B5XZP2 Multidrug resistance protein MdtL 2.19e-09 1.03e-02 NA NA
5. P Q96BI1 Solute carrier family 22 member 18 5.65e-10 6.44e-04 NA NA
5. P B4T562 Multidrug resistance protein MdtK 1.17e-06 4.83e-04 NA NA
5. P P19568 ADP,ATP carrier protein 1 1.90e-08 1.12e-09 NA NA
5. P D0JKF6 Multidrug transporter MdfA 6.33e-08 7.97e-03 NA NA
5. P Q8VNZ2 Probable lipid II flippase MurJ 2.23e-05 5.11e-03 NA NA
5. P P75742 Dipeptide permease D 4.53e-07 1.14e-06 NA NA
5. P B7UHQ3 Lysophospholipid transporter LplT 6.74e-09 5.58e-05 NA NA
5. P P0CD27 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.74e-05 3.90e-04 NA NA
5. P P0CD14 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.56e-05 9.98e-04 NA NA
5. P P10903 Nitrate/nitrite transporter NarK 2.43e-08 1.85e-08 NA NA
5. P B4T2Z8 Multidrug resistance protein MdtH 2.39e-09 8.32e-06 NA NA
5. P P0CC87 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.05e-05 8.38e-04 NA NA
5. P P0CC82 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 4.87e-05 1.15e-03 NA NA
5. P Q1R9E1 NADH-quinone oxidoreductase subunit N 5.97e-05 4.16e-05 NA NA
5. P B7GME1 NADH-quinone oxidoreductase subunit N 1.25e-04 8.84e-03 NA NA
5. P P0CC39 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.54e-05 1.61e-03 NA NA
5. P B7LQA4 Multidrug resistance protein MdtK 4.21e-06 4.77e-04 NA NA
5. P Q7V3C8 NAD(P)H-quinone oxidoreductase chain 4 2.27e-05 2.05e-02 NA NA
5. P A1K5C1 NADH-quinone oxidoreductase subunit N 1.44e-05 1.30e-03 NA NA
5. P P0CD46 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.39e-05 2.03e-04 NA NA
5. P Q8ZPM6 Dipeptide and tripeptide permease A 3.69e-07 1.97e-07 NA NA
5. P Q32ES6 Multidrug resistance protein MdtH 1.73e-10 4.02e-06 NA NA
5. P P06257 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 4.70e-05 1.71e-04 NA NA
5. P Q8Z6Q5 Dipeptide and tripeptide permease A 6.38e-07 3.00e-07 NA NA
5. P Q1ACP1 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 1.93e-05 1.85e-04 NA NA
5. P P98008 Nitric oxide reductase subunit B 1.07e-05 1.68e-05 NA NA
5. P P56911 NADH-quinone oxidoreductase subunit N 2 2.11e-05 4.83e-04 NA NA
5. P P0CD28 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.46e-05 1.21e-04 NA NA
5. P Q1RK92 ADP,ATP carrier protein 5 2.41e-09 1.31e-07 NA NA
5. P Q9SIA1 Protein DETOXIFICATION 5 1.02e-05 3.78e-02 NA NA
5. P B8IUV9 NADH-quinone oxidoreductase subunit N 3.14e-05 1.18e-02 NA NA
5. P Q6FPB6 Protein BTN1 6.11e-07 5.38e-03 NA NA
5. P A9N7X0 Uncharacterized MFS-type transporter YcaD 3.85e-14 3.97e-06 NA NA
5. P O07940 Uncharacterized transporter YisQ 2.77e-05 1.08e-02 NA NA
5. P Q6P2X9 Monocarboxylate transporter 12 1.58e-09 2.07e-02 NA NA
5. P A6TBW2 NADH-quinone oxidoreductase subunit N 3.68e-05 2.78e-05 NA NA
5. P Q96ES6 Major facilitator superfamily domain-containing protein 3 1.30e-11 6.22e-03 NA NA
5. P B5QU11 Purine ribonucleoside efflux pump NepI 1.75e-08 5.64e-05 NA NA
5. P P0C2U3 Di-/tripeptide transporter 7.33e-07 1.08e-03 NA NA
5. P P67444 Xanthine permease XanQ 1.92e-03 3.50e-02 NA NA
5. P P0CD43 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.93e-05 2.13e-03 NA NA
5. P B6I9E2 Multidrug resistance protein MdtH 1.97e-11 3.69e-06 NA NA
5. P C6XAK0 NADH-quinone oxidoreductase subunit N 7.15e-05 1.99e-05 NA NA
5. P E1V6K4 Trk system potassium uptake protein TrkI 6.60e-04 1.35e-04 NA NA
5. P Q3U481 Major facilitator superfamily domain-containing protein 12 2.46e-09 4.33e-06 NA NA
5. P A2ZN77 Sucrose transport protein SUT2 1.35e-09 9.20e-05 NA NA
5. P Q97QN5 Probable multidrug resistance protein NorM 5.24e-06 1.65e-04 NA NA
5. P D4A734 Monocarboxylate transporter 12 1.60e-09 3.14e-02 NA NA
5. P B7NBB6 Multidrug resistance protein MdtK 3.69e-06 4.67e-04 NA NA
5. P O67658 Probable lipid II flippase MurJ 2.09e-05 3.05e-03 NA NA
5. P A2RMA8 Di-/tripeptide transporter 1.04e-06 1.08e-03 NA NA
5. P Q58705 Uncharacterized protein MJ1309 1.38e-04 1.09e-03 NA NA
5. P Q03411 Sucrose transport protein 3.42e-09 5.21e-03 NA NA
5. P Q4UL68 NADH-quinone oxidoreductase subunit N 2.69e-04 1.03e-04 NA NA
5. P A6T6E2 Dipeptide permease D 9.51e-09 4.72e-07 NA NA
5. P P0CC98 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 1.11e-04 1.65e-04 NA NA
5. P P41438 Reduced folate transporter 5.68e-09 2.75e-05 NA NA
5. P Q7CH99 Uncharacterized MFS-type transporter YPO1221/y2967/YP_0917 8.46e-12 8.57e-03 NA NA
5. P Q2YSV4 Putative antiporter subunit mnhD2 1.43e-05 2.50e-05 NA NA
5. P Q8DHX4 NAD(P)H-quinone oxidoreductase chain 4 2 3.28e-05 1.85e-03 NA NA
5. P P0CD19 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.49e-05 7.73e-03 NA NA
5. P B8G6L3 NADH-quinone oxidoreductase subunit N 1.33e-04 4.09e-02 NA NA
5. P P23849 Trk system potassium uptake protein TrkG 2.50e-03 2.88e-04 NA NA
5. P B5FPF7 NADH-quinone oxidoreductase subunit N 6.05e-05 2.91e-05 NA NA
5. P B5BIG3 Purine ribonucleoside efflux pump NepI 7.34e-12 9.86e-05 NA NA
5. P P0CC29 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 1.95e-05 1.81e-04 NA NA
5. P P0CD45 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.44e-05 2.55e-04 NA NA
5. P Q63S57 Probable multidrug resistance protein NorM 5.17e-06 4.65e-02 NA NA
5. P C5B828 Multidrug resistance protein MdtH 1.66e-09 3.73e-06 NA NA
5. P B5Z4F3 Lysophospholipid transporter LplT 6.44e-09 1.16e-05 NA NA
5. P Q4ULW4 Putative transporter AmpG 4 7.96e-09 1.56e-05 NA NA
5. P Q9KRU4 Multidrug resistance protein NorM 3.39e-06 2.63e-04 NA NA
5. P P0CD48 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.95e-05 2.66e-04 NA NA
5. P P76242 2-nitroimidazole transporter 1.59e-09 7.32e-07 NA NA
5. P Q32FA7 Multidrug resistance protein MdtK 4.53e-06 2.27e-04 NA NA
5. P Q7NRM5 Dipeptide and tripeptide permease A 2.42e-07 1.31e-08 NA NA
5. P Q9PA34 Probable multidrug resistance protein NorM 9.95e-06 8.99e-05 NA NA
5. P Q9WZS2 Probable multidrug resistance protein NorM 9.54e-06 6.22e-03 NA NA
5. P Q6MGN8 NADH-quinone oxidoreductase subunit N 7.15e-05 6.22e-03 NA NA
5. P B3QY38 NADH-quinone oxidoreductase subunit N 2 1.23e-04 5.11e-03 NA NA
5. P A0A3Q2HW92 Major facilitator superfamily domain-containing protein 12 2.06e-09 3.09e-04 NA NA
5. P Q710D3 Protein unc-93 homolog A 2.81e-10 3.46e-02 NA NA
5. P P31462 Multidrug resistance protein MdtL 1.99e-08 5.38e-03 NA NA
5. P B4EZ47 NADH-quinone oxidoreductase subunit N 4.08e-05 1.53e-04 NA NA
5. P A4TM24 NADH-quinone oxidoreductase subunit N 4.23e-05 7.38e-05 NA NA
5. P A8AI11 Multidrug resistance protein MdtH 2.55e-10 4.11e-05 NA NA
5. P Q8GSG4 Low affinity inorganic phosphate transporter 4 2.11e-09 2.29e-02 NA NA
5. P B5XWP3 Dipeptide and tripeptide permease A 3.62e-07 5.87e-08 NA NA
5. P B1IV37 Multidrug resistance protein MdtH 5.85e-10 2.63e-06 NA NA
5. P B3R3Y0 NADH-quinone oxidoreductase subunit N 2.16e-05 1.79e-04 NA NA
5. P Q58880 Uncharacterized cation transporter MJ1485 4.08e-04 4.85e-03 NA NA
5. P Q8CPV1 Na(+)/H(+) antiporter subunit D1 3.03e-05 2.32e-03 NA NA
5. P Q5HI42 Putative antiporter subunit mnhD2 1.22e-05 2.50e-05 NA NA
5. P Q9DC37 Major facilitator superfamily domain-containing protein 1 4.19e-09 3.93e-03 NA NA
5. P B1J9Y3 Probable sugar efflux transporter 1.09e-11 9.28e-06 NA NA
5. P B5YXR6 NADH-quinone oxidoreductase subunit N 5.89e-05 3.92e-05 NA NA
5. P B5YL23 NADH-quinone oxidoreductase subunit N 2 2.84e-05 5.16e-04 NA NA
5. P B4TY33 Protein TsgA 1.27e-09 1.04e-07 NA NA
5. P B9LGS9 NADH-quinone oxidoreductase subunit N 1.21e-04 1.01e-02 NA NA
5. P Q02SS7 Probable sugar efflux transporter 3.30e-10 9.40e-06 NA NA
5. P Q9I426 Cytochrome bo(3) ubiquinol oxidase subunit 1 4.58e-04 2.48e-02 NA NA
5. P P0AF17 Probable lipid II flippase MurJ 2.99e-05 9.87e-04 NA NA
5. P Q72E86 Menaquinone reductase, integral membrane subunit 2.53e-04 3.23e-02 NA NA
5. P P98000 Alternative cytochrome c oxidase subunit 1 1.18e-04 4.78e-02 NA NA
5. P P0CC30 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.59e-05 1.03e-03 NA NA
5. P P33026 Sugar efflux transporter B 2.66e-15 6.37e-08 NA NA
5. P B7K1G4 NAD(P)H-quinone oxidoreductase subunit 2 2.96e-05 1.15e-03 NA NA
5. P Q2S2K9 NADH-quinone oxidoreductase subunit N 2.62e-05 1.64e-03 NA NA
5. P O33683 Uncharacterized protein RA0937 4.68e-04 1.89e-02 NA NA
5. P B2TTF0 Enterobactin exporter EntS 3.62e-12 3.56e-08 NA NA
5. P P0CD58 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.67e-05 5.27e-03 NA NA
5. P C4ZUB9 NADH-quinone oxidoreductase subunit N 4.31e-05 3.92e-05 NA NA
5. P D6R8X8 Hydantoin permease 1.51e-03 2.46e-07 NA NA
5. P Q1AVJ2 NADH-quinone oxidoreductase subunit N 7.20e-05 4.93e-04 NA NA
5. P O66504 Uncharacterized protein aq_097 3.80e-06 3.46e-02 NA NA
5. P P0CC65 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.58e-05 2.76e-04 NA NA
5. P P0CD07 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.15e-05 2.08e-03 NA NA
5. P P0AFF5 Nucleoside permease NupG 6.48e-12 4.37e-09 NA NA
5. P Q6D5W6 Multidrug resistance protein MdtK 7.35e-06 4.11e-05 NA NA
5. P P0CD44 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.20e-05 2.55e-04 NA NA
5. P F9X9V3 Siderophore transporter MYCGRDRAFT_70577 2.67e-06 3.50e-03 NA NA
5. P P0CD24 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 4.99e-05 1.77e-04 NA NA
5. P Q8X651 Dipeptide and tripeptide permease A 2.92e-07 2.50e-07 NA NA
5. P O34663 Uncharacterized MFS-type transporter YbcL 1.73e-09 7.93e-04 NA NA
5. P Q7VFT5 NADH-quinone oxidoreductase subunit N 3.22e-05 8.20e-04 NA NA
5. P Q28427 RH-like protein ID 8.76e-05 1.61e-02 NA NA
5. P Q879Z5 Probable multidrug resistance protein NorM 2.58e-05 3.41e-04 NA NA
5. P O15427 Monocarboxylate transporter 4 5.81e-09 4.90e-03 NA NA
5. P O94302 Oligosaccharide translocation protein rft1 3.78e-05 2.24e-02 NA NA
5. P Q6LQ49 Multidrug resistance protein NorM 5.94e-06 1.88e-04 NA NA
5. P Q6DG19 Molybdate-anion transporter 5.89e-10 1.83e-06 NA NA
5. P Q30PJ2 NADH-quinone oxidoreductase subunit N 2.20e-05 3.89e-03 NA NA
5. P B4TPJ8 NADH-quinone oxidoreductase subunit N 6.05e-05 2.16e-05 NA NA
5. P Q6GI68 Proton-coupled antiporter flippase LtaA 2.26e-09 1.12e-12 NA NA
5. P A6U056 Na(+)/H(+) antiporter subunit D1 3.62e-05 2.88e-04 NA NA
5. P P0C184 Ascorbate-specific PTS system EIIC component 8.00e-04 2.06e-03 NA NA
5. P Q6AY78 Solute carrier family 22 member 18 2.61e-11 2.78e-05 NA NA
5. P A9QYZ2 Multidrug resistance protein MdtH 1.24e-10 3.61e-05 NA NA
5. P Q8YMQ0 NAD(P)H-quinone oxidoreductase subunit 2 3.08e-05 1.27e-03 NA NA
5. P P0AFF1 NADH-quinone oxidoreductase subunit N 2.55e-04 3.92e-05 NA NA
5. P P21503 Uncharacterized MFS-type transporter YcaD 2.45e-14 2.50e-05 NA NA
5. P Q828X4 Putative cytochrome c oxidase subunit 1-beta 1.20e-04 1.38e-02 NA NA
5. P Q96AA3 Protein RFT1 homolog 2.65e-05 6.35e-03 NA NA
5. P Q9B6C8 NADH-ubiquinone oxidoreductase chain 2 3.85e-04 2.30e-04 NA NA
5. P Q17QR6 Monocarboxylate transporter 13 1.71e-10 7.13e-07 NA NA
5. P P36837 Dipeptide and tripeptide permease B 2.46e-07 7.58e-08 NA NA
5. P Q1C769 Multidrug resistance protein MdtK 4.54e-06 7.35e-04 NA NA
5. P Q6MLJ0 Ferreportin 9.26e-09 2.80e-06 NA NA
5. P Q39ZA5 NADH-quinone oxidoreductase subunit N 7.29e-05 2.13e-02 NA NA
5. P Q0CS59 MFS acetylaranotin efflux transporter ataA 1.67e-07 5.49e-03 NA NA
5. P B4TH65 Multidrug resistance protein MdtK 3.46e-06 4.51e-04 NA NA
5. P B7MA17 Multidrug resistance protein MdtK 3.72e-06 6.36e-04 NA NA
5. P P0CC52 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.13e-05 2.88e-04 NA NA
5. P P0AGC1 Hexose-6-phosphate:phosphate antiporter 6.85e-09 1.81e-06 NA NA
5. P D3V3D1 Dipeptide and tripeptide permease B 1.22e-07 7.55e-05 NA NA
5. P Q057W3 NADH-quinone oxidoreductase subunit N 6.75e-05 4.67e-06 NA NA
5. P P42306 Uncharacterized MFS-type transporter YxiO 1.05e-09 2.12e-08 NA NA
5. P Q8ZNE4 NADH-quinone oxidoreductase subunit N 6.04e-05 3.24e-05 NA NA
5. P Q9Z8J2 ADP,ATP carrier protein 1 3.30e-08 7.69e-10 NA NA
5. P P0CC61 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.30e-05 4.22e-04 NA NA
5. P Q62866 Reduced folate transporter 5.56e-09 1.88e-06 NA NA
5. P P60687 Na(+)/H(+) antiporter subunit D1 3.48e-05 2.88e-04 NA NA
5. P B1IXR6 NADH-quinone oxidoreductase subunit N 6.06e-05 5.78e-05 NA NA
5. P P9WJW7 Uncharacterized MFS-type transporter Rv2994 2.03e-08 5.20e-05 NA NA
5. P Q5PJ48 Ascorbate-specific PTS system EIIC component 9.96e-04 2.83e-03 NA NA
5. P P95827 Macrolide efflux protein A 3.16e-12 5.27e-04 NA NA
5. P B1LEM1 Multidrug resistance protein MdtK 3.22e-06 4.67e-04 NA NA
5. P Q5F629 NADH-quinone oxidoreductase subunit N 7.20e-05 1.21e-04 NA NA
5. P E1V6C5 Trk system potassium uptake protein TrkH 9.17e-04 1.11e-04 NA NA
5. P B1WUS5 NAD(P)H-quinone oxidoreductase subunit 2 3.55e-05 9.69e-03 NA NA
5. P Q1C833 Multidrug resistance protein MdtH 1.30e-10 3.61e-05 NA NA
5. P P98004 Quinol oxidase subunit 1 4.75e-05 2.04e-08 NA NA
5. P P0CC27 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.24e-05 2.22e-04 NA NA
5. P A8G2F5 NAD(P)H-quinone oxidoreductase chain 4 1.76e-05 4.95e-03 NA NA
5. P P0CD34 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.23e-05 9.53e-05 NA NA
5. P Q66660 Gene 58 protein NA 9.89e-03 NA NA
5. P B4T502 Lysophospholipid transporter LplT 4.86e-10 8.99e-05 NA NA
5. P Q5HRA9 Putative antiporter subunit mnhD2 2.00e-05 2.47e-05 NA NA
5. P Q4WYN4 Major facilitator copper-regulated transporter crmC 4.19e-06 4.01e-03 NA NA
5. P Q89AT4 NADH-quinone oxidoreductase subunit N 9.59e-05 5.15e-06 NA NA
5. P P56882 Probable lipid II flippase MurJ 1.97e-05 2.53e-02 NA NA
5. P Q0I6X0 NAD(P)H-quinone oxidoreductase chain 4 9.48e-05 4.78e-02 NA NA
5. P B7MTJ6 Multidrug resistance protein MdtH 5.58e-10 6.84e-06 NA NA
5. P Q7CQY0 Dipeptide permease D 1.23e-08 1.09e-07 NA NA
5. P Q8KX56 NAD(P)H-quinone oxidoreductase subunit 2 4.05e-05 2.44e-03 NA NA
5. P Q3BRP2 NADH-quinone oxidoreductase subunit N 1.07e-04 2.32e-03 NA NA
5. P Q0H8Y9 NADH-ubiquinone oxidoreductase chain 2 2.01e-03 9.99e-03 NA NA
5. P Q6D469 Multidrug resistance protein MdtH 5.44e-11 2.06e-05 NA NA
5. P Q7VMB5 Probable multidrug resistance protein NorM 4.06e-06 1.68e-03 NA NA
5. P P48903 NADH-ubiquinone oxidoreductase chain 2 2.54e-05 4.13e-02 NA NA
5. P P39301 Ascorbate-specific PTS system EIIC component 7.07e-04 1.66e-03 NA NA
5. P Q07282 Tetracycline resistance protein, class E 7.65e-12 2.38e-05 NA NA
5. P Q7CP73 Multidrug resistance protein MdtM 7.09e-09 9.49e-03 NA NA
5. P A3PAL7 NAD(P)H-quinone oxidoreductase chain 4 2.22e-05 1.41e-02 NA NA
5. P B4TRS9 Uncharacterized MFS-type transporter YcaD 2.13e-14 2.16e-05 NA NA
5. P A7E7N1 Autophagy-related protein 22-1 2.08e-07 4.46e-04 NA NA
5. P Q2FZP8 Proton-coupled antiporter flippase LtaA 2.73e-09 4.11e-12 NA NA
5. P Q92HH5 NADH-quinone oxidoreductase subunit N 3.91e-05 5.58e-05 NA NA
5. P Q8ZPP2 Multidrug resistance protein MdtK 4.62e-06 5.96e-04 NA NA
5. P Q7SXB7 Major facilitator superfamily domain-containing protein 4A 7.00e-09 9.64e-05 NA NA
5. P Q04991 Protein FMP42 2.88e-08 4.65e-02 NA NA
5. P P16552 Raffinose permease 5.07e-09 1.75e-08 NA NA
5. P P0A0J4 Quinolone resistance protein NorA 2.66e-10 1.35e-05 NA NA
5. P A9EX55 NADH-quinone oxidoreductase subunit N 1 4.52e-05 7.19e-03 NA NA
5. P P0A0J5 Quinolone resistance protein NorA 2.25e-10 1.35e-05 NA NA
5. P B8D9V8 Protein TsgA homolog 3.28e-11 6.90e-08 NA NA
5. P Q66HE2 Monocarboxylate transporter 13 7.19e-10 2.29e-06 NA NA
5. P B5BFH5 Lysophospholipid transporter LplT 5.41e-10 8.39e-05 NA NA
5. P G5E8K6 Monocarboxylate transporter 6 3.51e-10 1.44e-03 NA NA
5. P P0CC40 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 4.76e-05 2.79e-04 NA NA
5. P Q4ZY49 Probable sugar efflux transporter 1.23e-09 6.35e-06 NA NA
5. P A0KMY1 Dipeptide and tripeptide permease B 5.68e-09 5.64e-08 NA NA
5. P Q9PJP6 ADP,ATP carrier protein 2 6.53e-08 4.17e-12 NA NA
5. P B6VMU9 Dipeptide and tripeptide permease B 1.88e-07 5.90e-06 NA NA
5. P Q8WMW2 Ammonium transporter Rh type B 8.23e-05 3.89e-03 NA NA
5. P P0AEZ0 Multidrug transporter MdfA 2.76e-08 2.24e-02 NA NA
5. P Q4VUI0 Ammonium transporter Rh type B 9.00e-05 9.79e-03 NA NA
5. P P0CD31 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.45e-05 8.29e-04 NA NA
5. P P57264 NADH-quinone oxidoreductase subunit N 4.37e-05 2.16e-07 NA NA
5. P C0PXJ7 Lysophospholipid transporter LplT 5.13e-10 8.39e-05 NA NA
5. P O82855 Multidrug resistance protein NorM 5.63e-06 1.03e-03 NA NA
5. P Q4UK37 Putative transporter AmpG 3 4.44e-09 2.43e-07 NA NA
5. P P57601 Protein TsgA homolog 2.86e-09 6.90e-08 NA NA
5. P P0CD51 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.43e-05 2.13e-03 NA NA
5. P B5QYP8 Uncharacterized MFS-type transporter YcaD 2.50e-14 2.44e-05 NA NA
5. P P0CC21 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.35e-05 1.03e-03 NA NA
5. P P0CC94 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.24e-05 6.09e-04 NA NA
5. P Q06221 Glucose transporter 1B/1C/1D/1F/2B 3.93e-08 1.57e-03 NA NA
5. P B0BYP3 NAD(P)H-quinone oxidoreductase subunit 2 3.44e-05 1.85e-04 NA NA
5. P P40913 Oligosaccharide translocation protein RFT1 1.06e-05 2.63e-06 NA NA
5. P D2BX50 Multidrug resistance protein MdtG 4.69e-10 3.26e-06 NA NA
5. P Q2GKQ9 NADH-quinone oxidoreductase subunit N 1.10e-04 1.12e-04 NA NA
5. P B2U2G8 Multidrug resistance protein MdtK 3.61e-06 4.51e-04 NA NA
5. P B4TUY3 Multidrug resistance protein MdtK 5.63e-06 4.83e-04 NA NA
5. P P77549 Uncharacterized MFS-type transporter YfcJ 2.42e-09 9.05e-04 NA NA
5. P A9N3H7 Lysophospholipid transporter LplT 4.86e-10 8.79e-05 NA NA
5. P Q88K63 Probable sugar efflux transporter 3.54e-09 1.39e-05 NA NA
5. P P44958 Probable lipid II flippase MurJ 3.03e-06 1.54e-04 NA NA
5. P Q95KI5 Solute carrier family 45 member 3 9.34e-09 4.51e-05 NA NA
5. P Q3MAR0 NAD(P)H-quinone oxidoreductase chain 4 2 1.41e-04 8.57e-03 NA NA
5. P A8I421 NADH-quinone oxidoreductase subunit N 3.93e-05 1.68e-02 NA NA
5. P P0AGF5 D-xylose-proton symporter 1.86e-08 4.13e-04 NA NA
5. P P0CC36 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.01e-05 4.46e-04 NA NA
5. P P47685 Uncharacterized protein MG447 5.84e-06 2.76e-02 NA NA
5. P B7M940 Multidrug resistance protein MdtH 1.44e-10 6.84e-06 NA NA
5. P Q31CA0 NAD(P)H-quinone oxidoreductase subunit 2 3.36e-05 4.32e-03 NA NA
5. P B0SFU5 NADH-quinone oxidoreductase subunit N 6.70e-05 3.15e-03 NA NA
5. P Q68XS7 ADP,ATP carrier protein 1 1.74e-08 4.18e-10 NA NA
5. P B5FQ40 Uncharacterized MFS-type transporter YcaD 2.58e-14 2.56e-05 NA NA
5. P P64690 Uncharacterized protein Mb0105 5.32e-05 1.78e-02 NA NA
5. P P0CD10 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.32e-05 9.98e-04 NA NA
5. P Q8Z6N7 Multidrug resistance protein MdtK 4.63e-06 3.86e-04 NA NA
5. P C4LB43 NADH-quinone oxidoreductase subunit N 2.91e-05 4.32e-04 NA NA
5. P B5F941 Multidrug resistance protein MdtH 2.59e-10 8.32e-06 NA NA
5. P B2JDL5 NADH-quinone oxidoreductase subunit N 1.06e-04 5.83e-04 NA NA
5. P Q02CT1 NADH-quinone oxidoreductase subunit N 1 4.31e-05 4.01e-03 NA NA
5. P P0CC78 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.31e-05 2.49e-04 NA NA
5. P O35308 Monocarboxylate transporter 3 3.83e-09 3.17e-02 NA NA
5. P P0CC80 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.05e-05 2.35e-04 NA NA
5. P P0CC74 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.35e-05 2.49e-04 NA NA
5. P P0A4K7 Tetracycline resistance protein 3.29e-09 3.12e-03 NA NA
5. P D2TBH1 Dipeptide and tripeptide permease A 6.55e-06 1.30e-06 NA NA
5. P Q7UCG7 Probable sugar efflux transporter 3.92e-10 2.50e-06 NA NA
5. P A9HRS3 NADH-quinone oxidoreductase subunit N 3.25e-05 9.02e-03 NA NA
5. P Q57RM6 Dipeptide permease D 1.96e-08 1.42e-07 NA NA
5. P Q6FEY7 Probable multidrug resistance protein NorM 5.75e-06 1.36e-02 NA NA
5. P Q32DR3 NADH-quinone oxidoreductase subunit N 6.10e-05 3.87e-05 NA NA
5. P Q5PME0 Enterobactin exporter EntS 2.65e-12 1.19e-07 NA NA
5. P Q7WAK9 Probable multidrug resistance protein NorM 1.18e-05 8.14e-03 NA NA
5. P P0CC56 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.33e-05 5.57e-04 NA NA
5. P Q1RHU3 ADP,ATP carrier protein 2 4.62e-07 4.12e-06 NA NA
5. P Q7VE41 NAD(P)H-quinone oxidoreductase chain 4 4.30e-05 1.36e-02 NA NA
5. P B4SYY7 NADH-quinone oxidoreductase subunit N 6.04e-05 2.16e-05 NA NA
5. P P0CD04 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.70e-05 9.87e-04 NA NA
5. P A8AH48 Multidrug resistance protein MdtK 3.75e-06 7.03e-04 NA NA
5. P Q8ZLK7 Protein TsgA 1.53e-09 1.18e-07 NA NA
5. P P31122 Sugar efflux transporter 3.76e-10 3.06e-06 NA NA
5. P A5IRC7 Na(+)/H(+) antiporter subunit D1 3.62e-05 2.88e-04 NA NA
5. P Q6CGU8 Probable transporter MCH1 2.39e-07 6.23e-04 NA NA
5. P P33449 Multidrug resistance protein 1 2.28e-11 1.27e-03 NA NA
5. P Q92HP9 ADP,ATP carrier protein 3 1.57e-07 9.95e-09 NA NA
5. P Q83QB9 Lysophospholipid transporter LplT 1.16e-09 1.35e-05 NA NA
5. P B1X9H8 Multidrug resistance protein MdtH 5.33e-10 6.84e-06 NA NA
5. P Q9MUQ6 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 3.02e-05 1.06e-04 NA NA
5. P B1XUL1 NADH-quinone oxidoreductase subunit N 5.60e-05 4.41e-05 NA NA
5. P O06473 Multidrug efflux protein YfmO 2.14e-09 2.04e-03 NA NA
5. P P37593 Nitrate/nitrite transporter NarU 2.55e-07 1.37e-08 NA NA
5. P Q8FH91 Dipeptide and tripeptide permease A 5.30e-07 1.77e-07 NA NA
5. P P76197 Inner membrane transport protein YdiM 5.62e-10 6.52e-07 NA NA
5. P A4X1Z0 NADH-quinone oxidoreductase subunit N 3.92e-05 5.85e-03 NA NA
5. P Q8Z407 Lysophospholipid transporter LplT 4.75e-10 6.05e-06 NA NA
5. P B1IQQ5 Sialic acid transporter NanT 4.09e-07 4.41e-05 NA NA
5. P P57787 Monocarboxylate transporter 4 1.72e-08 8.39e-03 NA NA
5. P Q8PG07 Probable multidrug resistance protein NorM 1.31e-05 1.72e-03 NA NA
5. P Q888L8 Probable sugar efflux transporter 6.31e-10 3.74e-05 NA NA
5. P Q67P10 NADH-quinone oxidoreductase subunit N 1 2.74e-05 3.50e-03 NA NA
5. P Q9XIH6 Putative polyol transporter 2 1.81e-05 2.73e-02 NA NA
5. P Q3JC27 NADH-quinone oxidoreductase subunit N 1 6.83e-05 4.27e-04 NA NA
5. P A7ZQU1 Lysophospholipid transporter LplT 5.21e-09 4.79e-05 NA NA
5. P Q7A6D3 Proton-coupled antiporter flippase LtaA 1.45e-09 2.65e-12 NA NA
5. P P0CC44 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.50e-05 2.61e-04 NA NA
5. P A7H9U1 NADH-quinone oxidoreductase subunit N 1.23e-04 3.86e-04 NA NA
5. P Q4UJ69 Cytochrome c oxidase subunit 1 8.86e-05 5.39e-04 NA NA
5. P O32203 Uncharacterized MFS-type transporter YvqJ 2.22e-10 1.66e-08 NA NA
5. P P0CD36 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 7.89e-05 4.19e-03 NA NA
5. P B7NNV5 NADH-quinone oxidoreductase subunit N 5.81e-05 4.11e-05 NA NA
5. P Q1REX1 Enterobactin exporter EntS 3.76e-12 7.28e-08 NA NA
5. P Q5KUK6 NADH-quinone oxidoreductase subunit N 8.01e-05 4.65e-03 NA NA
5. P A6TA11 Multidrug resistance protein MdtK 6.32e-06 8.29e-04 NA NA
5. P Q5SPF7 Protein unc-93 homolog A 6.98e-09 7.82e-06 NA NA
5. P Q2JLH4 NAD(P)H-quinone oxidoreductase subunit 2 3.27e-05 1.54e-03 NA NA
5. P Q4L446 Putative antiporter subunit mnhD2 1.67e-05 3.32e-05 NA NA
5. P P37597 Inner membrane transport protein YdhC 2.40e-09 1.20e-04 NA NA
5. P C0QR92 NADH-quinone oxidoreductase subunit N 2.00e-05 6.20e-05 NA NA
5. P P0CC51 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.85e-05 1.35e-04 NA NA
5. P Q4PSF4 Protein DETOXIFICATION 52 3.09e-05 1.24e-02 NA NA
5. P A9N5P5 Multidrug resistance protein MdtH 4.84e-10 8.12e-06 NA NA
5. P Q82AK9 Probable cytochrome c oxidase subunit 1-alpha 1.37e-04 3.81e-03 NA NA
5. P Q3YY22 Lysophospholipid transporter LplT 8.99e-10 4.26e-05 NA NA
5. P A9RAG4 NADH-ubiquinone oxidoreductase chain 2 3.24e-04 9.87e-04 NA NA
5. P Q9ZCW4 Probable lipid II flippase MurJ 1.28e-05 1.04e-02 NA NA
5. P O31600 Uncharacterized MFS-type transporter YjbB 1.24e-14 2.61e-08 NA NA
5. P B2IHV3 NADH-quinone oxidoreductase subunit N 4.54e-05 6.49e-03 NA NA
5. P B5QXZ9 Multidrug resistance protein MdtH 2.41e-10 8.32e-06 NA NA
5. P A2ZU80 Probable high-affinity nitrate transporter 2.4 2.14e-08 9.30e-03 NA NA
5. P Q31NA0 NAD(P)H-quinone oxidoreductase chain 4 1 2.58e-05 1.03e-02 NA NA
5. P Q5PH16 Multidrug resistance protein MdtK 3.51e-06 4.46e-04 NA NA
5. P A5FXI8 NADH-quinone oxidoreductase subunit N 2 6.48e-05 7.89e-03 NA NA
5. P Q796Q1 Uncharacterized MFS-type transporter YitG 2.09e-09 3.95e-04 NA NA
5. P Q9RA46 Probable nitrate/nitrite antiporter NarK1 2.48e-09 3.96e-09 NA NA
5. P A3PBF7 NAD(P)H-quinone oxidoreductase subunit 2 3.78e-05 1.25e-03 NA NA
5. P Q99VY9 Putative antiporter subunit mnhD2 1.34e-05 2.95e-05 NA NA
5. P O35910 Monocarboxylate transporter 4 4.37e-10 4.60e-02 NA NA
5. P Q8YZV7 NAD(P)H-quinone oxidoreductase chain 4 1 4.09e-05 2.82e-02 NA NA
5. P Q9ZD47 ADP,ATP carrier protein 4 1.52e-08 7.48e-08 NA NA
5. P B1LKI4 Enterobactin exporter EntS 3.57e-12 2.99e-08 NA NA
5. P B5FDK5 Dipeptide and tripeptide permease B 4.64e-07 7.09e-08 NA NA
5. P C6DH09 Dipeptide and tripeptide permease A 2.03e-06 4.82e-09 NA NA
5. P P53986 Monocarboxylate transporter 1 3.37e-09 1.37e-03 NA NA
5. P B8GNZ8 NADH-quinone oxidoreductase subunit N 2.49e-05 2.10e-03 NA NA
5. P P60685 Na(+)/H(+) antiporter subunit D1 3.65e-05 2.88e-04 NA NA
5. P P0CD13 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.35e-05 9.98e-04 NA NA
5. P P29801 NAD(P)H-quinone oxidoreductase subunit 2 4.75e-05 3.02e-03 NA NA
5. P A7NEJ7 NADH-quinone oxidoreductase subunit N 2.54e-05 1.98e-04 NA NA
5. P Q35140 NADH-ubiquinone oxidoreductase chain 2 2.26e-04 1.15e-03 NA NA
5. P Q6NFM3 Cytochrome c oxidase subunit 1 9.39e-05 1.71e-02 NA NA
5. P Q5PLW2 Protein TsgA 1.43e-09 3.15e-08 NA NA
5. P Q2LCP8 NADH-ubiquinone oxidoreductase chain 2 4.73e-05 9.42e-05 NA NA
5. P Q752I1 Probable transporter MCH1 5.35e-09 7.93e-04 NA NA
5. P P0CD38 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.43e-05 6.88e-04 NA NA
5. P Q6PDE8 Transmembrane protein 180 1.80e-09 1.64e-05 NA NA
5. P O05467 Probable lipid II flippase MurJ 2.82e-05 5.49e-03 NA NA
5. P A7X0F9 Na(+)/H(+) antiporter subunit D1 2.89e-05 2.88e-04 NA NA
5. P B2VIN7 NADH-quinone oxidoreductase subunit N 3.82e-05 2.75e-05 NA NA
5. P O88298 Blood group Rh(D) polypeptide 5.00e-05 5.16e-04 NA NA
5. P P67446 Xanthine permease XanQ 1.41e-03 3.50e-02 NA NA
5. P O84068 ADP,ATP carrier protein 1 2.46e-08 8.82e-14 NA NA
5. P Q4R495 UNC93-like protein MFSD11 2.37e-08 2.98e-05 NA NA
5. P Q3T9M1 Major facilitator superfamily domain-containing protein 2B 4.00e-11 4.96e-05 NA NA
5. P A6LXP5 NADH-quinone oxidoreductase subunit N 3.22e-05 6.96e-05 NA NA
5. P Q6MDQ3 NADH-quinone oxidoreductase subunit N 4.53e-05 7.12e-03 NA NA
5. P B7L5L6 Multidrug resistance protein MdtK 4.03e-06 4.51e-04 NA NA
5. P P0C0L8 Proline/betaine transporter 5.55e-09 3.61e-05 NA NA
5. P Q9BZV2 Thiamine transporter 2 4.32e-08 5.22e-06 NA NA
5. P D0ZQC5 Dipeptide permease D 2.41e-08 1.09e-07 NA NA
5. P Q9B6D6 NADH-ubiquinone oxidoreductase chain 4 3.76e-04 4.05e-02 NA NA
5. P O07569 Uncharacterized MFS-type transporter YhjO 3.23e-11 7.27e-06 NA NA
5. P P0CD54 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 4.67e-05 4.08e-04 NA NA
5. P Q46821 Uric acid transporter UacT 1.03e-04 2.31e-02 NA NA
5. P P0CC81 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 6.92e-05 2.35e-04 NA NA
5. P P25744 Multidrug resistance protein MdtG 3.98e-12 3.64e-06 NA NA
5. P P69368 Multidrug resistance protein MdtH 7.27e-10 6.84e-06 NA NA
5. P P0AE16 Anhydromuropeptide permease 3.41e-09 1.15e-07 NA NA
5. P B1JLM7 Multidrug resistance protein MdtH 8.42e-10 3.61e-05 NA NA
5. P O31563 Uncharacterized MFS-type transporter YfiU 3.94e-08 1.44e-03 NA NA
5. P O34307 Uncharacterized MFS-type transporter YvmA 1.25e-10 1.85e-02 NA NA
5. P Q6A329 Putative sucrose transport protein SUC6 3.03e-09 5.27e-03 NA NA
5. P Q8BJ51 UNC93-like protein MFSD11 1.07e-08 1.76e-05 NA NA
5. P P0CC54 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.07e-05 2.85e-04 NA NA
5. P Q8FFK3 NADH-quinone oxidoreductase subunit N 5.95e-05 4.16e-05 NA NA
5. P A6QCE9 NADH-quinone oxidoreductase subunit N 4.14e-05 7.68e-04 NA NA
5. P A9R4E0 Multidrug transporter MdfA 5.23e-08 7.97e-03 NA NA
5. P P0CE44 Glucuronide carrier protein homolog 6.63e-11 1.82e-07 NA NA
5. P P32137 Putative 2,3-dihydroxypropane-1-sulfonate exporter 6.08e-11 2.10e-09 NA NA
5. P Q6ANN6 NADH-quinone oxidoreductase subunit N 2.97e-05 2.40e-02 NA NA
5. P O34674 Lipid II flippase MurJ 3.39e-06 1.62e-04 NA NA
5. P Q1C6C1 NADH-quinone oxidoreductase subunit N 3.99e-05 7.38e-05 NA NA
5. P Q8ZR35 Enterobactin exporter EntS 2.88e-12 1.34e-07 NA NA
5. P A1JLL1 NADH-quinone oxidoreductase subunit N 3.73e-05 3.87e-05 NA NA
5. P A0LDR4 NADH-quinone oxidoreductase subunit N 2.86e-05 2.80e-03 NA NA
5. P P0AF16 Lipid II flippase MurJ 2.94e-05 9.87e-04 NA NA
5. P Q68FT6 Ammonium transporter Rh type B 5.52e-05 6.55e-03 NA NA
5. P P70187 Hippocampus abundant transcript 1 protein 2.41e-09 5.16e-03 NA NA
5. P Q9I0J0 NADH-quinone oxidoreductase subunit M 5.53e-05 4.38e-02 NA NA
5. P P37746 Putative O-antigen transporter 1.18e-05 6.55e-03 NA NA
5. P O31577 Uncharacterized MFS-type transporter YfhI 4.72e-10 2.33e-04 NA NA
5. P C4XMN1 NADH-quinone oxidoreductase subunit N 1 4.06e-05 2.72e-03 NA NA
5. P Q0ILJ3 Sucrose transport protein SUT2 6.04e-09 8.01e-05 NA NA
5. P Q5BK75 Solute carrier family 46 member 3 1.55e-08 5.13e-08 NA NA
5. P P39386 Multidrug resistance protein MdtM 5.21e-09 1.32e-04 NA NA
5. P P0C566 Purine ribonucleoside efflux pump NepI 2.34e-10 8.49e-05 NA NA
5. P A1DG37 Autophagy-related protein 22-1 1.74e-07 2.73e-02 NA NA
5. P P36032 Probable transporter MCH2 8.36e-09 1.32e-05 NA NA
5. P P38731 Siderophore iron transporter ARN1 2.68e-08 4.99e-04 NA NA
5. P A4G631 NADH-quinone oxidoreductase subunit N 1.32e-05 1.01e-04 NA NA
5. P Q9CMZ9 Probable multidrug resistance protein NorM 6.46e-06 7.30e-05 NA NA
5. P B1JGM5 NADH-quinone oxidoreductase subunit N 4.59e-05 7.38e-05 NA NA
5. P Q06222 Glucose transporter 2A 1.55e-07 3.22e-03 NA NA
5. P P54723 Putative metabolite transport protein YfiG 1.80e-10 4.01e-03 NA NA
5. P P41036 Sialic acid transporter NanT 1.51e-07 5.20e-05 NA NA
5. P P0CD21 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.55e-05 7.73e-03 NA NA
5. P Q6GAR1 Proton-coupled antiporter flippase LtaA 1.55e-10 1.12e-12 NA NA
5. P Q8K9X5 NADH-quinone oxidoreductase subunit N 2.71e-05 4.73e-05 NA NA
5. P Q3V050 Multidrug and toxin extrusion protein 2 2.71e-05 5.67e-03 NA NA
5. P C1F9D0 NADH-quinone oxidoreductase subunit N 1 2.96e-04 2.81e-05 NA NA
5. P P0CC48 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.16e-04 4.01e-05 NA NA
5. P Q8ZK90 Ascorbate-specific PTS system EIIC component 5.40e-04 1.66e-03 NA NA
5. P P42726 Trifolitoxin-processing protein TfxD 1.64e-05 2.73e-07 NA NA
5. P P0CC25 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.61e-05 1.58e-04 NA NA
5. P D0CCT2 Chloramphenicol resistance protein CraA 1.16e-08 1.04e-03 NA NA
5. P A7ZMC9 Multidrug resistance protein MdtK 3.61e-06 4.51e-04 NA NA
5. P Q28814 RH-like protein IIR 8.99e-05 4.09e-02 NA NA
5. P Q32AW5 Dipeptide and tripeptide permease B 2.58e-08 8.78e-08 NA NA
5. P A2RJV0 PTS system galactose-specific EIIC component 3.48e-04 4.78e-02 NA NA
5. P A0A0H3M5L9 Multidrug efflux pump Tap 3.23e-10 2.40e-07 NA NA
5. P A1USY0 NADH-quinone oxidoreductase subunit N 3.81e-05 2.15e-04 NA NA
5. P Q9HTR0 Probable multidrug resistance protein NorM 4.45e-06 2.40e-02 NA NA
5. P Q8X4V6 Uncharacterized transporter YgaY 5.05e-10 5.89e-04 NA NA
5. P P0CD08 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.66e-05 9.98e-04 NA NA
5. P O52718 D-arabinitol transporter 1.25e-08 6.50e-11 NA NA
5. P O30513 Benzoate transport protein 3.66e-08 7.27e-06 NA NA
5. P Q5ATG7 Aspyridones efflux protein apdF 1.06e-12 8.57e-03 NA NA
5. P Q0T5W7 Multidrug resistance protein MdtH 9.38e-11 5.76e-06 NA NA
5. P A9R6K9 NADH-quinone oxidoreductase subunit N 3.63e-05 6.27e-05 NA NA
5. P Q04050 NADH-ubiquinone oxidoreductase chain 4 1.22e-04 1.56e-02 NA NA
5. P Q9S3J9 Sugar efflux transporter B 8.28e-11 7.04e-07 NA NA
5. P Q6N075 Molybdate-anion transporter 6.98e-10 3.62e-11 NA NA
5. P P0CD59 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.92e-05 5.27e-03 NA NA
5. P Q88BA2 Probable multidrug resistance protein NorM 3.59e-06 1.40e-02 NA NA
5. P P31675 Sugar efflux transporter A 4.04e-11 2.47e-08 NA NA
5. P Q1LTA1 NADH-quinone oxidoreductase subunit N 3.87e-05 5.55e-06 NA NA
5. P P0CC96 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.42e-05 2.55e-04 NA NA
5. P P0CD52 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.65e-05 1.77e-04 NA NA
5. P P0CD11 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.94e-05 9.98e-04 NA NA
5. P Q03583 Putative O-antigen transporter 1.71e-05 1.19e-02 NA NA
5. P Q9LE20 Protein DETOXIFICATION 54 4.93e-06 6.30e-04 NA NA
5. P Q9ZCQ1 Putative transporter AmpG 2 1.31e-08 1.92e-07 NA NA
5. P Q1PFG9 Protein DETOXIFICATION 7 3.84e-06 3.73e-03 NA NA
5. P Q5N5W1 NAD(P)H-quinone oxidoreductase chain 4 1 3.59e-05 1.03e-02 NA NA
5. P B5YVT5 Multidrug resistance protein MdtH 5.75e-10 9.51e-06 NA NA
5. P Q1IS45 NADH-quinone oxidoreductase subunit N 2 2.18e-05 2.75e-03 NA NA
5. P Q8NHS3 Major facilitator superfamily domain-containing protein 8 3.60e-09 1.32e-03 NA NA
5. P Q6CLN9 Protein BTN1 1.37e-05 6.51e-06 NA NA
5. P P60778 Protein TsgA 1.41e-09 6.99e-08 NA NA
5. P O60669 Monocarboxylate transporter 2 5.02e-09 1.56e-02 NA NA
5. P B5RBD4 Multidrug resistance protein MdtH 2.65e-10 7.82e-06 NA NA
5. P Q52981 Probable K(+)/H(+) antiporter subunit D 1.95e-05 2.12e-04 NA NA
5. P P0DPR7 Colistin resistance protein EmrB 2.35e-08 7.59e-04 NA NA
5. P Q0D2E8 Protein RFT1 homolog 4.29e-05 1.24e-03 NA NA
5. P B6I0P3 Enterobactin exporter EntS 4.57e-12 3.37e-08 NA NA
5. P P62967 Tetracycline resistance protein 1.26e-08 4.13e-04 NA NA
5. P Q0TDZ7 Lysophospholipid transporter LplT 8.87e-10 4.79e-05 NA NA
5. P Q9ZDE9 Uncharacterized protein RP382 4.37e-05 2.22e-04 NA NA
5. P Q45400 PTS system cellobiose-specific EIIC component 4.65e-04 4.97e-02 NA NA
5. P P98056 Cytochrome c oxidase subunit 1 homolog 4.40e-05 1.92e-05 NA NA
5. P Q1GTL2 NADH-quinone oxidoreductase subunit N 7.38e-05 2.75e-03 NA NA
5. P P0AEJ0 Multidrug export protein EmrB 7.57e-08 2.07e-02 NA NA
5. P P37758 Nitrate/nitrite transporter NarU 7.32e-09 1.70e-08 NA NA
5. P A9MWE8 Purine ribonucleoside efflux pump NepI 2.53e-10 9.20e-05 NA NA
5. P P96710 Arabinose-proton symporter 2.73e-10 4.06e-03 NA NA
5. P Q3LFN0 Riboflavin transporter rft-1 5.30e-07 8.75e-03 NA NA
5. P P74168 Uncharacterized symporter sll1374 2.67e-08 1.47e-08 NA NA
5. P A8GFK7 Multidrug resistance protein MdtH 1.75e-09 9.40e-06 NA NA
5. P O05000 NADH-ubiquinone oxidoreductase chain 2 1.72e-04 5.16e-03 NA NA
5. P Q9HR72 Putative dimethyl sulfoxide reductase membrane subunit C 6.40e-04 9.98e-05 NA NA
5. P P25596 Glutathione exchanger 1 5.37e-07 3.42e-06 NA NA
5. P P0CC93 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.44e-05 7.55e-05 NA NA
5. P P0CC45 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.42e-05 2.61e-04 NA NA
5. P Q39609 Nitrate transporter 2.2 5.97e-09 7.76e-04 NA NA
5. P B5QWU1 Lysophospholipid transporter LplT 4.94e-10 7.04e-05 NA NA
5. P Q08C75 Probable vesicular acetylcholine transporter-A 1.76e-09 3.78e-02 NA NA
5. P P33733 Tetracycline resistance protein, class D 8.43e-11 1.35e-04 NA NA
5. P P37621 Uncharacterized MFS-type transporter YhhS 6.37e-09 5.95e-08 NA NA
5. P Q8XFG0 Multidrug resistance protein MdtM 4.88e-09 9.49e-03 NA NA
5. P P41440 Reduced folate transporter 6.17e-08 3.60e-02 NA NA
5. P P0CC38 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.49e-05 1.61e-03 NA NA
5. P Q83QT2 NADH-quinone oxidoreductase subunit N 6.00e-05 6.65e-05 NA NA
5. P B5EZJ7 NADH-quinone oxidoreductase subunit N 6.05e-05 3.24e-05 NA NA
5. P Q82TV6 NADH-quinone oxidoreductase subunit N 2.28e-05 3.99e-04 NA NA
5. P Q4L8Q5 Probable nitrate transporter NarT 1.60e-10 3.83e-05 NA NA
5. P A0A2R9TD79 Peptide transporter YePEPT 3.05e-07 2.38e-02 NA NA
5. P P38724 Siderophore iron transporter ARN2 5.00e-08 4.67e-04 NA NA
5. P P53660 Uncharacterized protein MG447 homolog MYCGA2290 5.15e-06 4.01e-03 NA NA
5. P P0CY44 NADH-ubiquinone oxidoreductase chain 4 5.89e-05 1.71e-02 NA NA
5. P B7LFZ9 Multidrug resistance protein MdtH 3.12e-13 3.69e-06 NA NA
5. P Q4ULY0 ADP,ATP carrier protein 2 2.76e-08 1.05e-05 NA NA
5. P P57263 NADH-quinone oxidoreductase subunit M 5.10e-05 3.17e-02 NA NA
5. P P64784 Multidrug efflux pump Tap 2.89e-09 2.40e-07 NA NA
5. P B1KJW0 NADH-quinone oxidoreductase subunit N 1.61e-05 1.62e-05 NA NA
5. P P36173 Glutathione exchanger 2 2.06e-07 3.46e-06 NA NA
5. P Q4LCA6 ADP,ATP carrier protein 1 6.84e-08 8.02e-11 NA NA
5. P O43934 UNC93-like protein MFSD11 2.86e-08 5.62e-06 NA NA
5. P A6H1Q0 NADH-quinone oxidoreductase subunit N 5.56e-05 1.24e-03 NA NA
5. P Q2G2H7 Na(+)/H(+) antiporter subunit D1 3.50e-05 2.88e-04 NA NA
5. P P0CC26 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.56e-05 1.58e-04 NA NA
5. P Q1RBD2 Multidrug resistance protein MdtK 3.60e-06 6.36e-04 NA NA
5. P A0RME1 NADH-quinone oxidoreductase subunit N 1.83e-04 4.11e-05 NA NA
5. P Q9SQN2 Probable folate-biopterin transporter 3 4.87e-09 2.79e-02 NA NA
5. P A6QET6 Putative antiporter subunit mnhD2 1.49e-05 2.50e-05 NA NA
5. P B4TUM8 Lysophospholipid transporter LplT 5.25e-10 6.05e-06 NA NA
5. P P0CC32 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 7.64e-05 3.12e-04 NA NA
5. P B7NDX4 Protein TsgA 1.57e-09 7.48e-08 NA NA
5. P Q7A725 Putative antiporter subunit mnhD2 1.45e-05 2.95e-05 NA NA
5. P Q92QN9 NADH-quinone oxidoreductase subunit N 1 5.15e-05 5.16e-03 NA NA
5. P P9WJY7 Probable nitrate/nitrite transporter NarK2 5.48e-10 6.60e-07 NA NA
5. P B7UP79 Multidrug resistance protein MdtH 6.12e-10 6.84e-06 NA NA
5. P P31436 Sugar efflux transporter C 3.66e-10 2.82e-09 NA NA
5. P P15582 NADH-ubiquinone oxidoreductase chain 4 5.95e-05 2.60e-02 NA NA
5. P B1VSR0 NADH-quinone oxidoreductase subunit N 1 1.43e-05 3.99e-04 NA NA
5. P A7ZXL8 Enterobactin exporter EntS 3.27e-12 8.79e-09 NA NA
5. P O21048 NADH-ubiquinone oxidoreductase chain 2 5.01e-05 1.11e-04 NA NA
5. P C6DA34 NADH-quinone oxidoreductase subunit N 3.34e-05 9.64e-05 NA NA
5. P Q67IC4 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 2.42e-05 1.35e-04 NA NA
5. P P63853 Probable cytochrome c oxidase subunit 1 1.03e-04 3.90e-02 NA NA
5. P B3DZT0 NADH-quinone oxidoreductase subunit N 2.46e-05 1.77e-04 NA NA
5. P Q57QJ1 Multidrug resistance protein MdtH 2.05e-10 8.02e-06 NA NA
5. P Q83SB6 Enterobactin exporter EntS 4.50e-12 4.56e-10 NA NA
5. P B5XUP3 Lysophospholipid transporter LplT 7.93e-10 4.90e-03 NA NA
5. P Q19V78 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 2.32e-05 5.27e-04 NA NA
5. P B2K306 Multidrug resistance protein MdtH 1.10e-10 3.61e-05 NA NA
5. P P0CD25 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.29e-05 1.77e-04 NA NA
5. P Q56WD3 UNC93-like protein 1 1.11e-07 4.65e-02 NA NA
5. P Q8GFA2 Dipeptide and tripeptide permease B 1.92e-08 1.01e-05 NA NA
5. P P59699 Sialic acid transporter NanT 8.66e-08 4.41e-05 NA NA
5. P Q1RD92 Multidrug resistance protein MdtH 6.06e-10 6.84e-06 NA NA
5. P Q11073 Uncharacterized protein B0416.5 5.00e-09 8.78e-08 NA NA
5. P B6H059 MFS-type transporter prx5 2.13e-07 6.72e-05 NA NA
5. P C1F223 NADH-quinone oxidoreductase subunit N 2 1.36e-04 1.15e-04 NA NA
5. P Q6GID9 Na(+)/H(+) antiporter subunit D1 3.61e-05 4.51e-04 NA NA
5. P Q78KK3 Solute carrier family 22 member 18 3.06e-09 1.46e-02 NA NA
5. P B5XXJ2 Multidrug resistance protein MdtH 3.41e-10 9.06e-06 NA NA
5. P Q65S74 Probable sugar efflux transporter 1.37e-10 1.74e-05 NA NA
5. P O24723 Probable 1-hydroxy-2-naphthoate transporter 1.62e-12 9.98e-05 NA NA
5. P Q5HQE8 Proton-coupled antiporter flippase LtaA 3.61e-10 9.76e-12 NA NA
5. P Q57RY1 Enterobactin exporter EntS 2.91e-12 1.40e-07 NA NA
5. P D0Z7W2 Dipeptide and tripeptide permease A 1.71e-07 1.32e-06 NA NA
5. P A8G3E9 NAD(P)H-quinone oxidoreductase subunit 2 3.62e-05 2.06e-03 NA NA
5. P Q9ZDF2 ADP,ATP carrier protein 2 1.12e-07 1.40e-07 NA NA
5. P A4SR87 Multidrug resistance protein MdtH 1.50e-10 1.32e-05 NA NA
5. P A9B488 NADH-quinone oxidoreductase subunit N 2 1.33e-04 3.82e-02 NA NA
5. P A7ZIX5 Enterobactin exporter EntS 3.21e-12 3.37e-08 NA NA
5. P Q67IB5 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 7.73e-05 1.56e-04 NA NA
5. P Q2FIC6 Na(+)/H(+) antiporter subunit D1 3.59e-05 2.33e-04 NA NA
5. P O34367 Uncharacterized MFS-type transporter YtbD 9.97e-10 2.29e-03 NA NA
5. P Q99V76 Proton-coupled antiporter flippase LtaA 2.88e-09 2.65e-12 NA NA
5. P Q67IA3 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 9.61e-05 3.05e-04 NA NA
5. P Q92JI6 ADP,ATP carrier protein 1 4.44e-08 1.29e-09 NA NA
5. P O14237 Uncharacterized membrane protein C6F6.04c 5.21e-08 4.50e-10 NA NA
5. P B6ISW8 NADH-quinone oxidoreductase subunit N 3.27e-05 1.63e-02 NA NA
5. P A1A9W0 Multidrug resistance protein MdtH 8.24e-12 6.84e-06 NA NA
5. P P24326 Uncharacterized protein HI_0350 8.69e-08 2.25e-09 NA NA
5. P A9MEJ6 Multidrug resistance protein MdtK 4.44e-06 2.76e-04 NA NA
5. P Q4L8N9 Multidrug export protein MepA 4.49e-06 1.24e-03 NA NA
5. P Q9YDD0 Protein translocase subunit SecY 6.22e-04 4.65e-02 NA NA
5. P Q3BBX8 Ammonium transporter Rh type B 1.38e-04 1.41e-02 NA NA
5. P Q8YM86 NAD(P)H-quinone oxidoreductase chain 4-3 2.94e-04 2.33e-02 NA NA
5. P P0CC59 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.81e-05 5.10e-04 NA NA
5. P B3CUJ6 NADH-quinone oxidoreductase subunit N 2.25e-05 2.04e-05 NA NA
5. P A4XV14 NADH-quinone oxidoreductase subunit N 2.02e-05 1.71e-04 NA NA
5. P Q17Z65 NADH-quinone oxidoreductase subunit N 1.96e-05 1.11e-03 NA NA
5. P Q7V2N8 NAD(P)H-quinone oxidoreductase subunit 2 3.88e-05 6.76e-03 NA NA
5. P P0AFZ7 Trk system potassium uptake protein TrkH 7.33e-04 4.37e-04 NA NA
5. P Q9KGA4 Uncharacterized protein BH0208 8.06e-04 1.85e-02 NA NA
5. P Q92I98 ADP,ATP carrier protein 2 4.15e-07 2.00e-06 NA NA
5. P A6T7D8 Multidrug resistance protein MdtH 3.62e-10 1.78e-06 NA NA
5. P A8A2E5 NADH-quinone oxidoreductase subunit N 2.31e-04 3.92e-05 NA NA
5. P Q8VYL8 Protein DETOXIFICATION 10 9.08e-06 3.25e-03 NA NA
5. P Q3MHW6 Monocarboxylate transporter 1 4.15e-09 1.58e-02 NA NA
5. P Q8SUF9 ADP,ATP carrier protein 2 3.46e-09 2.40e-08 NA NA
5. P B5YPT7 Enterobactin exporter EntS 3.70e-12 3.86e-08 NA NA
5. P O80695 Protein DETOXIFICATION 37 8.90e-06 2.20e-02 NA NA
5. P Q9ZVH5 Protein DETOXIFICATION 53 2.84e-06 2.20e-02 NA NA
5. P Q2RJT7 NADH-quinone oxidoreductase subunit N 5.71e-05 2.63e-03 NA NA
5. P P72714 NAD(P)H-quinone oxidoreductase subunit 2 2.40e-05 5.00e-03 NA NA
5. P B2VK30 Protein TsgA homolog 1.73e-09 2.07e-09 NA NA
5. P Q67IL7 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic NA 1.52e-03 NA NA
5. P Q6AYY8 Acetyl-coenzyme A transporter 1 6.79e-07 7.89e-03 NA NA
5. P P45272 Multidrug resistance protein HmrM 7.15e-06 4.22e-04 NA NA
5. P Q96MC6 Hippocampus abundant transcript 1 protein 2.46e-09 9.02e-03 NA NA
5. P Q3T9X0 Solute carrier family 2, facilitated glucose transporter member 9 2.76e-07 3.97e-03 NA NA
5. P Q9WWR2 Cytochrome bo(3) ubiquinol oxidase subunit 1 3.20e-05 2.63e-02 NA NA
5. P O32859 Multidrug efflux pump Tap 1.20e-08 3.59e-09 NA NA
5. P B7I751 NADH-quinone oxidoreductase subunit N 3.99e-05 8.63e-06 NA NA
5. P P0CD49 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.17e-05 2.66e-04 NA NA
5. P P76417 Putative nucleoside transporter YegT 6.35e-10 5.10e-12 NA NA
5. P Q8DPQ6 Probable multidrug resistance protein NorM 1.69e-06 1.09e-04 NA NA
5. P P77437 Hydrogenase-4 component F 1.60e-05 2.03e-02 NA NA
5. P P93401 NADH-ubiquinone oxidoreductase chain 2 3.00e-05 2.45e-02 NA NA
5. P Q17766 Folate transporter 1 1.38e-09 1.93e-08 NA NA
5. P P75712 Putative allantoin permease 7.29e-04 1.83e-02 NA NA
5. P P39642 Putative bacilysin exporter BacE 8.08e-11 8.78e-08 NA NA
5. P A5IQH8 Putative antiporter subunit mnhD2 1.35e-05 2.50e-05 NA NA
5. P Q64Y15 NADH-quinone oxidoreductase subunit N 5.56e-05 9.98e-05 NA NA
5. P Q3M9C7 NAD(P)H-quinone oxidoreductase chain 4 3 3.58e-05 1.56e-02 NA NA
5. P P27670 Hexose-6-phosphate:phosphate antiporter 1.21e-08 9.53e-05 NA NA
5. P Q81K10 NADH-quinone oxidoreductase subunit N 2.34e-05 6.95e-04 NA NA
5. P P47040 Protein BTN1 3.25e-06 1.83e-03 NA NA
5. P Q0C1D1 NADH-quinone oxidoreductase subunit N 5.91e-05 3.25e-03 NA NA
5. P Q66AV8 Multidrug resistance protein MdtH 9.72e-11 3.61e-05 NA NA
5. P P98059 Cytochrome c oxidase subunit 1 2.57e-05 4.61e-06 NA NA
5. P P47307 Major facilitator superfamily transporter MG061 1.39e-07 2.07e-14 NA NA
5. P Q1CHR3 NADH-quinone oxidoreductase subunit N 3.47e-05 7.38e-05 NA NA
5. P Q7WTR3 Multidrug resistance protein MdtK 1.22e-05 4.62e-04 NA NA
5. P P77304 Dipeptide and tripeptide permease A 5.59e-06 2.84e-07 NA NA
5. P Q9M817 Protein NRT1/ PTR FAMILY 1.2 5.35e-07 2.40e-02 NA NA
5. P A6TZA2 Putative antiporter subunit mnhD2 1.44e-05 2.50e-05 NA NA
5. P B8D860 Protein TsgA homolog 3.52e-11 3.50e-07 NA NA
5. P O31444 Uncharacterized MFS-type transporter YbfB 4.84e-09 1.28e-03 NA NA
5. P B7MXV5 NADH-quinone oxidoreductase subunit N 5.88e-05 4.26e-05 NA NA
5. P P57415 Probable lipid II flippase MurJ 2.55e-05 6.35e-06 NA NA
5. P C0Q051 NADH-quinone oxidoreductase subunit N 6.07e-05 2.75e-05 NA NA
5. P A0A1W5T3J9 MFS-type tansporter poxA 2.97e-08 1.82e-02 NA NA
5. P P02920 Lactose permease 8.17e-10 1.34e-07 NA NA
5. P P0CC75 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.58e-05 2.49e-04 NA NA
5. P Q8K9L3 Probable lipid II flippase MurJ 4.14e-05 6.09e-04 NA NA
5. P A7ZZ23 Multidrug resistance protein MdtH 6.44e-11 2.63e-06 NA NA
5. P Q3Z351 Multidrug resistance protein MdtH 1.97e-11 3.46e-06 NA NA
5. P P37555 Uncharacterized membrane protein YabM 8.98e-06 1.74e-05 NA NA
5. P G7KDA1 Low affinity inorganic phosphate transporter 8 2.99e-09 7.27e-03 NA NA
5. P Q7N2J9 NADH-quinone oxidoreductase subunit N 5.04e-05 2.43e-04 NA NA
5. P P9WJY1 Uncharacterized MFS-type transporter Rv0037c 4.11e-13 1.41e-03 NA NA
5. P P39276 Dipeptide and tripeptide permease C 2.10e-07 4.48e-08 NA NA
5. P Q8WMW0 Ammonium transporter Rh type B 8.97e-05 1.80e-02 NA NA
5. P A5GQH5 NAD(P)H-quinone oxidoreductase chain 4 1.23e-05 3.60e-02 NA NA
5. P P75040 Major facilitator superfamily transporter MPN_077 1.42e-05 7.36e-10 NA NA
5. P P02983 Tetracycline resistance protein 1.52e-08 4.13e-04 NA NA
5. P A1JRQ2 Multidrug resistance protein MdtH 5.60e-10 1.29e-05 NA NA
5. P Q9JV27 Probable multidrug resistance protein NorM 3.66e-06 3.46e-03 NA NA
5. P Q28T49 NADH-quinone oxidoreductase subunit N 3.88e-05 1.75e-03 NA NA
5. P O31695 Uncharacterized MFS-type transporter YkuC 7.26e-09 3.88e-06 NA NA
5. P Q8ZMA5 Lysophospholipid transporter LplT 5.37e-10 8.99e-05 NA NA
5. P B4ETN1 Multidrug resistance protein MdtH 9.70e-11 2.95e-04 NA NA
5. P P32135 Inner membrane protein YihN 5.96e-09 5.94e-11 NA NA
5. P A8AP55 Lysophospholipid transporter LplT 5.50e-09 9.15e-04 NA NA
5. P P0CD37 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 7.57e-05 4.19e-03 NA NA
5. P P50676 Cytochrome c oxidase subunit 1 1.73e-04 4.88e-02 NA NA
5. P Q6GBK4 Putative antiporter subunit mnhD2 1.31e-05 2.50e-05 NA NA
5. P P0AGC0 Hexose-6-phosphate:phosphate antiporter 6.33e-09 1.81e-06 NA NA
5. P A9JTG4 Major facilitator superfamily domain-containing protein 4B 1.65e-08 5.67e-03 NA NA
5. P P9WJX8 Multidrug efflux pump Tap 3.47e-09 2.40e-07 NA NA
5. P Q8FK20 Enterobactin exporter EntS 2.97e-12 7.28e-08 NA NA
5. P A5GP41 NAD(P)H-quinone oxidoreductase chain 4 4.51e-05 2.79e-02 NA NA
5. P Q92AG2 Probable multidrug resistance protein NorM 2.49e-06 3.95e-04 NA NA
5. P A9BD08 NAD(P)H-quinone oxidoreductase chain 4 6.61e-05 1.95e-02 NA NA
5. P A7ZP90 NADH-quinone oxidoreductase subunit N 6.04e-05 3.92e-05 NA NA
5. P Q948L0 Sucrose transport protein SUT3 1.02e-08 1.63e-03 NA NA
5. P Q8LG53 UNC93-like protein 2 1.13e-07 4.65e-02 NA NA
5. P P94575 Probable allantoin permease 5.18e-04 2.03e-02 NA NA
5. P Q83II9 Ascorbate-specific PTS system EIIC component 7.14e-04 2.02e-03 NA NA
5. P Q66A27 Multidrug resistance protein MdtK 6.49e-06 7.35e-04 NA NA
5. P Q31YI5 NADH-quinone oxidoreductase subunit N 6.03e-05 8.10e-05 NA NA
5. P P0CD26 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 6.56e-05 3.90e-04 NA NA
5. P Q8DMR6 NAD(P)H-quinone oxidoreductase subunit 2 2.59e-05 2.24e-02 NA NA
5. P P47234 Lactose permease 9.71e-09 1.66e-08 NA NA
5. P Q8X1Z7 Siderophore iron transporter mirA 3.07e-09 3.49e-04 NA NA
5. P P02982 Tetracycline resistance protein, class A 1.12e-09 5.14e-05 NA NA
5. P D2TNL4 Dipeptide permease D 1.74e-08 8.43e-08 NA NA
5. P Q8XGS2 Purine ribonucleoside efflux pump NepI 7.78e-12 8.49e-05 NA NA
5. P Q47142 Probable 3-phenylpropionic acid transporter 1.64e-08 2.10e-06 NA NA
5. P Q9WXU1 Probable lipid II flippase MurJ 2.06e-05 3.99e-04 NA NA
5. P P0CC99 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 1.03e-04 1.65e-04 NA NA
5. P O05229 Na(+)/H(+) antiporter subunit D 4.14e-05 1.83e-05 NA NA
5. P A1B479 NADH-quinone oxidoreductase subunit N 3.72e-05 1.92e-05 NA NA
5. P P17583 Cyanate transport protein CynX 1.46e-08 1.62e-09 NA NA
5. P O13883 GPI transamidase component GAB1 homolog 1.20e-04 3.82e-02 NA NA
5. P A5VAN3 NADH-quinone oxidoreductase subunit N 6.36e-05 6.35e-03 NA NA
5. P Q9L6L2 Trk system potassium uptake protein TrkH 6.40e-04 4.27e-04 NA NA
5. P B7NL69 Multidrug resistance protein MdtH 8.09e-12 6.92e-06 NA NA
5. P Q8Y654 Probable multidrug resistance protein NorM 4.16e-06 2.35e-04 NA NA
5. P P9WJY3 Probable triacylglyceride transporter Rv1410c 1.48e-11 9.58e-07 NA NA
5. P Q57GJ9 Ascorbate-specific PTS system EIIC component 4.13e-04 1.46e-03 NA NA
5. P Q8K0H7 Solute carrier family 45 member 3 1.31e-07 3.16e-04 NA NA
5. P P0AEY9 Multidrug transporter MdfA 2.83e-08 2.24e-02 NA NA
5. P P02921 Melibiose carrier protein 1.49e-09 1.62e-09 NA NA
5. P A8AJL6 Enterobactin exporter EntS 2.16e-12 4.09e-07 NA NA
5. P P44927 Multidrug export protein EmrB 4.94e-08 3.86e-02 NA NA
5. P P0CC63 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 6.61e-05 8.57e-04 NA NA
5. P Q2NSL1 NADH-quinone oxidoreductase subunit N 6.37e-05 2.61e-04 NA NA
5. P Q7Z3Q1 Solute carrier family 46 member 3 6.36e-09 8.54e-07 NA NA
5. P Q05572 Cytochrome c oxidase subunit 1 homolog, bacteroid 6.13e-05 9.75e-06 NA NA
5. P P98055 Cytochrome c oxidase subunit 1 homolog 6.58e-05 5.02e-05 NA NA
5. P P0CC68 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.82e-05 2.98e-04 NA NA
5. P Q5U4V1 Ammonium transporter Rh type C 1.30e-04 1.29e-02 NA NA
5. P P0CD05 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.48e-05 9.87e-04 NA NA
5. P P37180 Probable Ni/Fe-hydrogenase 2 b-type cytochrome subunit 3.53e-04 1.60e-05 NA NA
5. P C5BGP5 Protein TsgA homolog 9.54e-10 4.82e-09 NA NA
5. P B3QXM3 NADH-quinone oxidoreductase subunit N 1 6.56e-05 9.31e-05 NA NA
5. P Q45411 EPS I polysaccharide export inner membrane protein EpsE 2.23e-05 1.56e-04 NA NA
5. P Q85FP1 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 8.08e-05 1.27e-04 NA NA
5. P Q28426 RH-like protein IC 9.59e-05 1.89e-02 NA NA
5. P Q4R877 Thiamine transporter 2 2.06e-09 6.90e-08 NA NA
5. P Q3YWQ7 Protein TsgA 1.10e-08 1.21e-08 NA NA
5. P Q2FJ12 Putative antiporter subunit mnhD2 1.18e-05 2.50e-05 NA NA
5. P Q2UD74 Autophagy-related protein 22-2 3.34e-06 1.83e-02 NA NA
5. P Q8H6G7 Probable inorganic phosphate transporter 1-9 5.67e-08 4.43e-02 NA NA
5. P Q5KZL2 Probable multidrug resistance protein NorM 4.44e-06 6.03e-03 NA NA
5. P P0CD15 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.84e-05 9.98e-04 NA NA
5. P Q68W11 ADP,ATP carrier protein 5 1.98e-08 2.19e-07 NA NA
5. P P0C0K1 Uncharacterized protein MHJ_0132 6.40e-08 1.44e-12 NA NA
5. P P0CC92 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.06e-05 7.55e-05 NA NA
5. P O51750 Probable lipid II flippase MurJ 1.10e-04 2.12e-04 NA NA
5. P B4U8J0 NADH-quinone oxidoreductase subunit N 2 1.97e-05 9.45e-04 NA NA
5. P P0AGF4 D-xylose-proton symporter 3.04e-09 4.13e-04 NA NA
5. P A7ZBF3 NADH-quinone oxidoreductase subunit N 1.14e-05 5.10e-04 NA NA
5. P Q9PKX5 ADP,ATP carrier protein 1 3.79e-08 3.11e-11 NA NA
5. P C6D5D2 NADH-quinone oxidoreductase subunit N 2.81e-05 1.48e-04 NA NA
5. P P0CC76 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 6.41e-05 4.95e-03 NA NA
5. P Q8SRA2 ADP,ATP carrier protein 1 7.89e-08 8.26e-11 NA NA
5. P Q8ZLD6 Dipeptide and tripeptide permease B 2.35e-07 1.10e-06 NA NA
5. P A7NL15 NADH-quinone oxidoreductase subunit N 1 8.24e-05 3.71e-02 NA NA
5. P P0A4K6 Tetracycline resistance protein 3.27e-09 3.12e-03 NA NA
5. P P0AGC2 Hexose-6-phosphate:phosphate antiporter 5.06e-09 1.81e-06 NA NA
5. P Q1KKV8 Molybdate-anion transporter 6.68e-10 1.15e-07 NA NA
5. P P59985 Uncharacterized protein Mb3654 4.04e-05 1.55e-02 NA NA
5. P P9WKX9 Uncharacterized protein Rv3630 4.76e-05 1.87e-02 NA NA
5. P A2BPR7 NAD(P)H-quinone oxidoreductase subunit 2 4.24e-05 6.09e-03 NA NA
5. P P0C0K2 Uncharacterized protein mhp246 2.42e-06 3.28e-13 NA NA
5. P A7ZKH0 Multidrug resistance protein MdtH 1.03e-10 6.84e-06 NA NA
5. P Q0VA82 Major facilitator superfamily domain-containing protein 8 1.08e-09 1.07e-04 NA NA
5. P Q1LTM2 Multidrug resistance protein MdtH NA 3.88e-06 NA NA
5. P Q9PJB9 Probable lipid II flippase MurJ 1.57e-05 1.85e-04 NA NA
5. P Q92PZ0 Probable multidrug resistance protein NorM 2.52e-06 9.11e-03 NA NA
5. P A5UFU0 Probable sugar efflux transporter 3.40e-10 1.11e-04 NA NA
5. P Q2G1N0 Staphyloferrin B transporter 2.35e-10 2.07e-12 NA NA
5. P A2BZX6 NAD(P)H-quinone oxidoreductase chain 4 2.22e-05 3.53e-02 NA NA
5. P Q8D9N8 Multidrug resistance protein NorM 5.03e-06 2.82e-04 NA NA
5. P O05390 Alpha-ketoglutarate permease 7.30e-09 5.27e-11 NA NA
5. P Q31TC4 Ascorbate-specific PTS system EIIC component 5.99e-04 2.10e-04 NA NA
5. P P0CC95 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.13e-05 6.09e-04 NA NA
5. P A1AVS5 NADH-quinone oxidoreductase subunit N 2.08e-05 1.24e-04 NA NA
5. P P37662 Uncharacterized MFS-type transporter YhjX 3.57e-10 3.73e-06 NA NA
5. P Q950U6 NADH-ubiquinone oxidoreductase chain 2 2.19e-04 1.26e-02 NA NA
5. P P0CC58 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.16e-05 5.10e-04 NA NA
5. P B7LAT8 NADH-quinone oxidoreductase subunit N 2.31e-04 3.92e-05 NA NA
5. P P38055 Inner membrane metabolite transport protein YdjE 8.25e-12 1.20e-02 NA NA
5. P O29750 Hdr-like menaquinol oxidoreductase integral membrane subunit 2.53e-05 1.56e-05 NA NA
5. P Q46909 Inner membrane metabolite transport protein YgcS 1.77e-11 4.50e-03 NA NA
5. P P30000 Sucrose permease 4.71e-09 1.95e-09 NA NA
5. P P0CC79 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 6.40e-05 2.49e-04 NA NA
5. P Q8VCV9 Sodium-dependent glucose transporter 1A 5.09e-10 5.67e-03 NA NA
5. P Q8YQ78 NAD(P)H-quinone oxidoreductase chain 4-2 4.64e-05 6.76e-03 NA NA
5. P A1C7M3 Autophagy-related protein 22-1 8.23e-08 2.80e-03 NA NA
5. P P0AFF0 NADH-quinone oxidoreductase subunit N 4.82e-05 3.92e-05 NA NA
5. P Q7VQX5 Multidrug resistance protein MdtH 8.20e-10 1.79e-04 NA NA
5. P Q9I3Y3 Multidrug resistance protein PmpM 2.55e-06 1.07e-03 NA NA
5. P B1IU09 Lysophospholipid transporter LplT 5.67e-09 4.79e-05 NA NA
5. P Q1CJI3 Multidrug resistance protein MdtH 9.07e-10 3.61e-05 NA NA
5. P C6DFD4 Multidrug resistance protein MdtH 8.14e-11 5.98e-05 NA NA
5. P P0AEY8 Multidrug transporter MdfA 2.80e-08 2.24e-02 NA NA
5. P P75366 Uncharacterized protein MG294 homolog 2.49e-08 1.37e-15 NA NA
5. P Q83BR8 NADH-quinone oxidoreductase subunit N 4.29e-05 4.32e-04 NA NA
5. P P53525 Uncharacterized protein ML1998 3.62e-04 1.87e-02 NA NA
5. P Q03073 Cytochrome c oxidase subunit 1 homolog, bacteroid 3.88e-05 9.40e-06 NA NA
5. P P60686 Na(+)/H(+) antiporter subunit D1 3.60e-05 2.88e-04 NA NA
5. P Q65SY9 Probable multidrug resistance protein NorM 7.37e-06 7.27e-03 NA NA
5. P O25788 Putative glucose/galactose transporter 7.58e-11 1.90e-04 NA NA
5. P Q8X9D3 Dipeptide permease D 7.79e-09 8.01e-07 NA NA
5. P A7FHJ7 Multidrug resistance protein MdtK 5.83e-06 5.22e-04 NA NA
5. P B1IYL5 Enterobactin exporter EntS 4.01e-12 8.79e-09 NA NA
5. P Q7CJ84 NADH-quinone oxidoreductase subunit N 3.58e-05 7.38e-05 NA NA
5. P B1I6I5 NADH-quinone oxidoreductase subunit N 3.09e-05 1.07e-03 NA NA
5. P Q4FM78 NADH-quinone oxidoreductase subunit N 3.98e-05 3.02e-04 NA NA
5. P A1ALQ2 NADH-quinone oxidoreductase subunit N 5.24e-05 3.25e-03 NA NA
5. P Q5ZIT9 Major facilitator superfamily domain-containing protein 1 8.52e-08 1.24e-06 NA NA
5. P P0AE24 Arabinose-proton symporter 8.96e-08 5.21e-03 NA NA
5. P B5FJP6 Protein TsgA 1.52e-09 3.92e-08 NA NA
5. P A4IF94 Hippocampus abundant transcript-like protein 1 4.11e-11 2.06e-03 NA NA
5. P Q08791 Uncharacterized MFS-type transporter YcxA 1.93e-09 6.72e-05 NA NA
5. P P0C0L7 Proline/betaine transporter 5.37e-09 3.61e-05 NA NA
5. P Q5U3U7 Sodium-dependent lysophosphatidylcholine symporter 1-A 5.82e-11 1.90e-04 NA NA
5. P P07561 Tetracycline resistance protein 2.89e-09 4.23e-03 NA NA
5. P P71399 Lsg locus putative protein 1 5.44e-06 4.85e-03 NA NA
5. P F4HZH9 Protein DETOXIFICATION 11 6.40e-06 5.85e-03 NA NA
5. P P0CC77 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.77e-05 4.95e-03 NA NA
5. P Q2W3J7 NADH-quinone oxidoreductase subunit N 4.76e-05 2.66e-03 NA NA
5. P P75291 Ascorbate-specific PTS system EIIC component 1.79e-03 1.77e-04 NA NA
5. P S7ZK48 MFS-type tansporter poxA 1.08e-08 1.82e-02 NA NA
5. P Q8Z172 Ascorbate-specific PTS system EIIC component 4.47e-04 2.39e-03 NA NA
5. P Q6GJ44 Putative antiporter subunit mnhD2 1.50e-05 5.28e-06 NA NA
5. P Q8VZR7 Protein NRT1/ PTR FAMILY 5.1 4.53e-07 2.55e-02 NA NA
5. P B4TGR4 Lysophospholipid transporter LplT 4.90e-10 4.84e-05 NA NA
5. P P0AE17 Anhydromuropeptide permease 7.00e-09 1.15e-07 NA NA
5. P B1LIU5 Multidrug resistance protein MdtH 1.42e-10 6.92e-06 NA NA
5. P Q2YIJ8 Glucose/galactose transporter 4.22e-15 1.54e-05 NA NA
5. P Q8FEA7 Lysophospholipid transporter LplT 4.06e-09 4.79e-05 NA NA
5. P Q68WQ3 ADP,ATP carrier protein 3 1.06e-07 7.68e-08 NA NA
5. P Q7UAH8 Multidrug resistance protein MdtK 4.86e-06 5.64e-04 NA NA
5. P P0CC84 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.48e-05 2.92e-04 NA NA
5. P Q01602 Transcription regulatory protein OpdE 5.97e-08 1.51e-04 NA NA
5. P Q8NN75 Betaine/ectoine transporter LcoP 4.96e-05 5.44e-03 NA NA
5. P Q31ZC0 Multidrug resistance protein MdtH 1.86e-10 3.38e-06 NA NA
5. P P02981 Tetracycline resistance protein, class C 1.26e-10 1.01e-05 NA NA
5. P Q47LF7 NADH-quinone oxidoreductase subunit N 1.05e-04 2.63e-02 NA NA
5. P Q7MKP8 Multidrug resistance protein NorM 5.29e-06 3.02e-04 NA NA
5. P Q73BB8 Probable multidrug resistance protein NorM 4.71e-06 2.05e-02 NA NA
5. P P25346 Glycerophosphoinositol transporter 1 1.82e-08 5.39e-04 NA NA
5. P A7NPD6 NADH-quinone oxidoreductase subunit N 2 3.86e-05 4.60e-02 NA NA
5. P P0CC46 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.27e-05 2.86e-03 NA NA
5. P A4W9W3 Dipeptide and tripeptide permease A 7.33e-06 7.65e-09 NA NA
5. P Q9HWR7 Probable sugar efflux transporter 2.34e-11 9.63e-06 NA NA
5. P C4ZS05 Multidrug resistance protein MdtH 6.87e-10 6.84e-06 NA NA
5. P Q32C86 Lysophospholipid transporter LplT 2.68e-08 5.58e-05 NA NA
5. P P0AFZ9 Trk system potassium uptake protein TrkH 6.47e-04 4.37e-04 NA NA
5. P B8NJG7 Leporins efflux protein lepC 4.74e-09 1.48e-02 NA NA
5. P B5F6M2 Multidrug resistance protein MdtK 4.32e-06 4.83e-04 NA NA
5. P Q9RUA0 NADH-quinone oxidoreductase subunit N 2.55e-05 1.09e-03 NA NA
5. P Q67IA9 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 5.14e-05 3.05e-04 NA NA
5. P A8AH15 Dipeptide and tripeptide permease A 6.09e-07 1.45e-07 NA NA
5. P Q34949 NADH-ubiquinone oxidoreductase chain 4 4.06e-05 3.94e-02 NA NA
5. P P44629 Probable 3-phenylpropionic acid transporter 7.40e-11 2.04e-09 NA NA
5. P Q95M75 Ammonium transporter Rh type B 2.23e-04 2.58e-02 NA NA
5. P P0CC62 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 6.36e-05 8.57e-04 NA NA
5. P A3Q537 NADH-quinone oxidoreductase subunit N 3.55e-05 2.27e-03 NA NA
5. P B5R8I5 Uncharacterized MFS-type transporter YcaD 3.00e-14 2.81e-05 NA NA
5. P Q118H6 NAD(P)H-quinone oxidoreductase chain 4 1 4.22e-05 7.19e-03 NA NA
5. P P21906 Glucose facilitated diffusion protein 1.17e-09 7.27e-03 NA NA
5. P B0Z4S5 NAD(P)H-quinone oxidoreductase chain 4, chloroplastic 2.68e-05 1.91e-02 NA NA
5. P Q28481 RH-like protein 7.29e-05 2.11e-02 NA NA
5. P P31141 Chloramphenicol resistance protein 1.25e-08 3.86e-04 NA NA
5. P P0CC47 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.38e-05 2.86e-03 NA NA
5. P Q99PL8 Thiamine transporter 2 4.92e-08 6.67e-06 NA NA
5. P P0CC55 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.82e-05 2.85e-04 NA NA
5. P F1PZV2 Major facilitator superfamily domain-containing protein 12 2.61e-09 5.69e-06 NA NA
5. P Q5RCQ5 UNC93-like protein MFSD11 2.55e-08 1.26e-04 NA NA
5. P P0CC41 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.36e-05 2.79e-04 NA NA
5. P P9WM62 Uncharacterized protein MT0111 1.33e-04 1.78e-02 NA NA
5. P Q5PN71 NADH-quinone oxidoreductase subunit N 6.06e-05 3.40e-05 NA NA
5. P A9MGZ7 Multidrug resistance protein MdtH 4.02e-10 9.58e-07 NA NA
5. P B5Z497 Multidrug resistance protein MdtK 3.84e-06 3.61e-04 NA NA
5. P C4ZYC7 Multidrug resistance protein MdtK 3.60e-06 4.04e-04 NA NA
5. P Q5GS15 NADH-quinone oxidoreductase subunit N 4.37e-05 1.49e-03 NA NA
5. P Q19V61 NAD(P)H-quinone oxidoreductase chain 4, chloroplastic 2.15e-05 1.36e-02 NA NA
5. P P39196 Lysophospholipid transporter LplT 5.65e-09 5.14e-05 NA NA
5. P E0T2N0 Multidrug transporter MdfA 5.39e-08 3.46e-02 NA NA
5. P Q3SJP4 NADH-quinone oxidoreductase subunit N 2.28e-05 2.25e-04 NA NA
5. P Q5E4Y6 Multidrug resistance protein NorM 3.08e-06 1.25e-03 NA NA
5. P A2BV95 NAD(P)H-quinone oxidoreductase subunit 2 3.53e-05 2.27e-03 NA NA
5. P Q5F4B8 Solute carrier family 46 member 3 5.73e-09 9.58e-07 NA NA
5. P Q22931 Folate-like transporter 3 1.23e-09 4.11e-05 NA NA
5. P B0JHK5 NAD(P)H-quinone oxidoreductase subunit 2 3.47e-05 3.46e-02 NA NA
5. P P0CD39 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.18e-05 6.88e-04 NA NA
5. P C1A8Y1 NADH-quinone oxidoreductase subunit N 4.49e-05 9.21e-03 NA NA
5. P B1XHP2 NAD(P)H-quinone oxidoreductase chain 4 1 1.83e-05 4.50e-03 NA NA
5. P A7MFC3 Multidrug resistance protein MdtK 6.40e-06 2.22e-03 NA NA
5. P P0CD40 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.85e-05 2.75e-03 NA NA
5. P Q3T4F3 NADH-ubiquinone oxidoreductase chain 2 1.97e-05 1.22e-02 NA NA
5. P Q8ZQ19 Multidrug resistance protein MdtH 2.52e-09 9.87e-06 NA NA
5. P Q7N1G0 Probable multidrug resistance protein NorM 3.36e-06 2.07e-06 NA NA
5. P Q492I8 NADH-quinone oxidoreductase subunit N 1.94e-04 9.10e-05 NA NA
5. P P37169 Probable lipid II flippase MurJ 3.49e-05 6.62e-03 NA NA
5. P A6L162 NADH-quinone oxidoreductase subunit N 6.73e-05 3.73e-03 NA NA
5. P B8FRJ7 NADH-quinone oxidoreductase subunit N 2.37e-05 8.57e-04 NA NA
5. P Q6BZW3 Protein BTN1 2.17e-05 1.15e-02 NA NA
5. P Q8Z8L4 Enterobactin exporter EntS 2.28e-12 1.47e-07 NA NA
5. P O82752 Protein DETOXIFICATION 49 9.33e-05 6.29e-03 NA NA
5. P Q9XQ96 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 5.23e-05 3.05e-04 NA NA
5. P Q8KWS7 Putative bacilysin exporter BacE 7.87e-11 1.78e-08 NA NA
5. P Q48457 Uncharacterized membrane protein in cps region 7.60e-06 6.09e-04 NA NA
5. P D5B5U5 Multidrug transporter MdfA 5.11e-08 7.97e-03 NA NA
5. P Q67IK8 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 2.51e-05 3.78e-04 NA NA
5. P P0CC35 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.34e-05 2.55e-04 NA NA
5. P P0CD03 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.21e-05 4.62e-04 NA NA
5. P B4EWN4 Multidrug resistance protein MdtK 4.59e-06 7.51e-04 NA NA
5. P C0PWD2 Dipeptide permease D 1.27e-08 1.36e-07 NA NA
5. P P0A5C2 Uncharacterized MFS-type transporter Mb0038c 4.30e-13 1.41e-03 NA NA
5. P Q6GAX7 Na(+)/H(+) antiporter subunit D1 3.56e-05 2.88e-04 NA NA
5. P A1WXV4 NADH-quinone oxidoreductase subunit N 1.54e-05 2.63e-04 NA NA
5. P P9WJX1 Uncharacterized MFS-type transporter Rv2456c 9.98e-10 8.10e-05 NA NA
5. P P33518 Cytochrome c oxidase polypeptide 1 7.66e-05 7.85e-04 NA NA
5. P A1JPA1 Multidrug resistance protein MdtK 1.91e-06 2.29e-03 NA NA
5. P A6ZTF2 Autophagy-related protein 22 1.61e-08 1.20e-03 NA NA
5. P Q4UL85 ADP,ATP carrier protein 3 1.02e-07 9.38e-08 NA NA
5. P Q328K4 Ascorbate-specific PTS system EIIC component 4.00e-04 1.11e-03 NA NA
5. P P9WLI3 Uncharacterized protein Rv2209 5.07e-07 3.06e-06 NA NA
5. P Q54IV7 Protein RFT1 homolog 1.40e-05 6.88e-04 NA NA
5. P C1DCB6 NADH-quinone oxidoreductase subunit N 3.41e-05 6.23e-04 NA NA
5. P P76628 Putative uncharacterized transporter YgaY 6.16e-10 3.95e-04 NA NA
5. P P58164 Multidrug resistance protein MdtK 3.75e-06 3.61e-04 NA NA
5. P Q2YWW7 Proton-coupled antiporter flippase LtaA 7.82e-10 1.47e-10 NA NA
5. P B4TTD0 Multidrug resistance protein MdtH 2.11e-09 7.73e-06 NA NA
5. P Q9KEJ2 Probable multidrug resistance protein NorM 1.42e-06 1.02e-02 NA NA
5. P Q9Z7H5 Probable lipid II flippase MurJ 9.14e-06 6.12e-05 NA NA
5. P P26400 Putative O-antigen transporter 6.63e-06 5.91e-03 NA NA
5. P P39755 Probable inorganic carbon transporter subunit DabB 7.53e-05 8.58e-05 NA NA
5. P Q8X534 Enterobactin exporter EntS 3.18e-12 3.86e-08 NA NA
5. P P13924 Tetracycline resistance protein 3.41e-09 1.24e-02 NA NA
5. P Q1DDD3 NADH-quinone oxidoreductase subunit N 8.16e-05 3.50e-03 NA NA
5. P P0CD12 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.02e-05 9.98e-04 NA NA
5. P B1XFX3 Multidrug resistance protein MdtK 3.69e-06 4.04e-04 NA NA
5. P A9QZC0 Multidrug resistance protein MdtK 4.60e-06 7.35e-04 NA NA
5. P O67342 NADH-quinone oxidoreductase subunit N 1 4.91e-05 4.56e-04 NA NA
5. P Q83S84 Dipeptide permease D 1.43e-08 1.25e-06 NA NA
5. P Q23444 Protein RFT1 homolog 1.20e-05 1.10e-02 NA NA
5. P Q1RGS8 ADP,ATP carrier protein 1 9.75e-09 6.56e-10 NA NA
5. P Q67IB2 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 7.86e-05 5.51e-04 NA NA
5. P Q9X813 Probable cytochrome c oxidase subunit 1-alpha 1.38e-04 2.73e-02 NA NA
5. P Q8FAJ3 Ascorbate-specific PTS system EIIC component 7.11e-04 2.27e-03 NA NA
5. P B5RHV8 Low affinity inorganic phosphate transporter 4 1.26e-09 3.23e-02 NA NA
5. P P0CD29 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.38e-05 1.21e-04 NA NA
5. P B2TTK5 Multidrug resistance protein MdtH 7.22e-11 6.84e-06 NA NA
5. P A5FX21 NADH-quinone oxidoreductase subunit N 1 2.68e-05 2.38e-02 NA NA
5. P Q9Z7U0 ADP,ATP carrier protein 2 1.99e-07 2.74e-10 NA NA
5. P P18943 Cytochrome c oxidase subunit 1 9.22e-05 7.04e-03 NA NA
5. P A1ABK4 Multidrug resistance protein MdtK 3.73e-06 6.36e-04 NA NA
5. P Q9Y115 UNC93-like protein 5.98e-08 2.83e-03 NA NA
5. P A4J650 NADH-quinone oxidoreductase subunit N 2.68e-05 5.27e-04 NA NA
5. P P0CC23 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.40e-05 1.35e-03 NA NA
5. P P9WJX7 Chloramphenicol efflux pump Rv0191 2.83e-14 1.55e-02 NA NA
5. P P36890 Tetracycline resistance protein 4.85e-09 1.89e-02 NA NA
5. P A4W978 Multidrug resistance protein MdtH 3.04e-10 9.40e-06 NA NA
5. P P94408 Uncharacterized transporter YclF 1.48e-06 1.83e-02 NA NA
5. P P42557 Reduced folate transporter 2.15e-09 2.03e-04 NA NA
5. P Q0T129 Lysophospholipid transporter LplT 1.37e-09 4.51e-05 NA NA
5. P P15729 Glucose transport protein 1.86e-11 3.64e-02 NA NA
5. P P0CC31 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.11e-05 1.81e-04 NA NA
5. P P37340 Multidrug resistance protein MdtK 3.75e-06 4.04e-04 NA NA
5. P P31435 Inner membrane symporter YicJ 2.34e-11 2.44e-05 NA NA
5. P O34238 Probable lipid II flippase MurJ 1.89e-05 2.82e-04 NA NA
5. P Q6YXR9 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 1.90e-05 4.22e-04 NA NA
5. P Q67IE2 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 2.40e-05 5.89e-04 NA NA
5. P F4I9E1 Protein NUCLEAR FUSION DEFECTIVE 4 5.69e-07 9.69e-03 NA NA
5. P B7M4S3 Enterobactin exporter EntS 2.65e-12 3.37e-08 NA NA
5. P Q6ZMD2 Protein spinster homolog 3 9.15e-10 2.34e-03 NA NA
5. P Q9ZCV6 Uncharacterized transporter RP603 3.50e-09 2.39e-03 NA NA
5. P A6NIM6 Solute carrier family 15 member 5 2.94e-08 2.02e-03 NA NA
5. P Q47421 Glycine betaine/proline/ectoine/pipecolic acid transporter OusA 4.07e-08 6.67e-06 NA NA
5. P B4EY98 Dipeptide and tripeptide permease A 1.77e-07 1.13e-04 NA NA
5. P C0Q5V7 Multidrug resistance protein MdtK 1.93e-06 3.86e-04 NA NA
5. P A1VM73 NADH-quinone oxidoreductase subunit N 1.76e-05 4.21e-05 NA NA
5. P P0CD16 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 6.05e-05 1.10e-03 NA NA
5. P Q99J27 Acetyl-coenzyme A transporter 1 5.19e-07 1.41e-02 NA NA
5. P Q8KX53 NAD(P)H-quinone oxidoreductase chain 4 2 3.43e-05 3.82e-02 NA NA
5. P Q5SJ79 Cytochrome c oxidase subunit 1 3.06e-05 1.63e-03 NA NA
5. P P0CC42 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 4.63e-05 4.46e-04 NA NA
5. P P31442 Multidrug resistance protein D 1.42e-12 1.66e-02 NA NA
5. P A0QWU7 Probable triacylglyceride transporter MSMEG_3069/MSMEI_2992 3.01e-05 3.30e-04 NA NA
5. P P0CD02 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.38e-05 4.62e-04 NA NA
5. P B5F4V3 Lysophospholipid transporter LplT 5.14e-10 8.39e-05 NA NA
5. P P0CC67 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.21e-05 2.20e-04 NA NA
5. P Q8Z1Z8 Protein TsgA 1.24e-09 1.22e-07 NA NA
5. P Q8XDJ5 Ascorbate-specific PTS system EIIC component 5.38e-04 2.58e-03 NA NA
5. P P72935 Putative ammonium transporter sll1017 5.33e-05 7.42e-03 NA NA
5. P Q80T22 Sodium-dependent glucose transporter 1 8.73e-11 2.53e-05 NA NA
5. P P52600 Probable multidrug resistance protein EmrY 1.11e-07 3.75e-02 NA NA
5. P B5XZE5 Dipeptide permease D 2.24e-08 1.92e-07 NA NA
5. P O34864 Putative transporter YoaB 3.30e-09 5.77e-11 NA NA
5. P C6V5H7 NADH-quinone oxidoreductase subunit N 3.29e-05 4.08e-04 NA NA
5. P Q503P5 Solute carrier family 49 member A3 1.26e-08 3.46e-06 NA NA
5. P P0CC53 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 9.49e-05 2.88e-04 NA NA
5. P Q49W88 Na(+)/H(+) antiporter subunit D1 3.30e-05 2.32e-03 NA NA
5. P A0A1D8PN12 Glycerophosphodiester transporter GIT2 2.34e-08 2.82e-02 NA NA
5. P Q1R7H6 Lysophospholipid transporter LplT 6.27e-09 5.02e-05 NA NA
5. P P0CD55 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.44e-05 4.08e-04 NA NA
5. P Q0TJ09 Multidrug resistance protein MdtH 6.31e-10 6.84e-06 NA NA
5. P Q5Z0K2 Probable cytochrome c oxidase subunit 1-beta 1.12e-04 5.16e-03 NA NA
5. P P77031 Inner membrane protein YqcE 8.54e-08 1.42e-12 NA NA
5. P P52067 Fosmidomycin resistance protein 4.20e-10 1.44e-04 NA NA
5. P Q9USW4 Uncharacterized protein C21B10.09 2.68e-08 3.20e-05 NA NA
5. P B5FIH8 Multidrug resistance protein MdtK 3.34e-06 3.86e-04 NA NA
5. P Q57484 Uncharacterized membrane protein HI_0867 4.48e-06 1.69e-04 NA NA
5. P Q6DBX0 Major facilitator superfamily domain-containing protein 6-like 6.02e-07 7.03e-04 NA NA
5. P P15584 NADH-ubiquinone oxidoreductase chain 5 2.23e-05 3.15e-03 NA NA
5. P P0C2U2 Di-/tripeptide transporter 4.00e-07 1.23e-03 NA NA
5. P A9F575 NADH-quinone oxidoreductase subunit N 2 2.52e-04 1.91e-03 NA NA
5. P Q6XL41 Ammonium transporter Rh type C 2.47e-04 9.21e-03 NA NA
5. P Q754Q7 Oligosaccharide translocation protein RFT1 2.94e-05 1.64e-03 NA NA
5. P Q2YA93 NADH-quinone oxidoreductase subunit N 1.22e-04 3.50e-03 NA NA
5. P B7UKN4 Enterobactin exporter EntS 2.95e-12 5.79e-08 NA NA
5. P Q8Z7L0 Multidrug resistance protein MdtH 6.09e-10 1.34e-05 NA NA
5. P B7L8H4 Enterobactin exporter EntS 3.63e-12 3.37e-08 NA NA
5. P A8A3W9 Lysophospholipid transporter LplT 9.25e-10 3.36e-05 NA NA
5. P P0CC88 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.68e-05 7.26e-04 NA NA
5. P Q49VH2 Putative antiporter subunit mnhD2 1.64e-05 2.65e-05 NA NA
5. P D9IA43 Cbb3-type cytochrome c oxidase subunit CcoN1 3.54e-05 5.04e-04 NA NA
5. P B2VKI2 Probable sugar efflux transporter 4.59e-12 7.54e-06 NA NA
5. P Q2FW71 Staphyloferrin A transporter 7.40e-09 7.13e-07 NA NA
5. P Q9JHZ2 Progressive ankylosis protein 2.30e-06 4.05e-02 NA NA
5. P M9M5N8 MFS-type efflux pump MMF1 4.50e-07 2.77e-03 NA NA
5. P P0CC34 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 3.30e-05 2.55e-04 NA NA
5. P Q8MA16 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 5.16e-05 1.44e-03 NA NA
5. P P0CC49 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.25e-04 3.74e-05 NA NA
5. P P0CD20 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 8.33e-05 7.73e-03 NA NA
5. P Q324V2 Enterobactin exporter EntS 3.26e-12 3.92e-08 NA NA
5. P F4HQ05 Protein DETOXIFICATION 8 4.10e-06 4.93e-02 NA NA
5. P P0CC50 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.02e-05 1.35e-04 NA NA
5. P Q5HIA2 Putative proline/betaine transporter 6.49e-09 1.43e-04 NA NA
5. P P58594 EPS I polysaccharide export inner membrane protein EpsE 1.09e-06 8.47e-04 NA NA
5. P B7NLV2 Enterobactin exporter EntS 3.42e-12 2.99e-08 NA NA
5. P A2BUC6 NAD(P)H-quinone oxidoreductase chain 4 4.60e-05 2.03e-02 NA NA
5. P P0CD47 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.67e-05 2.03e-04 NA NA
5. P Q10ZG8 NAD(P)H-quinone oxidoreductase chain 4 2 1.29e-04 9.15e-04 NA NA
5. P P60684 Na(+)/H(+) antiporter subunit D1 3.49e-05 2.88e-04 NA NA
5. P A9N592 NADH-quinone oxidoreductase subunit N 6.00e-05 3.24e-05 NA NA
5. P Q09037 Glucose transporter 1E 4.35e-08 6.80e-04 NA NA
5. P Q9RA45 Probable nitrate/nitrite antiporter NarK2 3.05e-08 4.19e-08 NA NA
5. P Q2JPJ1 NAD(P)H-quinone oxidoreductase chain 4 1 2.61e-05 3.33e-02 NA NA
5. P P44843 Trk system potassium uptake protein TrkH 1.62e-03 3.30e-02 NA NA
5. P P0CD53 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.79e-05 1.77e-04 NA NA
5. P O66545 Uncharacterized protein aq_155 6.53e-05 1.21e-02 NA NA
5. P P54487 Uncharacterized protein YqgE 1.13e-12 1.30e-15 NA NA
5. P B6I7M6 NADH-quinone oxidoreductase subunit N 6.05e-05 3.92e-05 NA NA
5. P Q0A788 NADH-quinone oxidoreductase subunit N 1.92e-05 1.35e-03 NA NA
5. P Q8NXT1 Putative antiporter subunit mnhD2 1.21e-05 2.50e-05 NA NA
5. P Q8CE94 Monocarboxylate transporter 13 6.29e-10 7.92e-06 NA NA
5. P Q67IA6 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic NA 2.98e-04 NA NA
5. P P53987 Monocarboxylate transporter 1 5.95e-09 2.06e-03 NA NA
5. P B5BKE4 Multidrug resistance protein MdtK 7.83e-06 4.46e-04 NA NA
5. P A1JRI8 Dipeptide and tripeptide permease B 4.02e-07 9.22e-07 NA NA
5. P P0CD42 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.57e-05 2.13e-03 NA NA
5. P Q2YWT7 Na(+)/H(+) antiporter subunit D1 2.92e-05 3.65e-04 NA NA
5. P L7WU90 Notoamide biosynthesis cluster protein O' 1.15e-06 1.04e-05 NA NA
5. P P0CC22 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 4.51e-05 1.03e-03 NA NA
5. P F1SVL2 F(420)H(2) dehydrogenase subunit N 2.20e-05 1.06e-02 NA NA
5. P Q3MCB9 NAD(P)H-quinone oxidoreductase chain 4 1 3.01e-05 1.44e-02 NA NA
5. P Q6NT16 MFS-type transporter SLC18B1 6.51e-11 7.43e-04 NA NA
5. P Q9SYQ1 Probable inorganic phosphate transporter 1-8 1.88e-09 1.89e-03 NA NA
5. P A7MHT8 NADH-quinone oxidoreductase subunit N 5.57e-05 1.94e-05 NA NA
5. P O70451 Monocarboxylate transporter 2 8.27e-10 4.31e-05 NA NA
5. P O05962 ADP,ATP carrier protein 5 7.51e-09 9.90e-08 NA NA
5. P B7MV43 Multidrug resistance protein MdtK 3.75e-06 4.04e-04 NA NA
5. P A4WT80 NADH-quinone oxidoreductase subunit N 1.55e-04 2.89e-03 NA NA
5. P Q8YFD7 Probable multidrug resistance protein NorM 1.13e-05 2.55e-02 NA NA
5. P A9N0Y8 Multidrug resistance protein MdtK 4.03e-06 4.83e-04 NA NA
5. P Q0APX7 NADH-quinone oxidoreductase subunit N 4.97e-05 1.32e-03 NA NA
5. P P44535 Probable sugar efflux transporter 1.88e-10 3.23e-04 NA NA
5. P Q46GY3 NAD(P)H-quinone oxidoreductase subunit 2 3.15e-05 8.22e-03 NA NA
5. P P0CD22 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.54e-05 7.73e-03 NA NA
5. P Q9LYK2 High affinity nitrate transporter 2.7 3.85e-07 2.55e-03 NA NA
5. P Q8VZ80 Polyol transporter 5 3.86e-07 2.38e-02 NA NA
5. P P23910 Putative transporter AraJ 1.41e-10 5.83e-04 NA NA
5. P Q68WD6 Uncharacterized transporter RT0591 2.30e-08 2.66e-04 NA NA
5. P P57648 Uncharacterized transporter BU588 7.72e-10 2.84e-02 NA NA
5. P A5GD16 NADH-quinone oxidoreductase subunit N 6.00e-05 3.58e-03 NA NA
5. P Q3Z4K2 Enterobactin exporter EntS 3.00e-12 3.37e-08 NA NA
5. P Q7AFA1 Multidrug resistance protein MdtH 5.79e-10 9.51e-06 NA NA
5. P Q9I0I9 NADH-quinone oxidoreductase subunit N 6.07e-05 1.01e-04 NA NA
5. P Q4ULJ8 ADP,ATP carrier protein 4 5.96e-07 7.89e-08 NA NA
5. P P9WJX3 Probable multidrug-efflux transporter Rv1634 1.16e-06 1.07e-04 NA NA
5. P B5R2Z7 NADH-quinone oxidoreductase subunit N 6.00e-05 3.24e-05 NA NA
5. P A4WCQ5 NADH-quinone oxidoreductase subunit N 3.77e-05 5.45e-05 NA NA
5. P Q589A5 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 2.39e-05 1.26e-04 NA NA
5. P Q45632 Maltose permease 3.66e-10 1.34e-07 NA NA
5. P A4QN56 Sodium-dependent glucose transporter 1 1.58e-09 2.47e-03 NA NA
5. P B0C4B4 NAD(P)H-quinone oxidoreductase chain 4 1.60e-04 3.75e-02 NA NA
5. P P0CC57 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.10e-05 5.57e-04 NA NA
5. P B7V6N7 Probable sugar efflux transporter 8.45e-12 1.24e-05 NA NA
5. P O32273 Teichuronic acid biosynthesis protein TuaB 5.00e-06 1.44e-06 NA NA
5. P P11551 L-fucose-proton symporter 8.21e-11 1.09e-04 NA NA
5. P Q8CIA9 Hippocampus abundant transcript-like protein 1 6.82e-11 4.30e-02 NA NA
5. P B1W4V1 NADH-quinone oxidoreductase subunit N 2 4.84e-04 5.64e-04 NA NA
5. P Q9TL07 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic 4.50e-05 2.82e-02 NA NA
5. P P77589 3-(3-hydroxy-phenyl)propionate transporter 1.91e-12 3.99e-04 NA NA
5. P P58369 Progressive ankylosis protein homolog 2.72e-05 6.42e-05 NA NA
5. P C9Y3M8 Dipeptide and tripeptide permease A 5.71e-06 6.81e-08 NA NA
5. P A7WZ79 Putative antiporter subunit mnhD2 1.19e-05 2.95e-05 NA NA
5. P P75683 Putative glycoside/cation symporter YagG 4.55e-11 1.44e-06 NA NA
5. P Q3YRZ4 NADH-quinone oxidoreductase subunit N 3.02e-05 6.03e-03 NA NA
5. P P41308 NADH-ubiquinone oxidoreductase chain 4 2.41e-04 2.15e-02 NA NA
5. P B7KEZ9 NAD(P)H-quinone oxidoreductase subunit 2 3.26e-05 1.81e-03 NA NA
5. P Q1RBN9 Probable sugar efflux transporter 3.27e-10 3.38e-06 NA NA
5. P Q49411 Uncharacterized protein MG294 1.73e-08 1.35e-15 NA NA
5. P P0CD41 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 2.38e-05 2.75e-03 NA NA
5. P O44827 Facilitated glucose transporter protein 1 5.61e-07 1.99e-02 NA NA
5. P P38206 Oligosaccharide translocation protein RFT1 2.14e-05 3.36e-02 NA NA
5. P Q5WT33 NADH-quinone oxidoreductase subunit N 8.80e-05 8.49e-05 NA NA
5. P A9RAH8 NADH-ubiquinone oxidoreductase chain 4 6.76e-05 1.26e-02 NA NA
5. P Q95JD4 Ammonium transporter Rh type B 8.95e-05 2.29e-02 NA NA
5. P O74921 Uncharacterized MFS-type transporter C757.11c 3.66e-10 6.30e-04 NA NA
5. P Q07376 Probable transporter MCH1 4.64e-10 1.05e-06 NA NA
5. P P33699 Succinoglycan biosynthesis transport protein ExoT 8.68e-06 3.99e-04 NA NA
5. P Q8CE47 Solute carrier family 49 member A3 3.82e-09 7.92e-06 NA NA
5. P Q2JUG6 NAD(P)H-quinone oxidoreductase subunit 2 4.72e-05 1.79e-03 NA NA
5. P Q6CZ44 Probable sugar efflux transporter 1.29e-10 3.09e-04 NA NA
5. P A7MG31 Multidrug resistance protein MdtH 3.23e-10 2.35e-06 NA NA
5. P A7HZW1 NADH-quinone oxidoreductase subunit N 2.76e-05 1.75e-04 NA NA
5. P P0CD30 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 5.67e-05 8.29e-04 NA NA
5. P Q57PL1 Multidrug resistance protein MdtK 3.40e-06 4.46e-04 NA NA
5. P B9KDV9 NADH-quinone oxidoreductase subunit N 2.84e-05 1.25e-02 NA NA
5. P Q8SUG0 ADP,ATP carrier protein 3 1.13e-07 2.38e-06 NA NA
5. P Q4QP52 Probable sugar efflux transporter 1.56e-09 1.79e-04 NA NA
5. P Q00758 Stage V sporulation protein B 1.71e-05 1.44e-05 NA NA
5. P P9WJX2 Probable multidrug-efflux transporter MT1670 1.19e-06 1.07e-04 NA NA
5. P Q9URX1 UNC93-like protein C922.05c 2.67e-07 4.55e-03 NA NA
5. P P0CD50 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 4.40e-05 2.13e-03 NA NA
5. P Q7VRW4 NADH-quinone oxidoreductase subunit N 6.78e-06 5.33e-04 NA NA
5. P Q111U1 NAD(P)H-quinone oxidoreductase subunit 2 4.69e-05 1.99e-03 NA NA
5. P Q4FU52 NADH-quinone oxidoreductase subunit N 8.36e-05 1.16e-03 NA NA
5. P P0CC71 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.10e-05 2.88e-04 NA NA
5. P Q7N568 Multidrug resistance protein MdtH 2.98e-10 1.92e-05 NA NA
5. P Q99W36 Putative proline/betaine transporter 7.64e-09 1.43e-04 NA NA
5. P Q01UN3 NADH-quinone oxidoreductase subunit N 2 8.18e-05 2.52e-04 NA NA
5. P Q8ZDZ8 Multidrug resistance protein MdtK 4.25e-06 7.35e-04 NA NA
5. P A4TIP9 Multidrug resistance protein MdtK 6.62e-06 7.35e-04 NA NA
5. P Q5A6K2 Autophagy-related protein 22 1.04e-09 1.34e-02 NA NA
5. P Q921Y4 Molybdate-anion transporter 2.36e-09 3.22e-10 NA NA
5. P Q3A815 NADH-quinone oxidoreductase subunit N 3.23e-04 2.88e-04 NA NA
5. P P0CC33 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.45e-05 3.12e-04 NA NA
5. P A1DI95 Autophagy-related protein 22-2 1.61e-06 1.61e-02 NA NA
5. P Q8CUL5 Probable multidrug resistance protein NorM 5.13e-06 8.84e-03 NA NA
5. P Q08299 Siderophore iron transporter ENB1 1.82e-08 3.36e-02 NA NA
5. P B7N9J8 Enterobactin exporter EntS 2.84e-12 3.37e-08 NA NA
5. P Q99191 Putative O-antigen transporter 4.80e-06 3.86e-02 NA NA
5. P P32369 Bile acid transporter 4.89e-07 4.46e-03 NA NA
5. P Q8BH31 Major facilitator superfamily domain-containing protein 8 4.23e-09 1.71e-02 NA NA
5. P B0SZ35 NADH-quinone oxidoreductase subunit N 7.32e-05 3.78e-04 NA NA
5. P Q0IHM1 Sodium-dependent lysophosphatidylcholine symporter 1 1.01e-10 8.32e-06 NA NA
5. P Q1RIL2 ADP,ATP carrier protein 3 3.72e-07 1.31e-07 NA NA
5. P C0Q842 Multidrug resistance protein MdtH 3.87e-10 8.63e-06 NA NA
5. P Q0THG4 Multidrug resistance protein MdtK 3.27e-06 4.04e-04 NA NA
5. P P38318 Uncharacterized membrane protein YBR220C 2.10e-07 5.10e-04 NA NA
5. P O67391 NADH-quinone oxidoreductase subunit N 2 6.03e-05 5.64e-05 NA NA
5. P Q89AI1 Probable lipid II flippase MurJ 1.19e-05 2.13e-03 NA NA
5. P Q9DA75 Sodium-dependent lysophosphatidylcholine symporter 1 9.55e-11 3.97e-03 NA NA
5. P P9WJX5 Uncharacterized MFS-type transporter Rv0849 3.61e-11 1.49e-08 NA NA
5. P Q87TN7 Trk system potassium uptake protein TrkH 1.71e-03 3.18e-06 NA NA
5. P P0CD23 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 3.29e-05 7.73e-03 NA NA
5. P B7NAU0 Multidrug resistance protein MdtH 5.26e-10 6.84e-06 NA NA
5. P Q71YH0 Probable multidrug resistance protein NorM 3.50e-06 3.99e-04 NA NA
5. P O31561 Uncharacterized MFS-type transporter YfiS 3.37e-11 3.61e-04 NA NA
5. P A6UZY0 Probable sugar efflux transporter 6.24e-12 7.21e-05 NA NA
5. P Q6FPE8 Oligosaccharide translocation protein RFT1 7.08e-05 2.96e-03 NA NA
5. P B0TH87 NADH-quinone oxidoreductase subunit N 4.66e-05 1.58e-04 NA NA
5. P Q32IX8 Enterobactin exporter EntS 3.30e-12 8.10e-08 NA NA
5. P Q8NA29 Sodium-dependent lysophosphatidylcholine symporter 1 1.38e-09 6.09e-04 NA NA
5. P Q31HE7 NADH-quinone oxidoreductase subunit N 3.67e-05 3.97e-03 NA NA
5. P A0A6L8Q027 Probable inorganic carbon transporter subunit DabB 1.43e-04 3.55e-06 NA NA
5. P D0KZ79 Probable inorganic carbon transporter subunit DabB1 1.04e-04 5.11e-03 NA NA
5. P Q0JCR9 Sugar transport protein MST1 1.35e-05 1.71e-02 NA NA
5. P Q9ZD67 ADP,ATP carrier protein 3 9.22e-08 5.87e-09 NA NA
5. P P0CC83 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 7.48e-05 1.15e-03 NA NA
5. P A7KAN0 Autophagy-related protein 22-2 2.07e-06 1.77e-03 NA NA
5. P A1A8M2 Enterobactin exporter EntS 3.54e-12 8.21e-08 NA NA
5. P A8A0L0 Multidrug resistance protein MdtK 5.77e-06 8.66e-04 NA NA
5. P Q9ZPJ8 Ammonium transporter 1 member 2 1.25e-04 4.09e-02 NA NA
5. P Q5HQL3 Na(+)/H(+) antiporter subunit D1 2.94e-05 3.32e-03 NA NA
5. P Q5XBB2 Macrolide efflux protein A 1.14e-12 5.27e-04 NA NA
5. P Q55179 Probable lipid II flippase MurJ 4.10e-06 5.33e-04 NA NA
5. P Q5HHD6 Na(+)/H(+) antiporter subunit D1 3.43e-05 3.26e-04 NA NA
5. P P75810 Inner membrane protein YbjJ 3.45e-09 1.35e-09 NA NA
5. P Q5A6N8 Oligosaccharide translocation protein RFT1 2.02e-05 5.26e-05 NA NA
5. P Q3Z218 Multidrug resistance protein MdtK 3.76e-06 8.20e-04 NA NA
5. P P0CC72 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 6.91e-05 4.10e-03 NA NA
5. P Q8K942 Protein TsgA homolog 3.56e-10 5.13e-08 NA NA
5. P B5BBQ8 Uncharacterized MFS-type transporter YcaD 2.98e-14 5.76e-06 NA NA
5. P B5RAN4 Multidrug resistance protein MdtK 4.95e-06 4.27e-04 NA NA
5. P P0CC73 NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic 5.38e-05 4.10e-03 NA NA
5. P Q9LPV5 High affinity nitrate transporter 2.5 2.64e-08 4.37e-03 NA NA
5. P O70461 Monocarboxylate transporter 3 3.51e-08 4.13e-02 NA NA
5. P Q46378 Probable lipid II flippase MurJ 1.64e-05 5.39e-04 NA NA
5. P Q56229 NADH-quinone oxidoreductase subunit 14 2.30e-04 2.34e-03 NA NA
5. P Q7NP39 NAD(P)H-quinone oxidoreductase chain 4 1.74e-05 9.89e-03 NA NA
5. P Q0WEG0 Dipeptide and tripeptide permease A 4.00e-07 1.59e-08 NA NA
5. P P0CC70 NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic 2.31e-05 2.88e-04 NA NA
5. P A8Z056 Na(+)/H(+) antiporter subunit D1 3.20e-05 2.33e-04 NA NA
5. P P9WKX8 Uncharacterized protein MT3732 5.51e-05 1.55e-02 NA NA
5. P Q49WE5 Proton-coupled antiporter flippase LtaA 1.02e-09 1.77e-12 NA NA
5. P O31686 Sporulation protein YkvU 6.88e-06 1.43e-02 NA NA
5. P C0Q0E8 Protein TsgA 1.41e-09 1.18e-07 NA NA
6. F Q4WF45 Major facilitator superfamily multidrug transporter mdr3 1.26e-06 NA NA 0.4626
6. F A0A3G9H2R5 MFS-type transporter cdmB 4.90e-07 NA NA 0.629
6. F Q5R5T8 Synaptic vesicle 2-related protein 1.10e-09 NA NA 0.5447
6. F P07921 Lactose permease 3.72e-10 NA NA 0.5586
6. F C6DBD0 Putative multidrug resistance protein MdtD 1.83e-09 NA NA 0.5821
6. F A0LNN5 L-lactate transporter 4.75e-09 NA NA 0.6229
6. F Q1JP63 Synaptic vesicle 2-related protein 8.37e-10 NA NA 0.5514
6. F S0AU91 MFS transporter fsdG 7.08e-09 NA NA 0.479
6. F M2YI75 Efflux pump dotC 6.93e-09 NA NA 0.5256
6. F A7FG15 Putative multidrug resistance protein MdtD 5.42e-06 NA NA 0.5524
6. F Q83QZ0 Putative multidrug resistance protein MdtD 1.56e-10 NA NA 0.6012
6. F A0A4Q4NJ90 MFS-type transporter MFS19 6.10e-09 NA NA 0.5236
6. F P64962 Uncharacterized protein Mb2288 2.77e-10 NA NA 0.5464
6. F Q0P4G6 Solute carrier family 2, facilitated glucose transporter member 10 9.64e-08 NA NA 0.5155
6. F Q5BIZ0 Major facilitator superfamily domain-containing protein 4A 1.93e-08 NA NA 0.5217
6. F M2YMU2 MFS-type transporter MYCFIDRAFT_190113 3.85e-09 NA NA 0.5734
6. F Q5R4L9 Synaptic vesicle glycoprotein 2A 6.22e-05 NA NA 0.5325
6. F P0AA79 Hexuronate transporter 4.35e-09 NA NA 0.4954
6. F B7UTB5 Putative multidrug resistance protein MdtD 1.47e-10 NA NA 0.574
6. F S0EEY7 Efflux pump FUS6 6.54e-09 NA NA 0.5106
6. F P9WEZ6 MFS-type transporter oryC 7.60e-09 NA NA 0.5683
6. F Q6F5E3 Aspyridones efflux protein 3.14e-07 NA NA 0.557
6. F P20303 Solute carrier family 2, facilitated glucose transporter member 1 2.15e-08 NA NA 0.5019
6. F A0A3G1DJE2 MFS transporter L2 3.58e-09 NA NA 0.5829
6. F P0AA81 Probable galactarate transporter 1.77e-08 NA NA 0.5346
6. F B8MYS7 MFS glucose transporter mfs1 2.68e-13 NA NA 0.5093
6. F Q68WQ5 Putative transporter AmpG 1 1.43e-09 NA NA 0.5316
6. F Q1R9Z4 Putative multidrug resistance protein MdtD 2.47e-10 NA NA 0.591
6. F B8NIM7 Probable quinate permease 5.41e-09 NA NA 0.5273
6. F Q2TXF2 MFS-type transporter oryF 5.20e-09 NA NA 0.5554
6. F P0DPR5 Fosfomycin resistance protein AbaF 9.36e-10 NA NA 0.5923
6. F B7M460 Putative multidrug resistance protein MdtD 2.56e-10 NA NA 0.5034
6. F A1CPX0 Probable quinate permease 3.63e-09 NA NA 0.5581
6. F D0ZXQ3 Methyl viologen resistance protein SmvA 9.65e-10 NA NA 0.4426
6. F B6HNK5 Major facilitator-type transporter sorT 2.72e-09 NA NA 0.5075
6. F P71369 Putative metabolite transport protein HI_1104 0.00e+00 NA NA 0.619
6. F Q05B21 Vesicular glutamate transporter 1 9.78e-08 NA NA 0.5651
6. F B5BF67 Putative multidrug resistance protein MdtD 1.83e-09 NA NA 0.5632
6. F P42237 Probable glucarate transporter 1.97e-08 NA NA 0.4597
6. F P58352 Solute carrier family 2, facilitated glucose transporter member 3 2.01e-08 NA NA 0.4576
6. F P9WG88 Multidrug resistance protein B homolog 6.19e-11 NA NA 0.5375
6. F A2Y8U6 SPX domain-containing membrane protein OsI_21475 1.61e-07 NA NA 0.5276
6. F B2CPI6 Low affinity inorganic phosphate transporter 4 1.73e-09 NA NA 0.5328
6. F Q180E3 Riboflavin transporter RibZ 2.04e-05 NA NA 0.5851
6. F A0A1L9UQW4 Efflux pump bfoC 2.01e-07 NA NA 0.5642
6. F A5ABG1 MFS-type transporter pynF 3.59e-08 NA NA 0.5966
6. F Q8TFD3 Efflux pump dotC 2.17e-08 NA NA 0.5387
6. F Q668C4 Putative multidrug resistance protein MdtD 6.07e-06 NA NA 0.5534
6. F B2KWH6 MFS siderochrome iron transporter 1 1.60e-06 NA NA 0.4741
6. F P58351 Solute carrier family 2, facilitated glucose transporter member 2 7.33e-08 NA NA 0.5128
6. F Q90592 Solute carrier family 2, facilitated glucose transporter member 2 7.74e-09 NA NA 0.464
6. F Q5R8G5 Major facilitator superfamily domain-containing protein 1 2.38e-09 NA NA 0.5517
6. F Q6GNV7 Solute carrier family 49 member 4 homolog 2.07e-08 NA NA 0.5556
6. F S0DPY2 Efflux pump apf11 5.44e-09 NA NA 0.5328
6. F P94422 Uncharacterized MFS-type transporter YcnB 2.74e-07 NA NA 0.4915
6. F P34698 Uncharacterized MFS-type transporter SACE_5813 3.06e-09 NA NA 0.5892
6. F Q0TG13 Putative multidrug resistance protein MdtD 1.43e-10 NA NA 0.5852
6. F B6HYS2 Putative multidrug resistance protein MdtD 1.63e-10 NA NA 0.6015
6. F Q00357 Putative HC-toxin efflux carrier TOXA 5.55e-10 NA NA 0.5394
6. F Q2W8K5 Magnetosome protein MamZ 1.62e-08 NA NA 0.6055
6. F A0A140JWS3 MFS-type transporter ptmT 2.16e-07 NA NA 0.571
6. F K0E3U9 Major facilitator-type transporter ecdD 3.41e-08 NA NA 0.5263
6. F Q4WHE1 MFS siderochrome iron transporter C 2.09e-09 NA NA 0.5979
6. F P39886 Tetracenomycin C resistance and export protein 1.67e-08 NA NA 0.5434
6. F A4TMR4 Putative multidrug resistance protein MdtD 5.53e-06 NA NA 0.511
6. F P13865 Probable transport protein 1.74e-08 NA NA 0.48
6. F C8VJW1 Major facilitator-type transporter hxnP 2.38e-08 NA NA 0.5201
6. F F2SH39 MFS-type efflux pump MFS1 1.01e-07 NA NA 0.5711
6. F Q9I6Q3 4-hydroxybenzoate transporter PcaK 7.22e-11 NA NA 0.6021
6. F Q0K843 Probable sulfoacetate transporter SauU 4.42e-10 NA NA 0.5997
6. F G3XMC9 Efflux pump azaK 6.01e-08 NA NA 0.4641
6. F P70786 Putative tartrate transporter 6.59e-10 NA NA 0.545
6. F Q2UPC1 MFS efflux transporter aclA 8.36e-08 NA NA 0.5526
6. F Q6C8F0 Citrate exporter 1 1.06e-08 NA NA 0.5951
6. F P13355 Solute carrier family 2, facilitated glucose transporter member 1 5.83e-09 NA NA 0.5045
6. F B8N0F1 MFS transporter asaE 6.13e-09 NA NA 0.6058
6. F A9ZSY2 Facilitated trehalose transporter Tret1 7.56e-07 NA NA 0.5286
6. F Q5XGK0 Protein spinster homolog 1 2.24e-09 NA NA 0.5347
6. F B1JSD2 Putative multidrug resistance protein MdtD 5.46e-06 NA NA 0.5347
6. F P15685 Maltose permease MAL61 1.86e-09 NA NA 0.5432
6. F A0A1L9WQV4 Acurin A biosynthesis cluster MFS-type transporter 3.22e-10 NA NA 0.5618
6. F A0A1V6PBC8 MFS-type transporter calB 4.26e-07 NA NA 0.5877
6. F B0JZE1 Protein spinster homolog 2 8.69e-09 NA NA 0.5884
6. F Q05181 Phthalate transporter 6.40e-09 NA NA 0.558
6. F Q7CJL1 Putative multidrug resistance protein MdtD 6.48e-06 NA NA 0.5181
6. F Q51955 4-hydroxybenzoate transporter PcaK 1.18e-10 NA NA 0.5906
6. F Q6FJH4 Multidrug transporter DTR1 8.81e-09 NA NA 0.5144
6. F A1D2R3 Probable quinate permease 4.96e-09 NA NA 0.5165
6. F S0ECK8 Fujikurins efflux protein FFUJ_12242 3.70e-09 NA NA 0.5957
6. F Q0D135 Probable quinate permease 1.86e-08 NA NA 0.5387
6. F O33057 Uncharacterized protein ML2143 2.76e-09 NA NA 0.5195
6. F A7MHI9 Putative multidrug resistance protein MdtD 4.28e-07 NA NA 0.6027
6. F C5H884 Efflux pump radE 4.70e-08 NA NA 0.5058
6. F L7X3H5 Dehydrocurvularin exporter 9.68e-10 NA NA 0.5297
6. F A0A2G5ID46 Cercosporin MFS transporter CTB4 3.30e-10 NA NA 0.5858
6. F P9WLG2 Uncharacterized protein MT2327 3.42e-10 NA NA 0.5453
6. F B7MWZ0 Putative multidrug resistance protein MdtD 1.70e-10 NA NA 0.5711
6. F Q8FG02 Putative multidrug resistance protein MdtD 1.41e-10 NA NA 0.6053
6. F P42670 Puromycin resistance protein pur8 9.38e-06 NA NA 0.498
6. F Q6FRT6 Multidrug transporter FLR1 2.34e-08 NA NA 0.5082
6. F P37489 Uncharacterized transporter YybO 6.01e-09 NA NA 0.5748
6. F Q1ERH8 Citrinin biosynthesis cluster MFS transporter ctnC 1.89e-08 NA NA 0.5015
6. F P42205 Probable glucarate transporter 5.01e-07 NA NA 0.5083
6. F Q9XSC2 Solute carrier family 2, facilitated glucose transporter member 3 1.93e-08 NA NA 0.4917
6. F A9QZU7 Putative multidrug resistance protein MdtD 1.12e-06 NA NA 0.5347
6. F P46896 Solute carrier family 2, facilitated glucose transporter member 1 3.41e-08 NA NA 0.4883
6. F O34502 Uncharacterized MFS-type transporter YvkA 3.22e-09 NA NA 0.585
6. F A4TMJ0 Sialic acid transporter NanT 2.84e-07 NA NA 0.5217
6. F P07661 Citrate-proton symporter 2.96e-08 NA NA 0.4215
6. F W3X9K4 MFS transporter PfmaC 2.23e-08 NA NA 0.4909
6. F E5AE35 Phomenoic acid biosynthesis cluster MFS-type transporter 1.82e-07 NA NA 0.5429
6. F Q9PJJ8 Probable hexose phosphate transport protein 3.48e-08 NA NA 0.5702
6. F P0AEP2 Galactose-proton symporter 3.77e-08 NA NA 0.5324
6. F A2QBE9 Efflux pump aunC 3.45e-06 NA NA 0.5917
6. F Q501I9 Solute carrier family 49 member 4 homolog 2.31e-08 NA NA 0.5628
6. F Q0P5M9 Major facilitator superfamily domain-containing protein 10 2.90e-08 NA NA 0.6018
6. F Q9N1F2 Feline leukemia virus subgroup C receptor-related protein 1 2.06e-07 NA NA 0.5914
6. F B2K942 Sialic acid transporter NanT 3.60e-07 NA NA 0.5406
6. F E9R876 MFS gliotoxin efflux transporter gliA 1.81e-06 NA NA 0.4676
6. F Q2UAZ7 MFS-type transporter ppsE 5.73e-09 NA NA 0.5211
6. F A0A089FNE5 MFS transporter prlL 4.93e-08 NA NA 0.5107
6. F Q4H425 MFS-type transporter EF102 7.14e-08 NA NA 0.5714
6. F B2KWH5 MFS siderochrome iron transporter 1 7.77e-06 NA NA 0.5059
6. F P0AA77 D-galactonate transporter 1.66e-08 NA NA 0.5429
6. F A0A0N7D7C9 Dehydrocurvularin exporter 1.30e-09 NA NA 0.4985
6. F P27669 Membrane sensor protein UhpC 2.37e-10 NA NA 0.6168
6. F Q58CV5 Glucose-6-phosphate exchanger SLC37A2 6.94e-09 NA NA 0.4837
6. F Q92253 Probable glucose transporter rco-3 4.64e-08 NA NA 0.4585
6. F O84548 Probable hexose phosphate transport protein 2.33e-09 NA NA 0.5837
6. F P46105 Probable actinorhodin transporter 3.42e-07 NA NA 0.5095
6. F Q6FNQ2 Multidrug transporter AQR1 3.69e-08 NA NA 0.4802
6. F B5R0C2 Putative multidrug resistance protein MdtD 2.07e-09 NA NA 0.5578
6. F A0A0A2IBP6 MFS-type transporter cnsO 1.31e-08 NA NA 0.5342
6. F A0A411KUX1 MFS-type transporter ucsD 5.36e-09 NA NA 0.5785
6. F A0A443HJZ5 MFS-type transporter VdtG 6.03e-06 NA NA 0.5041
6. F B2K9M2 Putative multidrug resistance protein MdtD 4.76e-06 NA NA 0.5339
6. F Q88FY6 Putative metabolite transport protein NicT 1.31e-08 NA NA 0.4935
6. F A0A411PQP0 Agnestins efflux protein AgnL12 1.27e-11 NA NA 0.6127
6. F G3XSI4 Efflux pump aunC 1.16e-07 NA NA 0.5891
6. F A0A089FRP6 MFS transporter prlG 7.81e-09 NA NA 0.5854
6. F A0A0D1DYJ6 MFS-type efflux pump MMF1 1.20e-07 NA NA 0.5101
6. F A0A0C1C354 MFS-type transporter opaD 5.78e-07 NA NA 0.6003
6. F B2TYA6 Putative multidrug resistance protein MdtD 1.53e-10 NA NA 0.5811
6. F P37594 Methyl viologen resistance protein SmvA 8.53e-10 NA NA 0.447
6. F P9WG90 Multidrug resistance protein Stp 6.51e-09 NA NA 0.5289
6. F B5YUD5 Putative multidrug resistance protein MdtD 1.67e-10 NA NA 0.5844
6. F A0A0E4AZP4 MFS transporter fsa7 1.16e-08 NA NA 0.5496
6. F Q5J316 Solute carrier family 2, facilitated glucose transporter member 12 3.18e-05 NA NA 0.5095
6. F A0A161CLJ6 Citrinin biosynthesis cluster MFS transporter mrr1 5.78e-11 NA NA 0.52
6. F A0ST42 Cercosporin MFS transporter CTB4 2.71e-10 NA NA 0.502
6. F O74713 High-affinity glucose transporter 7.58e-11 NA NA 0.5408
6. F Q5RB09 Solute carrier family 2, facilitated glucose transporter member 9 1.04e-07 NA NA 0.4905
6. F A0A0U2UXG3 Itaconate transport protein 9.49e-09 NA NA 0.4991
6. F D7PI13 Probable efflux pump gsfJ 1.77e-07 NA NA 0.5726
6. F Q29397 Synaptic vesicle glycoprotein 2A 1.50e-05 NA NA 0.5034
6. F Q9ZD69 Putative transporter AmpG 1 8.90e-09 NA NA 0.5016
6. F Q5AUY2 MFS-type transporter dbaD 1.54e-08 NA NA 0.5779
6. F Q4WC50 Major facilitator superfamily transporter mfsA 4.42e-08 NA NA 0.519
6. F P94493 Putative metabolite transport protein YncC 2.04e-09 NA NA 0.5586
6. F Q57VW6 Riboflavin transporter RibJ 6.15e-09 NA NA 0.5417
6. F Q89AA9 Uncharacterized transporter bbp_411 2.21e-10 NA NA 0.6512
6. F P79365 Solute carrier family 2, facilitated glucose transporter member 1 3.44e-08 NA NA 0.4981
6. F I1RF56 Rubrofusarin-specific efflux pump aurT 6.36e-08 NA NA 0.579
6. F A0A0M9EQT6 Efflux pump DEP3 2.55e-06 NA NA 0.5288
6. F O31762 Bacillibactin exporter 4.31e-09 NA NA 0.5876
6. F Q6INC8 Vesicular glutamate transporter 1 5.72e-09 NA NA 0.5498
6. F A0A2L0P0L8 MFS-type transporter TwmF 6.74e-08 NA NA 0.5853
6. F A0A166Z003 MFS-type transporter ppzB 6.25e-08 NA NA 0.5083
6. F P81721 Vesicular acetylcholine transporter 1.63e-09 NA NA 0.5207
6. F P37948 Glycerol-3-phosphate transporter 1.49e-08 NA NA 0.5062
6. F A1ACT2 Putative multidrug resistance protein MdtD 4.96e-06 NA NA 0.5949
6. F E8ZB61 Gallate transporter 8.25e-12 NA NA 0.5123
6. F Q8K999 Uncharacterized transporter BUsg_450 2.15e-12 NA NA 0.6106
6. F Q91498 Vesicular acetylcholine transporter 3.30e-09 NA NA 0.5503
6. F Q668K2 Sialic acid transporter NanT 2.87e-07 NA NA 0.5193
6. F Q27963 Synaptic vesicular amine transporter 1.64e-08 NA NA 0.4821
6. F Q8K902 Uncharacterized transporter BUsg_567 8.46e-13 NA NA 0.5754
6. F Q79VC4 Ectoine/proline transporter ProP 1.76e-08 NA NA 0.5505
6. F P57538 Uncharacterized transporter BU466 1.84e-12 NA NA 0.5922
6. F P44610 Putative metabolite transport protein HI_0281 1.13e-09 NA NA 0.5457
6. F P32071 Cycloheximide resistance protein 1.08e-08 NA NA 0.5397
6. F V6F4W4 Magnetosome protein MamZ 2.36e-08 NA NA 0.6248
6. F Q32LF0 Sodium-dependent phosphate transport protein 3 1.20e-08 NA NA 0.4969
6. F W7MLD3 Efflux pump FUS6 5.87e-09 NA NA 0.5062
6. F Q9ES43 Feline leukemia virus subgroup C receptor-related protein 1 2.47e-07 NA NA 0.5373
6. F P22152 Nitrate transporter 2.47e-05 NA NA 0.4399
6. F P9WG84 Uncharacterized MFS-type transporter MT1926 4.64e-08 NA NA 0.5943
6. F A8WGF7 Protein spinster homolog 1 4.73e-09 NA NA 0.5291
6. F A0A345BJP9 MFS-type transporter clz19 6.22e-08 NA NA 0.4707
6. F Q39608 Nitrate transporter 2.1 2.90e-07 NA NA 0.537
6. F Q01441 Membrane transporter D2 3.96e-07 NA NA 0.4324
6. F Q2TXG1 MFS-type transporter oryN 7.71e-09 NA NA 0.499
6. F A4WCC3 Putative multidrug resistance protein MdtD 4.91e-06 NA NA 0.4861
6. F Q870L2 Siderophore iron transporter mirB 6.85e-06 NA NA 0.4639
6. F Q5RCN7 Major facilitator superfamily domain-containing protein 4A 1.52e-08 NA NA 0.5822
6. F Q7RVX9 Repressible high-affinity phosphate permease 7.61e-09 NA NA 0.5365