Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54722.1
JCVISYN3A_0327
Chromosome segregation protein A.
M. mycoides homolog: Q6MTL8.
TIGRfam Classification: 2=Generic.
Category: Essential.
Statistics
Total GO Annotation: 21
Unique PROST Go: 14
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 126
Unique PROST Homologs: 8
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 1
Literature
Danchin and Fang [1]: segregation and condensation protein A|SMC (JCVISYN3A_0415) colocalizes with its interacting partners, ScpA and ScpB (JCVISYN3A_0328), and the specific localization of SMC depends on both Scp proteins, showing that all three components of the SMC complex are required for proper localization; dimeric ScpB stabilized the binding of ScpA to the SMC head domains;
Yang and Tsui [2]: Segregation and condensation protein A
Antczak et al. [3]: scpA
Zhang et al. [4]: GO:0051177|meiotic sister chromatid cohesion
Bianchi et al. [5]: "scpA, chromosome segregation protein"
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q3JZU0
(Segregation and condensation protein A) with a FATCAT P-Value: 1.44e-15 and RMSD of 3.16 angstrom. The sequence alignment identity is 28.1%.
Structural alignment shown in left. Query protein AVX54722.1 colored as red in alignment, homolog Q3JZU0 colored as blue.
Query protein AVX54722.1 is also shown in right top, homolog Q3JZU0 showed in right bottom. They are colored based on secondary structures.
AVX54722.1 MKHWQELTIDQFSGPIELLWLMIKEK-KLDIIELSLIEIVDQYLAYIKQNQQLDIEIASEYLIIASQLIELKSRHLLFKDQQVDQEQVVDYD---DLVYQ 96 Q3JZU0 ----MDIKLKDFEGPLDLL-LHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQLMLIKSRNLLPK--VVESNPIED-DPEMELLSQ 92 AVX54722.1 ISQYNQIKEISDRLFN-AQE-A-YLQTFSKKRSKQNFKKDLVFENPDPLIDLND---LDLDKLTEIFYSVITNSNAFKYQADFDLETEIYQTLT-TPSLT 189 Q3JZU0 LEEYRRFKVLSEELANQHQERAKY---FSKP------KQEVIFE--DAIL-LHDKSVMDL-FLT--FSQMMSQKQ--K-----ELSN--SQTVIEKEDYR 168 AVX54722.1 VHEVILDVVNKITSQKLKEWKLEELLEILELNLKN-FVVIFLAVLDLVR-YQILVIDSIDDQI-YISLRKEVIENENLIAQQLEVIANESTI 278 Q3JZU0 IEDMMI-VIERHFNLK-KKTTLQEVFA--DCQTKSEMITLFLAMLELIKLHQI-TVEQ-DSNFSQVILRKE--EK----------------- 235
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006260 | DNA replication |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0007049 | cell cycle |
| 1. PBF | GO:0051301 | cell division |
| 1. PBF | GO:0007059 | chromosome segregation |
| 3. BF | GO:0004146 | dihydrofolate reductase activity |
| 3. BF | GO:0046654 | tetrahydrofolate biosynthetic process |
| 5. P | GO:0033553 | rDNA heterochromatin |
| 5. P | GO:0051382 | kinetochore assembly |
| 5. P | GO:0031511 | Mis6-Sim4 complex |
| 5. P | GO:0000940 | outer kinetochore |
| 5. P | GO:0000939 | inner kinetochore |
| 5. P | GO:0072686 | mitotic spindle |
| 5. P | GO:0031110 | regulation of microtubule polymerization or depolymerization |
| 5. P | GO:0099115 | chromosome, subtelomeric region |
| 5. P | GO:0030915 | Smc5-Smc6 complex |
| 5. P | GO:0000278 | mitotic cell cycle |
| 5. P | GO:0000779 | condensed chromosome, centromeric region |
| 5. P | GO:0008017 | microtubule binding |
| 5. P | GO:0005876 | spindle microtubule |
| 5. P | GO:0061638 | CENP-A containing chromatin |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0007059 | chromosome segregation |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | C0ZC76 | Segregation and condensation protein A | 1.14e-10 | 9.72e-35 | 4.71e-12 | 0.6506 |
| 1. PBF | A4W3D2 | Segregation and condensation protein A | 7.71e-12 | 7.67e-33 | 2.42e-15 | 0.5403 |
| 1. PBF | Q98R95 | Segregation and condensation protein A | 1.88e-12 | 1.90e-30 | 1.56e-16 | 0.5095 |
| 1. PBF | Q812U6 | Segregation and condensation protein A | 1.38e-11 | 2.48e-30 | 5.57e-10 | 0.687 |
| 1. PBF | Q49XU3 | Segregation and condensation protein A | 1.66e-10 | 1.03e-36 | 1.14e-12 | 0.4953 |
| 1. PBF | Q8XJF4 | Segregation and condensation protein A | 6.69e-11 | 4.34e-36 | 1.91e-12 | 0.5175 |
| 1. PBF | Q3JZU0 | Segregation and condensation protein A | 1.44e-15 | 5.13e-32 | 1.55e-15 | 0.743 |
| 1. PBF | Q72PL7 | Segregation and condensation protein A | 1.74e-09 | 4.51e-32 | 7.36e-11 | 0.4628 |
| 1. PBF | B8CW05 | Segregation and condensation protein A | 1.29e-08 | 2.55e-34 | 3.69e-15 | 0.4401 |
| 1. PBF | Q6KHG7 | Segregation and condensation protein A | 2.51e-12 | 1.05e-40 | 4.80e-11 | 0.5508 |
| 1. PBF | C1CTA6 | Segregation and condensation protein A | 2.44e-11 | 2.36e-35 | 3.71e-15 | 0.5446 |
| 1. PBF | B9DNT5 | Segregation and condensation protein A | 3.36e-11 | 6.39e-35 | 6.86e-15 | 0.5212 |
| 1. PBF | C1C9E2 | Segregation and condensation protein A | 1.73e-11 | 3.76e-35 | 7.39e-15 | 0.5477 |
| 1. PBF | Q894L2 | Segregation and condensation protein A | 1.17e-11 | 3.44e-48 | 1.70e-11 | 0.5351 |
| 1. PBF | Q81MH0 | Segregation and condensation protein A | 3.29e-11 | 9.08e-32 | 7.86e-11 | 0.4805 |
| 1. PBF | Q97NX5 | Segregation and condensation protein A | 2.53e-11 | 6.25e-35 | 2.32e-15 | 0.5421 |
| 1. PBF | Q83CP8 | Segregation and condensation protein A | 6.18e-08 | 2.20e-16 | 9.27e-11 | 0.39 |
| 1. PBF | B4U4Q6 | Segregation and condensation protein A | 8.30e-13 | 1.37e-29 | 2.75e-16 | 0.5717 |
| 1. PBF | Q5HP55 | Segregation and condensation protein A | 2.71e-08 | 5.24e-35 | 1.01e-11 | 0.5276 |
| 1. PBF | Q9KCL1 | Segregation and condensation protein A | 2.31e-10 | 1.35e-44 | 4.46e-11 | 0.4784 |
| 1. PBF | C1CGA0 | Segregation and condensation protein A | 4.86e-12 | 3.76e-35 | 7.39e-15 | 0.6184 |
| 1. PBF | Q7ZAN1 | Segregation and condensation protein A | 2.16e-10 | 4.51e-32 | 7.36e-11 | 0.5737 |
| 1. PBF | A4VX28 | Segregation and condensation protein A | 1.40e-11 | 7.67e-33 | 2.42e-15 | 0.5349 |
| 1. PBF | Q6G969 | Segregation and condensation protein A | 1.28e-10 | 2.25e-33 | 3.70e-12 | 0.5191 |
| 1. PBF | Q9PQE6 | Segregation and condensation protein A | 7.29e-09 | 2.67e-34 | 1.40e-10 | 0.3749 |
| 1. PBF | Q88VY7 | Segregation and condensation protein A | 2.61e-11 | 5.80e-33 | 1.65e-09 | 0.4206 |
| 1. PBF | Q8EX12 | Segregation and condensation protein A | 7.02e-11 | 6.79e-25 | 4.86e-12 | 0.4211 |
| 1. PBF | C0M7Q5 | Segregation and condensation protein A | 5.54e-13 | 8.22e-30 | 7.17e-17 | 0.5709 |
| 1. PBF | Q635M2 | Segregation and condensation protein A | 1.18e-11 | 3.42e-31 | 1.01e-10 | 0.4847 |
| 1. PBF | B5E1Y8 | Segregation and condensation protein A | 7.93e-12 | 1.98e-35 | 6.56e-15 | 0.69 |
| 1. PBF | Q8P2C9 | Segregation and condensation protein A | 1.51e-12 | 2.85e-33 | 1.69e-15 | 0.4803 |
| 1. PBF | B8ZNI0 | Segregation and condensation protein A | 6.46e-12 | 3.76e-35 | 7.39e-15 | 0.6404 |
| 1. PBF | Q0SS18 | Segregation and condensation protein A | 1.75e-09 | 2.53e-35 | 1.78e-12 | 0.5197 |
| 1. PBF | B9E6N3 | Segregation and condensation protein A | 4.79e-12 | 1.56e-32 | 1.25e-09 | 0.5212 |
| 1. PBF | A9VFG1 | Segregation and condensation protein A | 2.96e-11 | 9.91e-29 | 2.41e-10 | 0.4983 |
| 1. PBF | B7H949 | Segregation and condensation protein A | 1.45e-11 | 2.48e-30 | 5.57e-10 | 0.4948 |
| 1. PBF | C3P7J3 | Segregation and condensation protein A | 1.27e-11 | 9.08e-32 | 7.86e-11 | 0.4718 |
| 1. PBF | A2RKH5 | Segregation and condensation protein A | 5.98e-09 | 1.64e-30 | 6.41e-14 | 0.5231 |
| 1. PBF | Q87BI4 | Segregation and condensation protein A | 1.73e-06 | 1.24e-15 | 7.12e-15 | 0.3626 |
| 1. PBF | Q1JIF5 | Segregation and condensation protein A | 1.41e-12 | 6.67e-34 | 9.91e-16 | 0.585 |
| 1. PBF | Q24V65 | Segregation and condensation protein A | 1.26e-08 | 3.35e-32 | 3.80e-12 | 0.4466 |
| 1. PBF | Q1JNA4 | Segregation and condensation protein A | 2.17e-12 | 5.85e-34 | 6.47e-15 | 0.7515 |
| 1. PBF | C0MGH0 | Segregation and condensation protein A | 1.02e-12 | 1.32e-29 | 8.01e-17 | 0.4987 |
| 1. PBF | Q92A57 | Segregation and condensation protein A | 1.57e-09 | 6.56e-30 | 3.11e-16 | 0.686 |
| 1. PBF | B0K9H1 | Segregation and condensation protein A | 5.63e-10 | 1.24e-40 | 4.37e-14 | 0.4887 |
| 1. PBF | B8DBX5 | Segregation and condensation protein A | 1.41e-11 | 1.52e-29 | 5.51e-17 | 0.6973 |
| 1. PBF | Q043U7 | Segregation and condensation protein A | 2.30e-08 | 1.03e-29 | 2.00e-17 | 0.5064 |
| 1. PBF | Q7ZAM4 | Segregation and condensation protein A | 4.54e-11 | 5.90e-31 | 6.19e-13 | 0.6767 |
| 1. PBF | Q5HFS7 | Segregation and condensation protein A | 3.68e-09 | 2.25e-33 | 3.70e-12 | 0.5051 |
| 1. PBF | Q7ZAL1 | Segregation and condensation protein A | 7.08e-10 | 5.13e-32 | 1.55e-15 | 0.5467 |
| 1. PBF | Q731P0 | Segregation and condensation protein A | 1.81e-11 | 1.61e-30 | 6.93e-11 | 0.6728 |
| 1. PBF | A0AK63 | Segregation and condensation protein A | 7.65e-12 | 4.99e-31 | 8.00e-18 | 0.6306 |
| 1. PBF | B1YMA3 | Segregation and condensation protein A | 2.30e-11 | 1.01e-36 | 2.69e-10 | 0.4723 |
| 1. PBF | B7IWH0 | Segregation and condensation protein A | 1.65e-11 | 2.48e-30 | 5.57e-10 | 0.6851 |
| 1. PBF | Q97HF0 | Segregation and condensation protein A | 1.87e-11 | 2.97e-37 | 2.17e-16 | 0.5318 |
| 1. PBF | Q5XDP4 | Segregation and condensation protein A | 1.08e-12 | 7.43e-34 | 7.86e-16 | 0.5637 |
| 1. PBF | Q2FGN7 | Segregation and condensation protein A | 3.18e-11 | 2.25e-33 | 3.70e-12 | 0.5139 |
| 1. PBF | B1I886 | Segregation and condensation protein A | 2.68e-12 | 3.76e-35 | 7.39e-15 | 0.601 |
| 1. PBF | Q04IT2 | Segregation and condensation protein A | 4.51e-12 | 3.76e-35 | 7.39e-15 | 0.6359 |
| 1. PBF | C4L379 | Segregation and condensation protein A | 5.46e-10 | 1.80e-37 | 3.73e-10 | 0.4154 |
| 1. PBF | Q71Y63 | Segregation and condensation protein A | 1.20e-11 | 1.29e-29 | 4.56e-16 | 0.5102 |
| 1. PBF | Q7ZAK8 | Segregation and condensation protein A | 3.79e-12 | 1.37e-32 | 4.21e-13 | 0.5355 |
| 1. PBF | B9DTS4 | Segregation and condensation protein A | 2.98e-10 | 1.37e-29 | 2.08e-19 | 0.5731 |
| 1. PBF | Q6GGK3 | Segregation and condensation protein A | 9.71e-11 | 1.73e-33 | 5.69e-12 | 0.5066 |
| 1. PBF | P60225 | Segregation and condensation protein A | 3.43e-08 | 2.25e-33 | 3.70e-12 | 0.5106 |
| 1. PBF | C3LIS3 | Segregation and condensation protein A | 1.27e-11 | 9.08e-32 | 7.86e-11 | 0.6543 |
| 1. PBF | Q1J8A9 | Segregation and condensation protein A | 7.75e-13 | 6.67e-34 | 9.91e-16 | 0.7476 |
| 1. PBF | C1CMI6 | Segregation and condensation protein A | 1.07e-11 | 3.76e-35 | 7.39e-15 | 0.5526 |
| 1. PBF | P35154 | Segregation and condensation protein A | 7.20e-10 | 1.17e-33 | 1.06e-10 | 0.4312 |
| 1. PBF | Q9A1B2 | Segregation and condensation protein A | 6.26e-14 | 1.43e-32 | 2.69e-15 | 0.4936 |
| 1. PBF | Q9CG33 | Segregation and condensation protein A | 2.46e-11 | 2.66e-28 | 1.56e-14 | 0.5131 |
| 1. PBF | B7HN36 | Segregation and condensation protein A | 1.16e-11 | 1.10e-30 | 1.41e-11 | 0.4831 |
| 1. PBF | Q8RAA1 | Segregation and condensation protein A | 1.42e-07 | 1.10e-39 | 5.75e-12 | 0.4977 |
| 1. PBF | Q1WTK0 | Segregation and condensation protein A | 1.21e-10 | 3.97e-29 | 3.88e-16 | 0.4902 |
| 1. PBF | A2RG92 | Segregation and condensation protein A | 2.05e-12 | 3.46e-33 | 2.28e-15 | 0.5022 |
| 1. PBF | Q6HEA8 | Segregation and condensation protein A | 2.03e-11 | 3.42e-31 | 1.01e-10 | 0.479 |
| 1. PBF | Q8CSH0 | Segregation and condensation protein A | 7.74e-11 | 5.24e-35 | 1.01e-11 | 0.5331 |
| 1. PBF | Q7ZAL5 | Segregation and condensation protein A | 7.33e-12 | 3.89e-32 | 1.58e-15 | 0.5625 |
| 1. PBF | B2TQW6 | Segregation and condensation protein A | 9.42e-12 | 7.69e-37 | 9.72e-12 | 0.5421 |
| 1. PBF | Q65HX1 | Segregation and condensation protein A | 2.23e-09 | 1.77e-36 | 1.31e-10 | 0.4233 |
| 1. PBF | A7GS82 | Segregation and condensation protein A | 7.80e-11 | 3.39e-30 | 1.70e-11 | 0.6472 |
| 1. PBF | Q5M1I0 | Segregation and condensation protein A | 1.96e-09 | 4.61e-32 | 1.17e-11 | 0.4544 |
| 1. PBF | C1KWQ2 | Segregation and condensation protein A | 2.04e-09 | 1.29e-29 | 4.56e-16 | 0.6343 |
| 1. PBF | B2V486 | Segregation and condensation protein A | 5.99e-12 | 8.04e-37 | 6.98e-12 | 0.5327 |
| 1. PBF | P0DF62 | Segregation and condensation protein A | 2.55e-12 | 6.67e-34 | 9.91e-16 | 0.583 |
| 1. PBF | Q8Y5V4 | Segregation and condensation protein A | 1.71e-11 | 1.29e-29 | 4.56e-16 | 0.6542 |
| 1. PBF | A5IT23 | Segregation and condensation protein A | 5.49e-11 | 2.25e-33 | 3.70e-12 | 0.513 |
| 1. PBF | A7Z671 | Segregation and condensation protein A | 1.58e-11 | 2.24e-34 | 3.55e-13 | 0.67 |
| 1. PBF | A8FEQ8 | Segregation and condensation protein A | 3.23e-09 | 5.98e-34 | 1.80e-10 | 0.4095 |
| 1. PBF | Q48V45 | Segregation and condensation protein A | 1.73e-11 | 5.85e-34 | 6.47e-15 | 0.4948 |
| 1. PBF | Q1JDD1 | Segregation and condensation protein A | 1.65e-14 | 5.85e-34 | 6.47e-15 | 0.4985 |
| 1. PBF | Q834U4 | Segregation and condensation protein A | 3.66e-10 | 1.20e-42 | 4.87e-10 | 0.4668 |
| 1. PBF | Q9EUR2 | Segregation and condensation protein A | 8.48e-12 | 2.37e-36 | 1.68e-16 | 0.5455 |
| 1. PBF | Q9EUQ7 | Segregation and condensation protein A | 1.85e-11 | 3.76e-35 | 7.39e-15 | 0.5433 |
| 1. PBF | A3CPQ7 | Segregation and condensation protein A | 2.77e-12 | 1.43e-32 | 1.75e-13 | 0.5678 |
| 1. PBF | Q4L6J5 | Segregation and condensation protein A | 4.39e-08 | 6.59e-38 | 9.36e-13 | 0.5031 |
| 1. PBF | B2ISX4 | Segregation and condensation protein A | 1.49e-11 | 6.25e-35 | 2.32e-15 | 0.548 |
| 1. PBF | B8FPL1 | Segregation and condensation protein A | 1.17e-08 | 3.35e-32 | 3.80e-12 | 0.4641 |
| 1. PBF | Q9PAP4 | Segregation and condensation protein A | 3.59e-09 | 6.70e-16 | 2.77e-14 | 0.354 |
| 1. PBF | A6U1W4 | Segregation and condensation protein A | 1.16e-08 | 2.25e-33 | 3.70e-12 | 0.5048 |
| 1. PBF | P60223 | Segregation and condensation protein A | 3.98e-08 | 2.25e-33 | 3.70e-12 | 0.5158 |
| 1. PBF | Q0TPF1 | Segregation and condensation protein A | 2.44e-11 | 4.34e-36 | 1.91e-12 | 0.5255 |
| 1. PBF | B5XJX8 | Segregation and condensation protein A | 5.38e-14 | 5.85e-34 | 6.47e-15 | 0.4898 |
| 1. PBF | P60224 | Segregation and condensation protein A | 3.26e-08 | 2.25e-33 | 3.70e-12 | 0.5196 |
| 1. PBF | B7JL37 | Segregation and condensation protein A | 1.22e-11 | 3.42e-31 | 1.01e-10 | 0.7011 |
| 1. PBF | A8AYT8 | Segregation and condensation protein A | 1.63e-12 | 1.85e-32 | 1.63e-15 | 0.7444 |
| 1. PBF | B0K158 | Segregation and condensation protein A | 1.13e-09 | 1.24e-40 | 4.37e-14 | 0.4889 |
| 1. PBF | Q02YQ8 | Segregation and condensation protein A | 1.58e-09 | 4.89e-31 | 7.44e-14 | 0.4805 |
| 1. PBF | Q03MF6 | Segregation and condensation protein A | 7.60e-10 | 4.61e-32 | 1.17e-11 | 0.5307 |
| 1. PBF | P0DF63 | Segregation and condensation protein A | 3.40e-13 | 6.67e-34 | 9.91e-16 | 0.7447 |
| 1. PBF | Q74JM3 | Segregation and condensation protein A | 7.88e-09 | 3.11e-29 | 1.10e-16 | 0.5654 |
| 1. PBF | Q5M622 | Segregation and condensation protein A | 1.58e-11 | 7.35e-32 | 2.24e-11 | 0.5361 |
| 1. PBF | B9IWS1 | Segregation and condensation protein A | 1.62e-11 | 1.10e-30 | 1.41e-11 | 0.6909 |
| 1. PBF | C1EQT2 | Segregation and condensation protein A | 2.07e-11 | 3.42e-31 | 1.01e-10 | 0.6728 |
| 3. BF | P75478 | Segregation and condensation protein A | 5.10e-04 | NA | 0.001 | 0.2741 |
| 3. BF | Q7NB76 | Segregation and condensation protein A | 2.60e-05 | NA | 3.07e-11 | 0.3896 |
| 4. PB | Q2FY76 | Segregation and condensation protein A | 5.56e-11 | 2.25e-33 | 3.70e-12 | NA |
| 5. P | Q0V7M7 | Spindle and kinetochore-associated protein 1 | 6.54e-03 | 1.41e-02 | NA | NA |
| 5. P | B0BM28 | Spindle and kinetochore-associated protein 1 | 2.09e-03 | 9.00e-03 | NA | NA |
| 5. P | Q58534 | Uncharacterized protein MJ1134 | 5.08e-04 | 2.05e-11 | NA | NA |
| 5. P | Q6DHG8 | Spindle and kinetochore-associated protein 1 | 8.50e-03 | 1.96e-02 | NA | NA |
| 5. P | Q8N140 | EP300-interacting inhibitor of differentiation 3 | 1.36e-03 | 3.04e-05 | NA | NA |
| 5. P | O94494 | Inner kinetochore subunit sim4 | 1.59e-04 | 4.28e-02 | NA | NA |
| 5. P | Q6BDR8 | Non-structural maintenance of chromosome element 4 | 1.61e-03 | 1.03e-05 | NA | NA |
| 5. P | P43124 | Non-structural maintenance of chromosome element 4 | 1.13e-03 | 6.12e-07 | NA | NA |
| 6. F | P47455 | Segregation and condensation protein A | 3.15e-09 | NA | NA | 0.6625 |