Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54723.1
JCVISYN3A_0328
Chromosome segregation protein B.
M. mycoides homolog: Q6MTL7.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 14
Unique PROST Go: 8
Unique BLAST Go: 0
Unique Foldseek Go: 2
Total Homologs: 309
Unique PROST Homologs: 164
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 9
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P60220
(Segregation and condensation protein B) with a FATCAT P-Value: 0 and RMSD of 2.26 angstrom. The sequence alignment identity is 35.8%.
Structural alignment shown in left. Query protein AVX54723.1 colored as red in alignment, homolog P60220 colored as blue.
Query protein AVX54723.1 is also shown in right top, homolog P60220 showed in right bottom. They are colored based on secondary structures.
AVX54723.1 MNQQYSAIIEGLLFIYGDDGVSLLDIQTVLDNLKPTEIKEIIIELNKKYLADPSSAFC-IQTYKKNNYRLQTKPELHEYFAK-LEQYNE---NKKLSHST 95 P60220 MT--YLSQIEALLFVAGEEGLSLRHLASML-SLTPTALQQQLEKLSQKYEKDQHSSLCLIET--ANTYRLVTK----EGFAELLRAYAKTPMNQSLSRAS 91 AVX54723.1 IEVLSIIAYKQPITKQQIDEIRNVDSTYQLYKLREKKLIKVVG-KDLENNRSNLYGITDNFFKVFNIKGGIEELPTISDDDIKQAIENNNEIKQEQQNLD 194 P60220 LEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVV-GRPHLYATTDYFLDYM----GINHL-----DEL---IE-VSAVEPADEEIA 177 AVX54723.1 LYGNIDDFNLDSQNQ 209 P60220 LFRTQD--------- 183
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0051301 | cell division |
| 1. PBF | GO:0051304 | chromosome separation |
| 1. PBF | GO:0006260 | DNA replication |
| 1. PBF | GO:0005737 | cytoplasm |
| 5. P | GO:0070647 | protein modification by small protein conjugation or removal |
| 5. P | GO:0030915 | Smc5-Smc6 complex |
| 5. P | GO:0030261 | chromosome condensation |
| 5. P | GO:0007059 | chromosome segregation |
| 5. P | GO:0046872 | metal ion binding |
| 5. P | GO:0009295 | nucleoid |
| 5. P | GO:0007127 | meiosis I |
| 5. P | GO:0007049 | cell cycle |
| 6. F | GO:0003700 | DNA-binding transcription factor activity |
| 6. F | GO:0016021 | integral component of membrane |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0051301 | cell division |
| GO:0007059 | chromosome segregation |
| GO:0051304 | chromosome separation |
| GO:0007049 | cell cycle |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | C0ZC77 | Segregation and condensation protein B | 2.11e-14 | 2.38e-33 | 1.08e-17 | 0.759 |
| 1. PBF | Q0TPF2 | Segregation and condensation protein B | 3.33e-16 | 6.38e-15 | 1.02e-19 | 0.7903 |
| 1. PBF | A0AK62 | Segregation and condensation protein B | 1.02e-14 | 1.74e-29 | 2.44e-18 | 0.4467 |
| 1. PBF | A5IT22 | Segregation and condensation protein B | 5.54e-10 | 3.70e-29 | 4.62e-18 | 0.4462 |
| 1. PBF | Q1GAK5 | Segregation and condensation protein B | 1.11e-15 | 7.01e-35 | 5.05e-16 | 0.8469 |
| 1. PBF | A9KMT3 | Segregation and condensation protein B | 2.89e-15 | 5.13e-28 | 3.09e-21 | 0.8134 |
| 1. PBF | C3KX86 | Segregation and condensation protein B | 6.77e-15 | 2.66e-10 | 2.78e-23 | 0.7715 |
| 1. PBF | B8DBX6 | Segregation and condensation protein B | 6.12e-12 | 2.36e-30 | 8.77e-18 | 0.4254 |
| 1. PBF | Q834U3 | Segregation and condensation protein B | 7.70e-13 | 1.56e-42 | 5.52e-20 | 0.4242 |
| 1. PBF | P35155 | Segregation and condensation protein B | 6.11e-15 | 2.03e-28 | 1.20e-23 | 0.4504 |
| 1. PBF | A8FEQ7 | Segregation and condensation protein B | 1.16e-12 | 3.15e-30 | 7.20e-21 | 0.5092 |
| 1. PBF | Q03WM8 | Segregation and condensation protein B | 8.97e-14 | 2.06e-37 | 7.49e-28 | 0.418 |
| 1. PBF | P60219 | Segregation and condensation protein B | 2.91e-10 | 3.70e-29 | 4.62e-18 | 0.4403 |
| 1. PBF | Q5XDP3 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9032 |
| 1. PBF | B1IMC4 | Segregation and condensation protein B | 6.88e-15 | 4.75e-10 | 3.29e-24 | 0.7529 |
| 1. PBF | Q5HP56 | Segregation and condensation protein B | 2.04e-10 | 2.11e-30 | 3.59e-18 | 0.4643 |
| 1. PBF | A3DD94 | Segregation and condensation protein B | 0.00e+00 | 1.21e-34 | 1.08e-25 | 0.8356 |
| 1. PBF | Q3A508 | Segregation and condensation protein B | 4.44e-16 | 3.04e-35 | 1.39e-14 | 0.7717 |
| 1. PBF | Q74JM2 | Segregation and condensation protein B | 1.11e-16 | 8.17e-32 | 2.60e-23 | 0.8724 |
| 1. PBF | Q5M621 | Segregation and condensation protein B | 0.00e+00 | 1.30e-28 | 1.89e-26 | 0.7665 |
| 1. PBF | Q9KCL0 | Segregation and condensation protein B | 1.11e-16 | 8.48e-30 | 2.37e-25 | 0.4863 |
| 1. PBF | Q6HEA9 | Segregation and condensation protein B | 5.55e-16 | 1.28e-24 | 9.67e-23 | 0.4761 |
| 1. PBF | C1KWQ1 | Segregation and condensation protein B | 2.50e-11 | 8.81e-30 | 2.71e-17 | 0.425 |
| 1. PBF | Q38WV4 | Segregation and condensation protein B | 2.52e-11 | 9.43e-36 | 9.14e-20 | 0.4102 |
| 1. PBF | Q6G970 | Segregation and condensation protein B | 2.72e-10 | 1.84e-29 | 9.24e-18 | 0.4396 |
| 1. PBF | Q83CP9 | Segregation and condensation protein B homolog | 3.02e-12 | 1.66e-24 | 1.81e-13 | 0.6822 |
| 1. PBF | B7IWG9 | Segregation and condensation protein B | 8.04e-13 | 2.03e-23 | 1.14e-21 | 0.4669 |
| 1. PBF | A6TR67 | Segregation and condensation protein B | 1.89e-15 | 1.14e-21 | 6.00e-23 | 0.8786 |
| 1. PBF | Q0SS19 | Segregation and condensation protein B | 7.77e-16 | 8.98e-15 | 2.17e-20 | 0.7929 |
| 1. PBF | Q65HX2 | Segregation and condensation protein B | 1.01e-12 | 3.74e-30 | 5.57e-22 | 0.4749 |
| 1. PBF | Q71Y64 | Segregation and condensation protein B | 3.30e-11 | 8.81e-30 | 2.71e-17 | 0.4265 |
| 1. PBF | B5XJX9 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9178 |
| 1. PBF | P60221 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9141 |
| 1. PBF | Q5WH04 | Segregation and condensation protein B | 9.55e-15 | 2.01e-24 | 1.58e-24 | 0.495 |
| 1. PBF | A7FUR1 | Segregation and condensation protein B | 6.33e-15 | 4.75e-10 | 3.29e-24 | 0.7682 |
| 1. PBF | Q67NF6 | Segregation and condensation protein B | 4.38e-12 | 6.80e-26 | 9.83e-19 | 0.8669 |
| 1. PBF | Q1JIF4 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9001 |
| 1. PBF | P0DF65 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9141 |
| 1. PBF | A6QH42 | Segregation and condensation protein B | 1.62e-10 | 5.39e-29 | 5.52e-18 | 0.4603 |
| 1. PBF | Q043U6 | Segregation and condensation protein B | 3.23e-12 | 6.59e-35 | 4.64e-23 | 0.8425 |
| 1. PBF | Q18BG3 | Segregation and condensation protein B | 0.00e+00 | 2.15e-18 | 3.41e-15 | 0.8588 |
| 1. PBF | A5I2X9 | Segregation and condensation protein B | 7.66e-15 | 4.75e-10 | 3.29e-24 | 0.7548 |
| 1. PBF | P60220 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9144 |
| 1. PBF | Q1J8A8 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9134 |
| 1. PBF | Q97NX6 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8121 |
| 1. PBF | Q9EUR1 | Segregation and condensation protein B | 4.21e-14 | 7.05e-25 | 1.51e-25 | 0.5931 |
| 1. PBF | B8ZNB3 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8163 |
| 1. PBF | Q97HF1 | Segregation and condensation protein B | 5.55e-16 | 2.52e-16 | 4.00e-21 | 0.7873 |
| 1. PBF | C1CTA5 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8036 |
| 1. PBF | Q48V44 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9198 |
| 1. PBF | A9VFG0 | Segregation and condensation protein B | 1.01e-12 | 5.70e-24 | 2.47e-19 | 0.5088 |
| 1. PBF | P47456 | Segregation and condensation protein B | 2.54e-13 | 1.42e-11 | 2.14e-18 | 0.8242 |
| 1. PBF | Q2FGN8 | Segregation and condensation protein B | 2.43e-10 | 5.39e-29 | 5.52e-18 | 0.4348 |
| 1. PBF | C1C9E1 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8145 |
| 1. PBF | Q8RAA0 | Segregation and condensation protein B | 0.00e+00 | 2.35e-11 | 1.92e-12 | 0.878 |
| 1. PBF | Q1WTK3 | Segregation and condensation protein B | 3.11e-15 | 9.60e-28 | 1.91e-23 | 0.6322 |
| 1. PBF | C1FNZ8 | Segregation and condensation protein B | 8.10e-15 | 2.83e-10 | 3.99e-23 | 0.7564 |
| 1. PBF | Q7ZAL6 | Segregation and condensation protein B | 0.00e+00 | 4.37e-32 | 3.21e-21 | 0.926 |
| 1. PBF | Q731P1 | Segregation and condensation protein B | 3.33e-16 | 1.12e-23 | 2.73e-23 | 0.478 |
| 1. PBF | A0RI62 | Segregation and condensation protein B | 0.00e+00 | 1.28e-24 | 9.67e-23 | 0.5386 |
| 1. PBF | Q7ZAJ3 | Segregation and condensation protein B | 1.87e-11 | 2.11e-30 | 3.59e-18 | 0.4429 |
| 1. PBF | Q5KXL1 | Segregation and condensation protein B | 5.49e-12 | 2.95e-29 | 1.44e-24 | 0.4764 |
| 1. PBF | Q7ZAL2 | Segregation and condensation protein B | 0.00e+00 | 4.37e-32 | 3.21e-21 | 0.9158 |
| 1. PBF | Q8NWF2 | Segregation and condensation protein B | 6.73e-11 | 1.84e-29 | 9.24e-18 | 0.4597 |
| 1. PBF | Q819C8 | Segregation and condensation protein B | 2.22e-16 | 8.72e-22 | 4.82e-21 | 0.8714 |
| 1. PBF | P60218 | Segregation and condensation protein B | 1.63e-10 | 3.70e-29 | 4.62e-18 | 0.4442 |
| 1. PBF | Q5M1H9 | Segregation and condensation protein B | 6.66e-16 | 1.00e-28 | 1.70e-26 | 0.8567 |
| 1. PBF | P0DF64 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9112 |
| 1. PBF | Q6KHG8 | Segregation and condensation protein B | 1.25e-11 | 2.23e-30 | 3.20e-16 | 0.4392 |
| 1. PBF | Q8EX11 | Segregation and condensation protein B | 4.44e-16 | 6.59e-32 | 4.54e-18 | 0.8743 |
| 1. PBF | B4U4Q5 | Segregation and condensation protein B | 0.00e+00 | 6.13e-17 | 4.12e-26 | 0.899 |
| 1. PBF | P75477 | Segregation and condensation protein B | 0.00e+00 | 3.51e-13 | 1.73e-21 | 0.854 |
| 1. PBF | B9IWS0 | Segregation and condensation protein B | 2.22e-12 | 5.47e-23 | 5.12e-23 | 0.5313 |
| 1. PBF | B5E1Y7 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8656 |
| 1. PBF | A8MFG6 | Segregation and condensation protein B | 0.00e+00 | 4.97e-19 | 3.69e-25 | 0.8854 |
| 1. PBF | C4Z9E6 | Segregation and condensation protein B | 0.00e+00 | 9.60e-28 | 2.65e-21 | 0.8164 |
| 1. PBF | Q04IT3 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.812 |
| 1. PBF | A8AYT7 | Segregation and condensation protein B | 0.00e+00 | 1.25e-22 | 9.60e-26 | 0.836 |
| 1. PBF | Q5HFS8 | Segregation and condensation protein B | 2.22e-10 | 5.39e-29 | 5.52e-18 | 0.443 |
| 1. PBF | Q8EQ83 | Segregation and condensation protein B | 9.92e-13 | 1.54e-25 | 6.63e-23 | 0.4859 |
| 1. PBF | A7Z670 | Segregation and condensation protein B | 1.20e-14 | 1.13e-29 | 1.56e-22 | 0.4508 |
| 1. PBF | A7GEA6 | Segregation and condensation protein B | 9.55e-15 | 4.75e-10 | 3.29e-24 | 0.7638 |
| 1. PBF | Q8Y5V5 | Segregation and condensation protein B | 1.41e-11 | 1.88e-29 | 1.13e-17 | 0.4288 |
| 1. PBF | C1EQT1 | Segregation and condensation protein B | 6.66e-16 | 1.28e-24 | 9.67e-23 | 0.4747 |
| 1. PBF | C1CMI5 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8685 |
| 1. PBF | Q635M3 | Segregation and condensation protein B | 4.22e-15 | 2.75e-24 | 3.11e-22 | 0.4798 |
| 1. PBF | B2ISX3 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8101 |
| 1. PBF | A2RKH6 | Segregation and condensation protein B | 0.00e+00 | 3.21e-22 | 5.85e-22 | 0.8404 |
| 1. PBF | Q8DNI9 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8117 |
| 1. PBF | B7HN35 | Segregation and condensation protein B | 2.22e-16 | 5.47e-23 | 5.12e-23 | 0.48 |
| 1. PBF | C3LIS2 | Segregation and condensation protein B | 0.00e+00 | 1.28e-24 | 9.67e-23 | 0.5383 |
| 1. PBF | A3CPQ6 | Segregation and condensation protein B | 0.00e+00 | 3.64e-26 | 8.57e-26 | 0.8598 |
| 1. PBF | Q98R94 | Segregation and condensation protein B | 6.86e-10 | 4.57e-35 | 1.60e-21 | 0.589 |
| 1. PBF | A2RG91 | Segregation and condensation protein B | 0.00e+00 | 4.05e-19 | 1.82e-27 | 0.9146 |
| 1. PBF | Q894L3 | Segregation and condensation protein B | 6.66e-16 | 4.16e-14 | 1.73e-18 | 0.8293 |
| 1. PBF | Q6GGK4 | Segregation and condensation protein B | 2.09e-10 | 1.32e-28 | 7.97e-18 | 0.4424 |
| 1. PBF | B7H948 | Segregation and condensation protein B | 2.65e-14 | 6.54e-24 | 4.39e-21 | 0.51 |
| 1. PBF | Q03F82 | Segregation and condensation protein B | 3.74e-11 | 1.84e-30 | 1.30e-24 | 0.4403 |
| 1. PBF | Q49XU2 | Segregation and condensation protein B | 2.02e-10 | 8.58e-26 | 1.82e-15 | 0.4329 |
| 1. PBF | Q1JNA3 | Segregation and condensation protein B | 0.00e+00 | 1.30e-19 | 1.74e-26 | 0.9139 |
| 1. PBF | Q1JDD0 | Segregation and condensation protein B | 0.00e+00 | 1.30e-19 | 1.74e-26 | 0.9031 |
| 1. PBF | A6U1W3 | Segregation and condensation protein B | 9.38e-11 | 3.70e-29 | 4.62e-18 | 0.4418 |
| 1. PBF | Q46206 | Segregation and condensation protein B | 4.44e-16 | 6.38e-15 | 1.02e-19 | 0.7945 |
| 1. PBF | C1CG99 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.8118 |
| 1. PBF | B8I2V4 | Segregation and condensation protein B | 0.00e+00 | 4.64e-29 | 6.79e-19 | 0.8196 |
| 1. PBF | Q9CG34 | Segregation and condensation protein B | 0.00e+00 | 8.43e-21 | 2.56e-22 | 0.8452 |
| 1. PBF | Q2RIR6 | Segregation and condensation protein B | 1.11e-16 | 1.25e-28 | 1.77e-19 | 0.8438 |
| 1. PBF | A4J3L6 | Segregation and condensation protein B | 1.11e-16 | 2.18e-15 | 2.24e-13 | 0.8439 |
| 1. PBF | Q02YQ9 | Segregation and condensation protein B | 0.00e+00 | 3.21e-22 | 5.85e-22 | 0.8443 |
| 1. PBF | Q7ZAK9 | Segregation and condensation protein B | 0.00e+00 | 1.34e-35 | 8.99e-25 | 0.7511 |
| 1. PBF | B7JL36 | Segregation and condensation protein B | 4.44e-16 | 1.28e-24 | 9.67e-23 | 0.4765 |
| 1. PBF | Q92A58 | Segregation and condensation protein B | 1.24e-13 | 5.49e-29 | 4.25e-17 | 0.43 |
| 1. PBF | A7GS81 | Segregation and condensation protein B | 1.90e-12 | 2.24e-25 | 1.16e-24 | 0.5054 |
| 1. PBF | Q81MH2 | Segregation and condensation protein B | 0.00e+00 | 1.28e-24 | 9.67e-23 | 0.5443 |
| 1. PBF | A7X2K7 | Segregation and condensation protein B | 1.84e-10 | 3.70e-29 | 4.62e-18 | 0.4545 |
| 1. PBF | Q3AAS0 | Segregation and condensation protein B | 7.11e-15 | 1.60e-19 | 3.84e-15 | 0.7852 |
| 1. PBF | C0M7Q4 | Segregation and condensation protein B | 0.00e+00 | 6.13e-17 | 4.12e-26 | 0.8911 |
| 1. PBF | B1KT22 | Segregation and condensation protein B | 6.99e-15 | 4.75e-10 | 3.29e-24 | 0.7671 |
| 1. PBF | Q3JZU1 | Segregation and condensation protein B | 0.00e+00 | 4.37e-32 | 3.21e-21 | 0.9129 |
| 1. PBF | A4IQG3 | Segregation and condensation protein B | 1.78e-13 | 8.32e-18 | 1.53e-26 | 0.4387 |
| 1. PBF | B1I885 | Segregation and condensation protein B | 0.00e+00 | 7.71e-26 | 2.17e-29 | 0.819 |
| 1. PBF | Q88VY8 | Segregation and condensation protein B | 3.69e-11 | 6.62e-29 | 1.55e-30 | 0.4928 |
| 1. PBF | Q4L6J4 | Segregation and condensation protein B | 1.00e-10 | 1.18e-27 | 1.15e-19 | 0.4404 |
| 1. PBF | C3P764 | Segregation and condensation protein B | 2.00e-12 | 1.28e-24 | 9.67e-23 | 0.5043 |
| 1. PBF | C0MGH1 | Segregation and condensation protein B | 0.00e+00 | 4.27e-16 | 8.52e-26 | 0.899 |
| 2. PF | Q0HW81 | UPF0502 protein Shewmr7_1629 | 1.14e-05 | 2.28e-02 | NA | 0.2657 |
| 2. PF | A0KVN6 | UPF0502 protein Shewana3_1622 | 4.88e-06 | 2.70e-02 | NA | 0.2628 |
| 2. PF | Q083L8 | UPF0502 protein Sfri_1696 | 1.18e-05 | 2.51e-02 | NA | 0.2764 |
| 2. PF | A4XVL7 | UPF0502 protein Pmen_2627 | 2.79e-05 | 8.66e-05 | NA | 0.2789 |
| 2. PF | A4Y5Y6 | UPF0502 protein Sputcn32_1644 | 1.05e-05 | 2.15e-02 | NA | 0.2737 |
| 2. PF | B1K2U6 | UPF0502 protein Bcenmc03_4618 | 1.34e-04 | 2.96e-04 | NA | 0.2656 |
| 2. PF | Q4ZTR4 | UPF0502 protein Psyr_2419 | 1.21e-05 | 3.57e-03 | NA | 0.2828 |
| 2. PF | Q48IK9 | UPF0502 protein PSPPH_2577 | 1.05e-05 | 7.89e-03 | NA | 0.2699 |
| 3. BF | Q7NB77 | Segregation and condensation protein B | 4.93e-11 | NA | 2.25e-15 | 0.861 |
| 3. BF | Q9PQE5 | Segregation and condensation protein B | 3.31e-13 | NA | 5.89e-14 | 0.8602 |
| 4. PB | Q2FY77 | Segregation and condensation protein B | 1.73e-10 | 5.39e-29 | 5.52e-18 | NA |
| 5. P | B2JND6 | UPF0502 protein Bphy_5360 | 3.14e-05 | 1.81e-04 | NA | NA |
| 5. P | Q0T5W5 | UPF0502 protein YceH | 1.71e-05 | 3.26e-03 | NA | NA |
| 5. P | Q1RD90 | UPF0502 protein YceH | 1.18e-05 | 1.27e-03 | NA | NA |
| 5. P | Q39BG3 | UPF0502 protein Bcep18194_B0081 | 1.31e-04 | 7.47e-05 | NA | NA |
| 5. P | B5FKZ6 | UPF0502 protein YceH | 1.17e-05 | 1.08e-02 | NA | NA |
| 5. P | B4SRN7 | UPF0502 protein Smal_0052 | 1.73e-04 | 2.47e-03 | NA | NA |
| 5. P | Q4K9I2 | UPF0502 protein PFL_4004 | 4.46e-05 | 1.05e-05 | NA | NA |
| 5. P | B4TTD2 | UPF0502 protein YceH | 1.18e-05 | 9.39e-03 | NA | NA |
| 5. P | B7UP81 | UPF0502 protein YceH | 1.34e-05 | 3.93e-03 | NA | NA |
| 5. P | Q7N6B8 | Chromosome partition protein MukE | 2.10e-03 | 1.63e-08 | NA | NA |
| 5. P | A0KM75 | UPF0502 protein AHA_2872 | 1.62e-05 | 8.53e-03 | NA | NA |
| 5. P | B2FU56 | UPF0502 protein Smlt0097 | 2.15e-04 | 1.83e-02 | NA | NA |
| 5. P | Q8X8M9 | UPF0502 protein YceH | 1.20e-05 | 9.74e-04 | NA | NA |
| 5. P | A3NKT2 | UPF0502 protein BURPS668_A1958 | 1.26e-04 | 1.05e-02 | NA | NA |
| 5. P | A1A9W2 | UPF0502 protein YceH | 7.75e-06 | 1.27e-03 | NA | NA |
| 5. P | Q3JLJ5 | UPF0502 protein BURPS1710b_A0399 | 1.33e-04 | 1.05e-02 | NA | NA |
| 5. P | B7NL67 | UPF0502 protein YceH | 1.15e-05 | 4.87e-03 | NA | NA |
| 5. P | B7NAU2 | UPF0502 protein YceH | 1.27e-05 | 1.27e-03 | NA | NA |
| 5. P | B5YVT7 | UPF0502 protein YceH | 1.43e-05 | 9.74e-04 | NA | NA |
| 5. P | A1AT30 | UPF0502 protein Ppro_2903 | 2.07e-05 | 3.71e-02 | NA | NA |
| 5. P | Q7UQ43 | UPF0502 protein RB6530 | 3.22e-04 | 6.19e-05 | NA | NA |
| 5. P | B5E8F0 | UPF0502 protein Gbem_0102 | 8.67e-05 | 2.17e-02 | NA | NA |
| 5. P | C3K6R3 | UPF0502 protein PFLU_2135 | 2.25e-05 | 4.93e-04 | NA | NA |
| 5. P | Q7VL95 | Chromosome partition protein MukE | 1.16e-04 | 1.71e-06 | NA | NA |
| 5. P | Q0HJY5 | UPF0502 protein Shewmr4_1554 | 1.31e-05 | 4.00e-02 | NA | NA |
| 5. P | B2SHI9 | UPF0502 protein PXO_03616 | 8.97e-06 | 1.61e-03 | NA | NA |
| 5. P | Q3IF86 | UPF0502 protein PSHAa0076 | 3.15e-06 | 3.13e-04 | NA | NA |
| 5. P | Q029U7 | UPF0502 protein Acid_1185 | 4.97e-06 | 2.61e-06 | NA | NA |
| 5. P | B1X9I0 | UPF0502 protein YceH | 1.23e-05 | 1.02e-03 | NA | NA |
| 5. P | Q53EK2 | Non-structural maintenance of chromosomes element 1 | 2.02e-04 | 4.49e-02 | NA | NA |
| 5. P | Q8Z7Z6 | Chromosome partition protein MukE | 2.05e-03 | 1.48e-08 | NA | NA |
| 5. P | Q32ES9 | UPF0502 protein YceH | 1.03e-05 | 4.08e-04 | NA | NA |
| 5. P | Q6D446 | Chromosome partition protein MukE | 2.20e-03 | 4.96e-09 | NA | NA |
| 5. P | A1WB87 | UPF0502 protein Ajs_3392 | 2.43e-05 | 1.42e-02 | NA | NA |
| 5. P | Q5PGW9 | UPF0502 protein YceH | 1.18e-05 | 1.13e-02 | NA | NA |
| 5. P | A8AI08 | UPF0502 protein CKO_01995 | 1.37e-05 | 1.10e-02 | NA | NA |
| 5. P | A5W5G8 | UPF0502 protein Pput_3252 | 4.75e-05 | 9.75e-06 | NA | NA |
| 5. P | Q7MJ63 | Chromosome partition protein MukE | 3.19e-04 | 3.78e-07 | NA | NA |
| 5. P | B1IV35 | UPF0502 protein YceH | 1.42e-05 | 1.33e-03 | NA | NA |
| 5. P | B1Z2C1 | UPF0502 protein BamMC406_5439 | 3.65e-05 | 7.51e-04 | NA | NA |
| 5. P | Q1LH07 | UPF0502 protein Rmet_3697 | 2.79e-05 | 3.68e-02 | NA | NA |
| 5. P | A1RKL0 | UPF0502 protein Sputw3181_2381 | 2.18e-05 | 3.20e-02 | NA | NA |
| 5. P | B5ETZ4 | UPF0502 protein VFMJ11_A0613 | 1.01e-05 | 3.51e-04 | NA | NA |
| 5. P | Q83LI7 | UPF0502 protein YceH | 1.37e-05 | 3.26e-03 | NA | NA |
| 5. P | Q3K9V5 | UPF0502 protein Pfl01_3711 | 2.12e-05 | 2.62e-05 | NA | NA |
| 5. P | Q5DZX2 | UPF0502 protein VF_A0604 | 1.43e-05 | 8.47e-04 | NA | NA |
| 5. P | Q48AN9 | UPF0502 protein CPS_0106 | 7.96e-06 | 3.35e-04 | NA | NA |
| 5. P | C4ZS07 | UPF0502 protein YceH | 1.18e-05 | 1.02e-03 | NA | NA |
| 5. P | B7MIK8 | UPF0502 protein YceH | 1.21e-05 | 1.27e-03 | NA | NA |
| 5. P | Q47D77 | UPF0502 protein Daro_2469 | 1.91e-05 | 3.83e-03 | NA | NA |
| 5. P | A1SW15 | UPF0502 protein Ping_1905 | 4.26e-05 | 3.41e-05 | NA | NA |
| 5. P | Q7NQ37 | UPF0502 protein CV_4303 | 1.57e-05 | 2.56e-03 | NA | NA |
| 5. P | A4JKA9 | UPF0502 protein Bcep1808_3727 | 1.73e-04 | 4.36e-04 | NA | NA |
| 5. P | B1ZXJ5 | UPF0502 protein Oter_3715 | 8.26e-05 | 2.34e-03 | NA | NA |
| 5. P | B3PE25 | UPF0502 protein CJA_1529 | 3.79e-05 | 2.83e-03 | NA | NA |
| 5. P | Q4UNV7 | UPF0502 protein XC_4228 | 3.76e-06 | 6.77e-05 | NA | NA |
| 5. P | Q0TJ07 | UPF0502 protein YceH | 1.41e-05 | 3.93e-03 | NA | NA |
| 5. P | Q9CN37 | Chromosome partition protein MukE | 9.10e-05 | 2.25e-07 | NA | NA |
| 5. P | Q8PER2 | UPF0502 protein XAC4278 | 1.16e-05 | 5.47e-04 | NA | NA |
| 5. P | Q57QI9 | UPF0502 protein YceH | 1.21e-05 | 9.39e-03 | NA | NA |
| 5. P | Q0I3K1 | Chromosome partition protein MukE | 1.16e-04 | 5.86e-07 | NA | NA |
| 5. P | B6ERZ8 | Chromosome partition protein MukE | 2.81e-03 | 2.53e-06 | NA | NA |
| 5. P | B1LIU3 | UPF0502 protein YceH | 5.71e-06 | 1.27e-03 | NA | NA |
| 5. P | Q02QU2 | UPF0502 protein PA14_19450 | 9.86e-06 | 3.02e-05 | NA | NA |
| 5. P | Q5H6C1 | UPF0502 protein XOO0245 | 1.02e-05 | 1.61e-03 | NA | NA |
| 5. P | A7N3Y9 | UPF0502 protein VIBHAR_05349 | 1.02e-05 | 2.14e-03 | NA | NA |
| 5. P | Q87QW3 | Chromosome partition protein MukE | 1.51e-03 | 4.78e-05 | NA | NA |
| 5. P | A4SKY4 | UPF0502 protein ASA_1460 | 1.21e-05 | 1.06e-02 | NA | NA |
| 5. P | B0UU63 | Chromosome partition protein MukE | 8.19e-05 | 8.03e-07 | NA | NA |
| 5. P | Q8D049 | Chromosome partition protein MukE | 5.04e-03 | 2.41e-08 | NA | NA |
| 5. P | Q66CH4 | Chromosome partition protein MukE | 2.18e-03 | 2.41e-08 | NA | NA |
| 5. P | P29217 | UPF0502 protein YceH | 1.56e-05 | 1.02e-03 | NA | NA |
| 5. P | B5XXJ0 | UPF0502 protein KPK_3478 | 1.32e-05 | 1.41e-02 | NA | NA |
| 5. P | A1K339 | UPF0502 protein azo0627 | 1.22e-05 | 3.47e-02 | NA | NA |
| 5. P | B4T300 | UPF0502 protein YceH | 1.16e-05 | 1.01e-02 | NA | NA |
| 5. P | B5F939 | UPF0502 protein YceH | 1.22e-05 | 1.08e-02 | NA | NA |
| 5. P | A0B3W7 | UPF0502 protein Bcen2424_5610 | 2.10e-05 | 3.35e-04 | NA | NA |
| 5. P | Q31ZC2 | UPF0502 protein YceH | 1.30e-05 | 1.85e-03 | NA | NA |
| 5. P | A4W980 | UPF0502 protein Ent638_1581 | 7.11e-05 | 3.14e-02 | NA | NA |
| 5. P | P45186 | Chromosome partition protein MukE | 6.33e-05 | 8.21e-07 | NA | NA |
| 5. P | Q3Z349 | UPF0502 protein YceH | 1.18e-05 | 1.33e-03 | NA | NA |
| 5. P | B7VQW9 | UPF0502 protein VS_II0353 | 2.91e-05 | 2.02e-04 | NA | NA |
| 5. P | A9AL79 | UPF0502 protein Bmul_3231/BMULJ_05293 | 1.61e-04 | 1.33e-02 | NA | NA |
| 5. P | Q8XDG1 | Chromosome partition protein MukE | 3.28e-03 | 1.38e-08 | NA | NA |
| 5. P | A6VP66 | Chromosome partition protein MukE | 5.21e-04 | 1.75e-05 | NA | NA |
| 5. P | Q8FJA3 | Chromosome partition protein MukE | 2.05e-03 | 1.48e-08 | NA | NA |
| 5. P | B6I9E4 | UPF0502 protein YceH | 2.75e-05 | 1.33e-03 | NA | NA |
| 5. P | Q9KRC7 | Chromosome partition protein MukE | 2.17e-03 | 4.56e-07 | NA | NA |
| 5. P | Q88K50 | UPF0502 protein PP_2442 | 3.95e-05 | 3.02e-05 | NA | NA |
| 5. P | A6T7E0 | UPF0502 protein KPN78578_10500 | 9.84e-06 | 1.90e-02 | NA | NA |
| 5. P | B7LG01 | UPF0502 protein YceH | 1.24e-05 | 1.33e-03 | NA | NA |
| 5. P | Q9HYF3 | UPF0502 protein PA3453 | 2.08e-05 | 2.02e-05 | NA | NA |
| 5. P | Q0B5Y5 | UPF0502 protein Bamb_4889 | 2.11e-05 | 1.51e-03 | NA | NA |
| 5. P | A7ZKH2 | UPF0502 protein YceH | 1.36e-05 | 1.33e-03 | NA | NA |
| 5. P | A9N5P3 | UPF0502 protein YceH | 1.20e-05 | 1.08e-02 | NA | NA |
| 5. P | A3D3F9 | UPF0502 protein Sbal_1765 | 6.89e-05 | 1.67e-03 | NA | NA |
| 5. P | C3LW05 | UPF0502 protein VCM66_A0698 | 2.31e-05 | 8.55e-04 | NA | NA |
| 5. P | B7LT70 | UPF0502 protein YceH | 1.09e-05 | 1.57e-03 | NA | NA |
| 5. P | A8GFK5 | UPF0502 protein Spro_2794 | 1.05e-05 | 1.01e-02 | NA | NA |
| 5. P | Q98EG3 | UPF0502 protein mll4256 | 1.10e-05 | 5.57e-04 | NA | NA |
| 5. P | C0Q840 | UPF0502 protein YceH | 1.21e-05 | 9.39e-03 | NA | NA |
| 5. P | Q8XF09 | UPF0502 protein YceH | 1.25e-05 | 1.08e-02 | NA | NA |
| 5. P | A1VS93 | UPF0502 protein Pnap_3223 | 2.69e-05 | 1.15e-02 | NA | NA |
| 5. P | A9BNV7 | UPF0502 protein Daci_5373 | 1.70e-05 | 5.50e-05 | NA | NA |
| 5. P | A6V1X3 | UPF0502 protein PSPA7_1674 | 1.01e-05 | 4.04e-05 | NA | NA |
| 5. P | A6WM62 | UPF0502 protein Shew185_1758 | 1.29e-04 | 3.18e-03 | NA | NA |
| 5. P | B7UYP4 | UPF0502 protein PLES_16071 | 7.86e-06 | 2.02e-05 | NA | NA |
| 5. P | B4ELG6 | UPF0502 protein BceJ2315_62050 | 2.32e-05 | 1.03e-03 | NA | NA |
| 5. P | Q8ZQB6 | Chromosome partition protein MukE | 2.25e-03 | 1.48e-08 | NA | NA |
| 5. P | Q9KLK3 | UPF0502 protein VC_A0740 | 2.17e-05 | 8.55e-04 | NA | NA |
| 5. P | B7MTJ8 | UPF0502 protein YceH | 2.19e-05 | 1.82e-02 | NA | NA |
| 5. P | A9MGZ5 | UPF0502 protein YceH | 1.19e-05 | 2.70e-02 | NA | NA |
| 5. P | A9KY67 | UPF0502 protein Sbal195_1802 | 5.69e-05 | 8.63e-04 | NA | NA |
| 5. P | B2TTK3 | UPF0502 protein YceH | 1.95e-05 | 3.97e-03 | NA | NA |
| 5. P | Q8FIR0 | UPF0502 protein YceH | 7.88e-06 | 1.27e-03 | NA | NA |
| 5. P | B0KLP4 | UPF0502 protein PputGB1_3531 | 3.06e-05 | 8.66e-05 | NA | NA |
| 5. P | Q2P8Z8 | UPF0502 protein XOO0224 | 1.02e-05 | 1.61e-03 | NA | NA |
| 5. P | Q87GU2 | UPF0502 protein VPA1223 | 1.70e-05 | 2.47e-05 | NA | NA |
| 5. P | A1S716 | UPF0502 protein Sama_1967 | 3.61e-05 | 8.61e-03 | NA | NA |
| 5. P | A3P6E0 | UPF0502 protein BURPS1106A_A1866 | 1.36e-04 | 1.05e-02 | NA | NA |
| 5. P | Q125Q0 | UPF0502 protein Bpro_3844 | 1.82e-05 | 2.63e-03 | NA | NA |
| 5. P | Q0K292 | UPF0502 protein H16_B1091 | 4.36e-05 | 1.71e-02 | NA | NA |
| 5. P | Q21HZ3 | UPF0502 protein Sde_2426 | 1.72e-05 | 4.53e-02 | NA | NA |
| 5. P | Q46SS9 | UPF0502 protein Reut_B4455 | 9.66e-05 | 1.03e-02 | NA | NA |
| 5. P | Q2T6L2 | UPF0502 protein BTH_II0990 | 2.54e-05 | 2.42e-02 | NA | NA |
| 5. P | Q13MT2 | UPF0502 protein Bxeno_B1639 | 2.14e-05 | 3.93e-03 | NA | NA |
| 5. P | Q882E2 | UPF0502 protein PSPTO_2686 | 2.90e-05 | 5.31e-04 | NA | NA |
| 5. P | B1Y234 | UPF0502 protein Lcho_2066 | 1.23e-04 | 7.10e-03 | NA | NA |
| 5. P | B7M942 | UPF0502 protein YceH | 1.24e-05 | 1.33e-03 | NA | NA |
| 5. P | B5QXZ7 | UPF0502 protein YceH | 1.20e-05 | 1.08e-02 | NA | NA |
| 5. P | Q8P3D5 | UPF0502 protein XCC4136 | 5.45e-06 | 6.77e-05 | NA | NA |
| 5. P | Q8DAP9 | Chromosome partition protein MukE | 4.00e-04 | 3.78e-07 | NA | NA |
| 5. P | B1JAB6 | UPF0502 protein PputW619_3184 | 1.77e-05 | 4.76e-06 | NA | NA |
| 5. P | Q6LPL4 | Chromosome partition protein MukE | 2.75e-03 | 7.95e-07 | NA | NA |
| 5. P | A5G733 | UPF0502 protein Gura_3445 | 3.08e-05 | 4.26e-03 | NA | NA |
| 5. P | Q65TL8 | Chromosome partition protein MukE | 1.38e-04 | 5.90e-08 | NA | NA |
| 5. P | Q21XX5 | UPF0502 protein Rfer_1648 | 4.08e-05 | 1.74e-03 | NA | NA |
| 5. P | B2TDB3 | UPF0502 protein Bphyt_5265 | 1.67e-05 | 2.06e-03 | NA | NA |
| 5. P | Q7CQR2 | UPF0502 protein YceH | 1.15e-05 | 1.08e-02 | NA | NA |
| 5. P | Q8D5Z2 | UPF0502 protein VV2_0756 | 2.69e-05 | 1.00e-03 | NA | NA |
| 5. P | B1KRD2 | UPF0502 protein Swoo_2055 | 7.88e-05 | 2.46e-02 | NA | NA |
| 5. P | A7ZZ25 | UPF0502 protein YceH | 1.17e-05 | 1.33e-03 | NA | NA |
| 5. P | A7MG41 | UPF0502 protein ESA_02280 | 2.53e-05 | 2.06e-02 | NA | NA |
| 5. P | B8EAI5 | UPF0502 protein Sbal223_2520 | 1.18e-04 | 1.90e-03 | NA | NA |
| 5. P | Q7UD30 | Chromosome partition protein MukE | 1.88e-03 | 1.48e-08 | NA | NA |
| 5. P | Q6LJI1 | UPF0502 protein PBPRB0676 | 1.68e-04 | 2.40e-03 | NA | NA |
| 5. P | B6ERM6 | UPF0502 protein VSAL_II0605 | 2.16e-05 | 1.22e-02 | NA | NA |
| 5. P | Q1IKF4 | UPF0502 protein Acid345_3645 | 1.19e-04 | 1.15e-02 | NA | NA |
| 5. P | B5BBC1 | UPF0502 protein YceH | 1.14e-05 | 1.13e-02 | NA | NA |
| 5. P | Q74GL3 | UPF0502 protein GSU0233 | 2.37e-05 | 4.20e-02 | NA | NA |
| 5. P | B0RZ32 | UPF0502 protein xcc-b100_4348 | 4.11e-06 | 6.77e-05 | NA | NA |
| 5. P | A5EZS7 | UPF0502 protein VC0395_0676/VC395_A0574 | 2.49e-05 | 8.24e-04 | NA | NA |
| 5. P | C6DFD6 | UPF0502 protein PC1_1804 | 1.72e-05 | 6.17e-03 | NA | NA |
| 5. P | B4TEU0 | UPF0502 protein YceH | 1.32e-05 | 1.01e-02 | NA | NA |
| 5. P | Q63KI8 | UPF0502 protein BPSS1373 | 1.26e-04 | 1.05e-02 | NA | NA |
| 5. P | C1DJE8 | UPF0502 protein Avin_04790 | 7.72e-06 | 1.60e-06 | NA | NA |
| 5. P | Q1IB54 | UPF0502 protein PSEEN2299 | 3.53e-05 | 4.01e-04 | NA | NA |
| 5. P | A2SFS2 | UPF0502 protein Mpe_A1449 | 2.97e-05 | 1.73e-02 | NA | NA |
| 5. P | P22524 | Chromosome partition protein MukE | 4.38e-03 | 8.98e-06 | NA | NA |
| 5. P | Q3BMA2 | UPF0502 protein XCV4380 | 7.21e-06 | 1.83e-04 | NA | NA |
| 5. P | Q12LW4 | UPF0502 protein Sden_2282 | 7.18e-06 | 4.34e-03 | NA | NA |
| 5. P | Q6D471 | UPF0502 protein ECA2523 | 1.24e-05 | 2.99e-02 | NA | NA |
| 5. P | B5E988 | UPF0502 protein Gbem_0194 | 1.82e-04 | 1.39e-03 | NA | NA |
| 5. P | Q7MD11 | UPF0502 protein VVA1225 | 2.69e-05 | 1.54e-03 | NA | NA |
| 6. F | Q4J9J9 | HTH-type transcriptional activator ArnR | 1.05e-04 | NA | NA | 0.293 |
| 6. F | Q6G757 | Uncharacterized HTH-type transcriptional regulator SAS2155 | 3.35e-05 | NA | NA | 0.468 |
| 6. F | Q8NVA6 | Uncharacterized HTH-type transcriptional regulator MW2183 | 1.05e-04 | NA | NA | 0.4681 |
| 6. F | P96705 | Uncharacterized HTH-type transcriptional regulator YdgG | 1.37e-04 | NA | NA | 0.4518 |
| 6. F | Q5HDU4 | Uncharacterized HTH-type transcriptional regulator SACOL2256 | 9.67e-05 | NA | NA | 0.4681 |
| 6. F | P62087 | Uncharacterized HTH-type transcriptional regulator SA2060 | 1.01e-04 | NA | NA | 0.4679 |
| 6. F | P62086 | Uncharacterized HTH-type transcriptional regulator SAV2265 | 9.85e-05 | NA | NA | 0.4682 |
| 6. F | Q6GEG9 | Uncharacterized HTH-type transcriptional regulator SAR2349 | 2.10e-05 | NA | NA | 0.5023 |
| 6. F | A8H5G5 | UPF0502 protein Spea_2482 | 4.22e-06 | NA | NA | 0.2714 |