Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54729.1
JCVISYN3A_0345
Uncharacterized ECF transporter S component.
M. mycoides homolog: Q6MTJ9.
TIGRfam Classification: 2=Generic.
Category: Essential.
Statistics
Total GO Annotation: 13
Unique PROST Go: 11
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 62
Unique PROST Homologs: 60
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 1
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
Q6F0N9
(Putative riboflavin transporter RibV) with a FATCAT P-Value: 6.99e-13 and RMSD of 3.02 angstrom. The sequence alignment identity is 21.5%.
Structural alignment shown in left. Query protein AVX54729.1 colored as red in alignment, homolog Q6F0N9 colored as blue.
Query protein AVX54729.1 is also shown in right top, homolog Q6F0N9 showed in right bottom. They are colored based on secondary structures.
AVX54729.1 MKESKSLKEQLNDVVCNVDKDLETHIEHEDENHK--NKDHYHGIHHFDQFGNHDDIQNQKFELKTVFQFNRKKLIFKIALTGIFLALAASVSALDILLES 98 Q6F0N9 ----------------------------MDKKYKLWN---YK--YDFSEI-N---LKNWKEVLKDTFKLNTR----KIALLSMLFAIEILMTIISKVIMG 59 AVX54729.1 IKIPVSDQVW-IQ-SRFLDISI-VCISIATLGPIFASLLGFLAPILHNFIHGMEHGWIQPPIEAVINVFIVWIVFL-IFNVMFSNSPIHHDTNKNV-ARF 193 Q6F0N9 LAIPMIVGVYTIEISFFVILIIYLCSNY-----IYASILSITA-IWFRLLLGSE------PV-GLLSMMISDTAFLTIFAVLFF---I---LKKFIFLKF 140 AVX54729.1 KRWTPLPIMSVLVAIVSTLGFILALYIDSKTNTTGIVSN--NSQLFFHAGHDHGHVHDD-----NMLTFNKINMFIVIAVFGWNVLRYAIAL-LLFILVE 285 Q6F0N9 KFKNQI---KILIALICFAG-LISM-IGS-----GFISMLCNDKFIF----EMYYLSDDGSGYWKMLLW--VGFGVTLAKYSINILLFASTLKVLLILI- 223 AVX54729.1 WKMRPINHRYK 296 Q6F0N9 -KQSRV----- 228
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 2. PF | GO:0005886 | plasma membrane |
| 2. PF | GO:0016021 | integral component of membrane |
| 5. P | GO:0022857 | transmembrane transporter activity |
| 5. P | GO:0015087 | cobalt ion transmembrane transporter activity |
| 5. P | GO:0032218 | riboflavin transport |
| 5. P | GO:0006824 | cobalt ion transport |
| 5. P | GO:0015225 | biotin transmembrane transporter activity |
| 5. P | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
| 5. P | GO:0009236 | cobalamin biosynthetic process |
| 5. P | GO:0000041 | transition metal ion transport |
| 5. P | GO:0032217 | riboflavin transmembrane transporter activity |
| 5. P | GO:0022900 | electron transport chain |
| 5. P | GO:0005542 | folic acid binding |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0022857 | transmembrane transporter activity |
| GO:0016020 | membrane |
| GO:0055085 | transmembrane transport |
| GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 3. BF | P47393 | Uncharacterized protein MG147 | 2.90e-07 | NA | 6.58e-06 | 0.6423 |
| 5. P | Q1G8W8 | UPF0397 protein Ldb1710 | 1.29e-07 | 1.50e-02 | NA | NA |
| 5. P | A3CL70 | Cobalt transport protein CbiM | 2.68e-05 | 9.05e-12 | NA | NA |
| 5. P | B7GLU2 | Cobalt transport protein CbiM | 2.21e-05 | 8.05e-11 | NA | NA |
| 5. P | Q3AE25 | Cobalt transport protein CbiM | 2.58e-06 | 8.05e-11 | NA | NA |
| 5. P | Q4QJQ3 | Ion-translocating oxidoreductase complex subunit E | 9.18e-05 | 3.86e-03 | NA | NA |
| 5. P | Q048Q1 | UPF0397 protein LBUL_1584 | 1.24e-07 | 1.50e-02 | NA | NA |
| 5. P | Q8DG81 | Cobalt transport protein CbiM | 1.36e-05 | 4.51e-10 | NA | NA |
| 5. P | C4L1J3 | UPF0397 protein EAT1b_2102 | 1.06e-10 | 9.29e-03 | NA | NA |
| 5. P | Q035X6 | Folate transporter FolT | 6.04e-07 | 9.96e-03 | NA | NA |
| 5. P | D9QVP6 | Cobalt transport protein CbiM | 1.84e-06 | 3.42e-08 | NA | NA |
| 5. P | Q18J48 | Putative cobalt transport protein CbiM | 4.31e-06 | 2.46e-04 | NA | NA |
| 5. P | Q6F0N9 | Putative riboflavin transporter RibV | 6.99e-13 | 4.25e-22 | NA | NA |
| 5. P | B1MWU5 | UPF0397 protein LCK_00164 | 3.67e-10 | 1.01e-02 | NA | NA |
| 5. P | E3PSD4 | Cobalt transport protein CbiM | 3.73e-05 | 1.36e-15 | NA | NA |
| 5. P | Q8YQ91 | Cobalt transport protein CbiM | 9.15e-07 | 1.78e-09 | NA | NA |
| 5. P | A6LKX5 | Cobalt transport protein CbiM | 6.06e-06 | 6.13e-12 | NA | NA |
| 5. P | Q041L7 | UPF0397 protein LGAS_1499 | 3.73e-10 | 8.93e-03 | NA | NA |
| 5. P | Q897L1 | Cobalt transport protein CbiM | 9.42e-05 | 2.58e-13 | NA | NA |
| 5. P | D5AUZ9 | Cobalt transport protein CbiM | 9.52e-06 | 9.03e-04 | NA | NA |
| 5. P | A4J832 | Cobalt transport protein CbiM | 7.28e-05 | 7.84e-09 | NA | NA |
| 5. P | Q46D59 | Putative cobalt transport protein CbiM 1 | 9.72e-06 | 7.37e-04 | NA | NA |
| 5. P | D9SNZ5 | Cobalt transport protein CbiM | 7.16e-05 | 7.44e-13 | NA | NA |
| 5. P | A8YUY9 | UPF0397 protein lhv_0999 | 1.82e-10 | 3.32e-02 | NA | NA |
| 5. P | P44274 | Putative metal transport protein HI_1621 | 2.32e-04 | 1.07e-03 | NA | NA |
| 5. P | Q2RJ53 | Cobalt transport protein CbiM | 5.98e-05 | 2.22e-07 | NA | NA |
| 5. P | Q03US7 | UPF0397 protein LEUM_1974 | 3.65e-10 | 3.48e-02 | NA | NA |
| 5. P | B0R611 | Putative cobalt transport protein CbiM | 3.01e-06 | 1.73e-04 | NA | NA |
| 5. P | Q05594 | Cobalt transport protein CbiM | 1.06e-05 | 2.59e-10 | NA | NA |
| 5. P | A5VM74 | Cobalt transport protein CbiM | 1.47e-05 | 2.25e-11 | NA | NA |
| 5. P | E5QVT2 | Riboflavin transporter RibU | 2.25e-08 | 8.05e-05 | NA | NA |
| 5. P | Q03ZT0 | Folate transporter FolT | 1.08e-05 | 6.48e-04 | NA | NA |
| 5. P | O83256 | Probable biotin transporter BioY | 1.61e-04 | 2.05e-03 | NA | NA |
| 5. P | B8GEB7 | Putative cobalt transport protein CbiM 2 | 2.06e-06 | 2.05e-02 | NA | NA |
| 5. P | A1ANE2 | Cobalt transport protein CbiM 2 | 5.46e-05 | 2.63e-02 | NA | NA |
| 5. P | Q57020 | Ion-translocating oxidoreductase complex subunit E | 9.04e-05 | 4.19e-03 | NA | NA |
| 5. P | Q2NHA4 | Putative cobalt transport protein CbiM | 2.15e-06 | 1.55e-03 | NA | NA |
| 5. P | B8GJG9 | Putative cobalt transport protein CbiM 1 | 7.61e-06 | 4.23e-03 | NA | NA |
| 5. P | P75251 | Uncharacterized protein MG350.1 homolog | 6.06e-07 | 1.03e-03 | NA | NA |
| 5. P | Q9ZB72 | Uncharacterized protein MG350.1 | 5.49e-07 | 2.34e-02 | NA | NA |
| 5. P | Q9ZB74 | Uncharacterized protein MG323.1 | 1.73e-03 | 5.35e-08 | NA | NA |
| 5. P | B8F7B0 | Ion-translocating oxidoreductase complex subunit E | 3.04e-03 | 2.79e-02 | NA | NA |
| 5. P | O66771 | Uncharacterized protein aq_473 | 2.71e-04 | 2.14e-03 | NA | NA |
| 5. P | D1AFI6 | Cobalt transport protein CbiM | 9.06e-05 | 3.80e-08 | NA | NA |
| 5. P | D3UMA1 | Cobalt transport protein CbiM | 3.24e-05 | 1.24e-12 | NA | NA |
| 5. P | A2RKV5 | Niacin transporter NiaX | 2.95e-06 | 3.77e-04 | NA | NA |
| 5. P | D9S0S1 | Cobalt transport protein CbiM | 2.15e-06 | 2.13e-09 | NA | NA |
| 5. P | A1ANC7 | Cobalt transport protein CbiM 1 | 1.01e-04 | 7.76e-03 | NA | NA |
| 5. P | Q5FKJ5 | UPF0397 protein LBA0922 | 2.10e-10 | 4.05e-02 | NA | NA |
| 5. P | P75314 | Uncharacterized protein MG323.1 homolog | 7.06e-04 | 3.98e-04 | NA | NA |
| 5. P | A5UFC5 | Ion-translocating oxidoreductase complex subunit E | 1.18e-04 | 4.29e-02 | NA | NA |
| 5. P | A9KP98 | Cobalt transport protein CbiM | 3.21e-06 | 1.01e-08 | NA | NA |
| 5. P | A5UBI7 | Ion-translocating oxidoreductase complex subunit E | 9.61e-05 | 1.07e-02 | NA | NA |
| 5. P | B3EC54 | Cobalt transport protein CbiM | 4.81e-05 | 9.47e-12 | NA | NA |
| 5. P | B8I0P7 | Cobalt transport protein CbiM | 2.48e-05 | 1.56e-14 | NA | NA |
| 5. P | A5UQS9 | Cobalt transport protein CbiM | 1.34e-04 | 9.72e-11 | NA | NA |
| 5. P | Q5M614 | Riboflavin transporter RibU | 1.85e-08 | 2.01e-08 | NA | NA |
| 5. P | D5WSC8 | Cobalt transport protein CbiM | 2.81e-05 | 2.71e-05 | NA | NA |
| 5. P | Q58964 | Putative metal transport protein MJ1569 | 1.01e-07 | 2.25e-04 | NA | NA |
| 5. P | Q74I63 | UPF0397 protein LJ_1703 | 3.54e-10 | 1.70e-03 | NA | NA |
| 5. P | C9YID6 | Cobalt transport protein CbiM | 9.79e-06 | 3.99e-11 | NA | NA |
| 6. F | P75585 | Uncharacterized protein MG147 homolog | 7.49e-09 | NA | NA | 0.6606 |