Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54730.1
JCVISYN3A_0346

Uncharacterized protein.
M. mycoides homolog: Q6MTJ8.
TIGRfam Classification: 1=Unknown.
Category: Nonessential.

Statistics

Total GO Annotation: 153
Unique PROST Go: 153
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 66
Unique PROST Homologs: 66
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: o-succinylbenzoate synthase menC
Antczak et al. [3]: Transmembrane protein, not a transporter
Zhang et al. [4]: GO:0005215|transporter activity
Bianchi et al. [5]: Unclear - membrane protein

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was Q9VRL2 (Probable Golgi SNAP receptor complex member 2) with a FATCAT P-Value: 3.94e-06 and RMSD of 2.42 angstrom. The sequence alignment identity is 20.2%.
Structural alignment shown in left. Query protein AVX54730.1 colored as red in alignment, homolog Q9VRL2 colored as blue. Query protein AVX54730.1 is also shown in right top, homolog Q9VRL2 showed in right bottom. They are colored based on secondary structures. 

  AVX54730.1 MNKEYTSRNQLFNKEI--DLVN-QQIKSAKSLGNYTKFINNSLNVLTKLDEKYFTNSFINLYDEFEKGSFYLAKTKISQTINQELLNNIDKQINL-LKNI 96
      Q9VRL2 MESLYHQTNNVV-KDIERDFQRLSQLSAQESLD-----VENGIQL--KI-----TQANANC-DRLD---VLLYKVPPSQRQSSKL--RVD-QLKYDLRHL 80

  AVX54730.1 STNDL---VDLKN--YSDFIVLDEQKFHFVNLLNMTKDIEFHKKTTSQSF--ESSKIINNDF-----TNLTKANFEQNDLKQVQNNNDLKQILITD---L 181
      Q9VRL2 QT-SLQTARERRQRRMQE---ISERE----QLLN-------H-RFTANSAQPEETR-LQLDYELQHHTQLGNAHRGVDDM--IASGSGILESLISQRMTL 161

  AVX54730.1 ---------IKKT--KSENLKKIFELERKKQMYQIKKNWFLIWI-SIFIAIMIFSLLL-FIVL 231
      Q9VRL2 GGAHKRIQAIGSTLGLSNHTMKL--IERR--LVEDRR----IFIGGVVVTLLIIALIIYFLVL 216

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
5. P GO:0045335 phagocytic vesicle
5. P GO:0033605 positive regulation of catecholamine secretion
5. P GO:0044201 host cell nuclear inner membrane
5. P GO:0005484 SNAP receptor activity
5. P GO:0005911 cell-cell junction
5. P GO:0071279 cellular response to cobalt ion
5. P GO:0006891 intra-Golgi vesicle-mediated transport
5. P GO:0051561 positive regulation of mitochondrial calcium ion concentration
5. P GO:0009629 response to gravity
5. P GO:0032456 endocytic recycling
5. P GO:0031901 early endosome membrane
5. P GO:0012505 endomembrane system
5. P GO:0050921 positive regulation of chemotaxis
5. P GO:1903076 regulation of protein localization to plasma membrane
5. P GO:0043195 terminal bouton
5. P GO:1903827
5. P GO:0070925 organelle assembly
5. P GO:1902109 negative regulation of mitochondrial membrane permeability involved in apoptotic process
5. P GO:0005802 trans-Golgi network
5. P GO:0098967 exocytic insertion of neurotransmitter receptor to postsynaptic membrane
5. P GO:0016189 synaptic vesicle to endosome fusion
5. P GO:0042582 azurophil granule
5. P GO:1902685 positive regulation of receptor localization to synapse
5. P GO:0035694 mitochondrial protein catabolic process
5. P GO:0030139 endocytic vesicle
5. P GO:0043229 intracellular organelle
5. P GO:0048193 Golgi vesicle transport
5. P GO:0031982 vesicle
5. P GO:0050882 voluntary musculoskeletal movement
5. P GO:0035493 SNARE complex assembly
5. P GO:0042581 specific granule
5. P GO:0010917 negative regulation of mitochondrial membrane potential
5. P GO:0030136 clathrin-coated vesicle
5. P GO:0072657 protein localization to membrane
5. P GO:0030073 insulin secretion
5. P GO:0019869 chloride channel inhibitor activity
5. P GO:0031175 neuron projection development
5. P GO:0017156 calcium-ion regulated exocytosis
5. P GO:0010701 positive regulation of norepinephrine secretion
5. P GO:0019905 syntaxin binding
5. P GO:0042147 retrograde transport, endosome to Golgi
5. P GO:0042734 presynaptic membrane
5. P GO:0070044 synaptobrevin 2-SNAP-25-syntaxin-1a complex
5. P GO:0019855 calcium channel inhibitor activity
5. P GO:0042641 actomyosin
5. P GO:0051640 organelle localization
5. P GO:0006078 (1->6)-beta-D-glucan biosynthetic process
5. P GO:0043008 ATP-dependent protein binding
5. P GO:0090161 Golgi ribbon formation
5. P GO:0060291 long-term synaptic potentiation
5. P GO:0097345 mitochondrial outer membrane permeabilization
5. P GO:0010637 negative regulation of mitochondrial fusion
5. P GO:0050544 arachidonic acid binding
5. P GO:0043005 neuron projection
5. P GO:0070033 synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex
5. P GO:0030672 synaptic vesicle membrane
5. P GO:0045055 regulated exocytosis
5. P GO:0032940 secretion by cell
5. P GO:0000139 Golgi membrane
5. P GO:0061025 membrane fusion
5. P GO:0042470 melanosome
5. P GO:0001956 positive regulation of neurotransmitter secretion
5. P GO:0006836 neurotransmitter transport
5. P GO:0098837 postsynaptic recycling endosome
5. P GO:0047485 protein N-terminus binding
5. P GO:0048102 autophagic cell death
5. P GO:0016236 macroautophagy
5. P GO:0140507 granzyme-mediated programmed cell death signaling pathway
5. P GO:0055037 recycling endosome
5. P GO:0048280 vesicle fusion with Golgi apparatus
5. P GO:0006623 protein targeting to vacuole
5. P GO:0030426 growth cone
5. P GO:0046879 hormone secretion
5. P GO:0099003 vesicle-mediated transport in synapse
5. P GO:0044325 transmembrane transporter binding
5. P GO:0017022 myosin binding
5. P GO:0043653 mitochondrial fragmentation involved in apoptotic process
5. P GO:0044877 protein-containing complex binding
5. P GO:0005483 soluble NSF attachment protein activity
5. P GO:0012507 ER to Golgi transport vesicle membrane
5. P GO:0045837 negative regulation of membrane potential
5. P GO:1903575 cornified envelope assembly
5. P GO:1903078 positive regulation of protein localization to plasma membrane
5. P GO:0050908 detection of light stimulus involved in visual perception
5. P GO:0098794 postsynapse
5. P GO:0010940 positive regulation of necrotic cell death
5. P GO:0098815 modulation of excitatory postsynaptic potential
5. P GO:0030027 lamellipodium
5. P GO:0016079 synaptic vesicle exocytosis
5. P GO:0048306 calcium-dependent protein binding
5. P GO:0090649 response to oxygen-glucose deprivation
5. P GO:0031629 synaptic vesicle fusion to presynaptic active zone membrane
5. P GO:0042589 zymogen granule membrane
5. P GO:0009968 negative regulation of signal transduction
5. P GO:0048278 vesicle docking
5. P GO:0048787 presynaptic active zone membrane
5. P GO:0006906 vesicle fusion
5. P GO:0048488 synaptic vesicle endocytosis
5. P GO:0030141 secretory granule
5. P GO:0031201 SNARE complex
5. P GO:2000010 positive regulation of protein localization to cell surface
5. P GO:0032588 trans-Golgi network membrane
5. P GO:0048471 perinuclear region of cytoplasm
5. P GO:0005794 Golgi apparatus
5. P GO:0098978 glutamatergic synapse
5. P GO:0000149 SNARE binding
5. P GO:0016192 vesicle-mediated transport
5. P GO:0005769 early endosome
5. P GO:0008021 synaptic vesicle
5. P GO:0000011 vacuole inheritance
5. P GO:0048209 regulation of vesicle targeting, to, from or within Golgi
5. P GO:2000463 positive regulation of excitatory postsynaptic potential
5. P GO:0098685 Schaffer collateral - CA1 synapse
5. P GO:0035149 lumen formation, open tracheal system
5. P GO:0043243 positive regulation of protein-containing complex disassembly
5. P GO:0075733 intracellular transport of virus
5. P GO:0017157 regulation of exocytosis
5. P GO:0045956 positive regulation of calcium ion-dependent exocytosis
5. P GO:0035974 meiotic spindle pole body
5. P GO:0010807 regulation of synaptic vesicle priming
5. P GO:0045785 positive regulation of cell adhesion
5. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
5. P GO:1903715 regulation of aerobic respiration
5. P GO:0019900 kinase binding
5. P GO:0043067 regulation of programmed cell death
5. P GO:0005770 late endosome
5. P GO:0001916 positive regulation of T cell mediated cytotoxicity
5. P GO:0006896 Golgi to vacuole transport
5. P GO:0005768 endosome
5. P GO:0070820 tertiary granule
5. P GO:0001669 acrosomal vesicle
5. P GO:0030285 integral component of synaptic vesicle membrane
5. P GO:1990144 intrinsic apoptotic signaling pathway in response to hypoxia
5. P GO:0070032 synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex
5. P GO:0016021 integral component of membrane
5. P GO:0006887 exocytosis
5. P GO:0010659 cardiac muscle cell apoptotic process
5. P GO:0005737 cytoplasm
5. P GO:0046907 intracellular transport
5. P GO:0001772 immunological synapse
5. P GO:0031902 late endosome membrane
5. P GO:0045921 positive regulation of exocytosis
5. P GO:0099056 integral component of presynaptic membrane
5. P GO:0005789 endoplasmic reticulum membrane
5. P GO:1903599 positive regulation of autophagy of mitochondrion
5. P GO:0008076 voltage-gated potassium channel complex
5. P GO:0005797 Golgi medial cisterna
5. P GO:0032028 myosin head/neck binding
5. P GO:0014069 postsynaptic density
5. P GO:0016925 protein sumoylation
5. P GO:0006886 intracellular protein transport
5. P GO:0005801 cis-Golgi network
5. P GO:0016081 synaptic vesicle docking

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
5. P Q75CY3 Protein transport protein BOS1 4.92e-04 8.26e-03 NA NA
5. P P52465 Nuclear egress protein 2 NA 2.33e-02 NA NA
5. P Q148R9 Regulator of G-protein signaling 9-binding protein 4.74e-03 2.27e-02 NA NA
5. P Q5R6Q2 Syntaxin-6 7.89e-05 3.07e-02 NA NA
5. P O43752 Syntaxin-6 9.81e-05 3.07e-02 NA NA
5. P P25385 Protein transport protein BOS1 7.13e-04 9.55e-05 NA NA
5. P Q9YJQ8 Protein tio NA 3.22e-03 NA NA
5. P Q9LVP9 Vesicle transport v-SNARE 13 6.31e-05 5.66e-03 NA NA
5. P Q6CRX0 Protein transport protein BOS1 1.91e-04 3.98e-05 NA NA
5. P Q6GLX4 Regulator of G-protein signaling 9-binding protein B 8.64e-04 4.98e-08 NA NA
5. P P61267 Syntaxin-1B 1.39e-04 4.44e-02 NA NA
5. P Q9SEL5 Vesicle transport v-SNARE 12 4.30e-05 4.83e-02 NA NA
5. P Q5R602 Syntaxin-7 1.38e-05 4.89e-04 NA NA
5. P Q04338 t-SNARE VTI1 2.16e-05 1.12e-03 NA NA
5. P Q5R4L2 Syntaxin-1A 1.14e-04 1.17e-02 NA NA
5. P Q5XHI3 Regulator of G-protein signaling 9-binding protein A 3.26e-03 7.41e-04 NA NA
5. P O14653 Golgi SNAP receptor complex member 2 2.04e-05 1.96e-02 NA NA
5. P P32856 Syntaxin-2 1.54e-04 2.19e-02 NA NA
5. P Q95ZW1 Golgi SNAP receptor complex member 1 1.63e-05 1.38e-02 NA NA
5. P O35526 Syntaxin-1A 1.18e-04 1.96e-02 NA NA
5. P Q8MJG0 Regulator of G-protein signaling 9-binding protein 1.61e-03 1.76e-02 NA NA
5. P O15400 Syntaxin-7 7.62e-05 2.73e-04 NA NA
5. P P32854 Syntaxin PEP12 5.23e-05 2.58e-02 NA NA
5. P Q5ZL19 Syntaxin-6 1.30e-04 2.33e-02 NA NA
5. P Q60376 Uncharacterized protein MJ0064 5.13e-05 3.65e-03 NA NA
5. P P38736 Golgi SNAP receptor complex member 1 3.59e-05 1.53e-02 NA NA
5. P Q08100 Envelope glycoprotein D NA 3.05e-02 NA NA
5. P Q03322 t-SNARE affecting a late Golgi compartment protein 1 3.56e-05 1.34e-02 NA NA
5. P O70257 Syntaxin-7 1.08e-05 5.13e-03 NA NA
5. P O35166 Golgi SNAP receptor complex member 2 2.45e-05 2.69e-02 NA NA
5. P Q6CMA4 Protein BIG1 1.79e-01 3.02e-02 NA NA
5. P P0C6D5 Toxin coregulated pilus biosynthesis protein R 7.89e-03 4.39e-08 NA NA
5. P A4KX73 Uncharacterized protein ORF18 NA 3.67e-02 NA NA
5. P P61268 Syntaxin-1B 2.79e-05 4.44e-02 NA NA
5. P A5F396 Toxin coregulated pilus biosynthesis protein R 4.70e-03 4.39e-08 NA NA
5. P Q9JI51 Vesicle transport through interaction with t-SNAREs homolog 1A 5.05e-05 6.57e-03 NA NA
5. P Q6GLU0 Regulator of G-protein signaling 9-binding protein C 2.20e-03 5.72e-08 NA NA
5. P P47573 Uncharacterized protein MG331 5.35e-04 3.42e-05 NA NA
5. P Q5UQP0 Uncharacterized protein L448 NA 7.35e-07 NA NA
5. P Q54I54 Putative uncharacterized transmembrane protein DDB_G0288997 7.68e-05 9.07e-13 NA NA
5. P A8XLW0 Golgi SNAP receptor complex member 1 3.62e-05 1.84e-03 NA NA
5. P Q5UR47 Uncharacterized protein R570 NA 1.11e-04 NA NA
5. P Q00186 Protein TraM 1.38e-04 2.12e-02 NA NA
5. P Q16623 Syntaxin-1A 1.02e-04 9.34e-03 NA NA
5. P Q9VRL2 Probable Golgi SNAP receptor complex member 2 3.94e-06 2.23e-02 NA NA
5. P O70439 Syntaxin-7 5.33e-05 4.76e-04 NA NA
5. P Q9FK28 Membrin-12 1.80e-04 4.71e-04 NA NA
5. P Q64704 Syntaxin-3 1.71e-05 4.33e-03 NA NA
5. P O74466 Uncharacterized protein C1739.04c 7.52e-04 3.49e-02 NA NA
5. P P32851 Syntaxin-1A 8.77e-05 1.73e-02 NA NA
5. P Q6FKA1 Protein transport protein BOS1 1.76e-04 3.54e-04 NA NA
5. P O35165 Golgi SNAP receptor complex member 2 2.18e-05 9.84e-03 NA NA
5. P Q9SEL6 Vesicle transport v-SNARE 11 2.19e-05 6.75e-03 NA NA
5. P P75307 Uncharacterized protein MG331 homolog 1.55e-03 9.67e-10 NA NA
5. P Q3ZBT5 Syntaxin-7 5.65e-05 9.67e-03 NA NA
5. P Q13277 Syntaxin-3 1.93e-04 1.09e-02 NA NA
5. P O74449 Uncharacterized protein C16C4.04 1.60e-03 4.63e-02 NA NA
5. P Q6XK22 Regulator of G-protein signaling 9-binding protein 8.20e-03 2.42e-05 NA NA
5. P Q9SJL6 Membrin-11 7.94e-05 2.37e-04 NA NA
5. P Q77PA8 Apoptosis regulator M11L NA 1.71e-02 NA NA
5. P O55003 BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 4.12e-03 2.21e-02 NA NA
5. P Q01045 Nuclear egress protein 2 NA 1.02e-04 NA NA
5. P Q08849 Syntaxin-3 1.01e-04 8.05e-03 NA NA
5. P Q6BVM4 Protein transport protein BOS1 8.73e-06 1.87e-03 NA NA
5. P Q9XXX1 23 kDa piroplasm membrane protein 7.19e-02 2.19e-02 NA NA
5. P Q9ER00 Syntaxin-12 4.16e-05 4.02e-02 NA NA