Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54732.1

JCVISYN3A_0348

Ribosome biogenesis GTPase.
M. mycoides homolog: Q6MTJ6.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 47
Unique PROST Go: 2
Unique BLAST Go: 24
Unique Foldseek Go: 0

Total Homologs: 2250
Unique PROST Homologs: 180
Unique BLAST Homologs: 628
Unique Foldseek Homologs: 23

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: engA; GTPase Der
Zhang et al. [4]: GO:0043022|ribosome binding
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q21W32 (GTPase Der) with a FATCAT P-Value: 0 and RMSD of 3.30 angstrom. The sequence alignment identity is 35.4%.
Structural alignment shown in left. Query protein AVX54732.1 colored as red in alignment, homolog Q21W32 colored as blue. Query protein AVX54732.1 is also shown in right top, homolog Q21W32 showed in right bottom. They are colored based on secondary structures.

  AVX54732.1 MKKQVVAIVGKPNVGKSSLFNRIIKEKKSIVDNKPGVTRDRIYSSAEWLTREFILIDTGGISLSDQ---LFSNEIKLQTQIAIEQADVIIFVVDFLNNLD 97
      Q21W32 M-KPVVALVGRPNVGKSTLFNRLTKSRDAIVADFAGLTRDRHYGNAKQGKHEFIVIDTGGFE-PDAAGGIFKEMAKQTTQ-AVAEADVVIFVVDAREGIS 97

  AVX54732.1 NDDKMIAKILHKSKKPVILAVNKYDKKTIDDHN-YQFMSLGFSDLYFISSTHGIGVGDLLDKVIS--YISKNEEIIKDDS--------TKIAIIGRPNVG 186
      Q21W32 AQDHEIAKYLRRLGKPCVLAANKAE-GMLAGAQLVEFFELGLGEVHAISAAHGQGIRTLVDLALAPLHL---ED--QDDADEQREPGIIKLAVAGRPNVG 191

  AVX54732.1 KSSLVNSLVNENRMIVSEIEGTTLDAVDISFSYNKKKYTVIDTAGIRKKSKLGQTIEKYSYLRSLSAISNADIVLLMIDATKPITDQDTNIGGLIYDEKK 286
      Q21W32 KSTLINTWLGEERLVAFDLPGTTRDAISVPFERNGQKFELVDTAGLRRRGKVFEAIEKFSVVKTLQAIESSNVVLLLIDATQGVTDQDAHIAGYILENGR 291

  AVX54732.1 PVIIVVNKWDLIKNKETEILKKEEEIRAYFKYISYAKIIFISTLDKTRITKI-LDLVDEIK-QNLDIKIKTYVLNEVLNKAQLIN-PAPEFNGN-RLKIY 382
      Q21W32 AVVIAVNKWDAVDEYQRELVKRSIETR--LPFLKFATMHLISATKRQGLGPLWASIAQAYKAANC--KMSTPILTRLLLEA--VQFQSPKRSGMFRPKLR 385

  AVX54732.1 YASQ--VQAYIPTFVLFCNNPNYL-HFS--YKRFLENQIRFSFGLDSIPINLIFREKK----------- 435
      Q21W32 YAHQGGMNP--PVIII---HGNSLEHVTDAYKRFLEGRFRKEFDLVGTPMRIEF--KSSTNPYADKATA 447

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0043022	ribosome binding
1. PBF	GO:0000027	ribosomal large subunit assembly
1. PBF	GO:0003723	RNA binding
1. PBF	GO:0030488	tRNA methylation
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0002098	tRNA wobble uridine modification
1. PBF	GO:0003924	GTPase activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0042254	ribosome biogenesis
1. PBF	GO:0006400	tRNA modification
1. PBF	GO:0046872	metal ion binding
1. PBF	GO:0019843	rRNA binding
1. PBF	GO:0005525	GTP binding
3. BF	GO:0000028	ribosomal small subunit assembly
3. BF	GO:0000917	division septum assembly
3. BF	GO:0043024	ribosomal small subunit binding
3. BF	GO:0070181	small ribosomal subunit rRNA binding
3. BF	GO:0042274	ribosomal small subunit biogenesis
4. PB	GO:0097216	guanosine tetraphosphate binding
4. PB	GO:0005524	ATP binding
4. PB	GO:0070899	mitochondrial tRNA wobble uridine modification
5. P	GO:0000287	magnesium ion binding
5. P	GO:0043023	ribosomal large subunit binding
7. B	GO:0070129	regulation of mitochondrial translation
7. B	GO:0044065	regulation of respiratory system process
7. B	GO:0005887	integral component of plasma membrane
7. B	GO:0005615	extracellular space
7. B	GO:0004781	sulfate adenylyltransferase (ATP) activity
7. B	GO:0002181	cytoplasmic translation
7. B	GO:2000200	regulation of ribosomal subunit export from nucleus
7. B	GO:0005634	nucleus
7. B	GO:0051301	cell division
7. B	GO:0000103	sulfate assimilation
7. B	GO:0006412	translation
7. B	GO:0070814	hydrogen sulfide biosynthetic process
7. B	GO:0006351	transcription, DNA-templated
7. B	GO:0016021	integral component of membrane
7. B	GO:0005576	extracellular region
7. B	GO:0031116	positive regulation of microtubule polymerization
7. B	GO:1901673	regulation of mitotic spindle assembly
7. B	GO:0015093	ferrous iron transmembrane transporter activity
7. B	GO:0033342	negative regulation of collagen binding
7. B	GO:0016020	membrane
7. B	GO:0042644	chloroplast nucleoid
7. B	GO:0005654	nucleoplasm
7. B	GO:0007049	cell cycle
7. B	GO:0055072	iron ion homeostasis

Uniprot GO Annotations

GO	Description
GO:0042254	ribosome biogenesis
GO:0000166	nucleotide binding
GO:0005525	GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	A6Q4R8	GTPase Der	0.00e+00	1.05e-46	4.47e-92	0.5869
1. PBF	Q8DDI1	tRNA modification GTPase MnmE	1.47e-03	8.30e-05	3.38e-12	0.6646
1. PBF	Q7VFY6	GTPase Der	0.00e+00	6.62e-40	2.91e-82	0.5864
1. PBF	Q98RC1	GTPase Der	0.00e+00	7.27e-68	3.31e-127	0.8047
1. PBF	C5D3F4	GTPase Der	0.00e+00	1.30e-70	2.54e-156	0.9144
1. PBF	Q8CX13	tRNA modification GTPase MnmE	3.38e-04	3.56e-06	1.22e-17	0.6226
1. PBF	A0KUJ9	GTPase Der	0.00e+00	8.53e-38	2.60e-86	0.8192
1. PBF	B1KX71	GTPase Der	0.00e+00	5.05e-71	3.33e-129	0.9319
1. PBF	B5Z0Y0	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8238
1. PBF	B3CR58	GTPase Der	0.00e+00	9.86e-49	1.99e-77	0.806
1. PBF	B7UGV7	GTPase Der	0.00e+00	4.37e-38	1.38e-91	0.8378
1. PBF	A1VZU7	tRNA modification GTPase MnmE	6.70e-04	4.39e-04	1.61e-18	0.4376
1. PBF	Q7VM29	GTPase Der	0.00e+00	1.58e-36	2.45e-89	0.8407
1. PBF	Q8EC36	GTPase Der	0.00e+00	3.00e-38	3.31e-86	0.8156
1. PBF	A7ZBS1	GTPase Der	0.00e+00	9.18e-46	7.34e-91	0.5915
1. PBF	P0C8P1	tRNA modification GTPase MnmE	1.41e-03	8.12e-06	7.20e-17	0.746
1. PBF	A5I816	tRNA modification GTPase MnmE	2.98e-03	2.35e-05	1.82e-17	0.6074
1. PBF	Q7N702	GTPase Der	0.00e+00	3.77e-38	3.58e-93	0.862
1. PBF	B7I5H1	GTPase Der	0.00e+00	4.31e-36	1.91e-88	0.8457
1. PBF	Q8D3I9	tRNA modification GTPase MnmE	3.03e-04	3.26e-05	4.71e-12	0.5347
1. PBF	Q8A135	GTPase Der	0.00e+00	1.29e-65	1.46e-119	0.8904
1. PBF	A6LEP5	GTPase Der	0.00e+00	1.48e-68	1.10e-115	0.8925
1. PBF	Q834T4	GTPase Der	0.00e+00	5.47e-66	1.45e-149	0.911
1. PBF	B1YR40	GTPase Der	0.00e+00	1.64e-55	1.84e-98	0.8181
1. PBF	P53364	tRNA modification GTPase MnmE	1.04e-03	1.54e-04	5.75e-12	0.765
1. PBF	A5N7W7	GTPase Der	0.00e+00	3.98e-68	1.23e-128	0.9211
1. PBF	Q8XH30	tRNA modification GTPase MnmE	1.64e-03	1.66e-04	2.91e-17	0.7032
1. PBF	A2BPL9	GTPase Der	0.00e+00	2.03e-46	2.26e-105	0.7844
1. PBF	A1TM31	GTPase Der	0.00e+00	1.83e-53	2.19e-88	0.8237
1. PBF	Q8G2E8	GTPase Der	0.00e+00	3.86e-43	5.14e-84	0.5835
1. PBF	A1JKS6	GTPase Der	0.00e+00	8.88e-37	2.69e-87	0.8536
1. PBF	Q668A3	GTPase Der	0.00e+00	5.98e-36	7.57e-88	0.8512
1. PBF	A4SGR9	tRNA modification GTPase MnmE	3.70e-03	7.83e-05	1.16e-14	0.4098
1. PBF	B5Z7J9	GTPase Der	0.00e+00	5.23e-49	5.64e-75	0.5488
1. PBF	A8A317	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8365
1. PBF	A3CPT0	GTPase Der	0.00e+00	3.08e-69	5.56e-141	0.9239
1. PBF	B3PS53	tRNA modification GTPase MnmE	1.70e-02	2.13e-04	5.79e-12	0.704
1. PBF	A0Q125	GTPase Der	0.00e+00	3.80e-63	2.36e-136	0.8954
1. PBF	C3P591	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9079
1. PBF	A1BCU6	tRNA modification GTPase MnmE	1.06e-03	2.29e-03	1.70e-12	0.3979
1. PBF	Q0BND2	GTPase Der	0.00e+00	1.25e-47	6.23e-73	0.782
1. PBF	B1YGA8	tRNA modification GTPase MnmE	2.44e-04	2.99e-05	4.73e-16	0.7295
1. PBF	B0RT56	GTPase Der	0.00e+00	1.00e-38	6.67e-88	0.8337
1. PBF	Q1G7Z4	tRNA modification GTPase MnmE	3.57e-04	2.28e-05	5.85e-17	0.5962
1. PBF	Q72D51	tRNA modification GTPase MnmE	2.36e-04	6.16e-06	6.93e-12	0.6802
1. PBF	Q7MVZ2	tRNA modification GTPase MnmE	5.93e-04	1.92e-05	1.01e-14	0.4331
1. PBF	B2IRW4	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9216
1. PBF	Q2JV46	GTPase Der	0.00e+00	1.73e-48	8.76e-104	0.6208
1. PBF	A7Z636	GTPase Der	0.00e+00	1.20e-70	2.24e-153	0.8985
1. PBF	Q8FF59	GTPase Der	0.00e+00	1.07e-38	1.75e-91	0.8304
1. PBF	B5ZYX3	GTPase Der	5.55e-15	1.24e-44	5.04e-88	0.673
1. PBF	B3Q9V3	GTPase Der	0.00e+00	7.44e-49	5.67e-92	0.7797
1. PBF	Q9PG37	GTPase Der	0.00e+00	1.73e-38	8.78e-84	0.7597
1. PBF	Q4L2Z2	tRNA modification GTPase MnmE	5.99e-03	6.28e-06	1.19e-16	0.7475
1. PBF	Q0SNY5	tRNA modification GTPase MnmE	5.57e-04	1.58e-04	1.20e-11	0.7774
1. PBF	Q4L6I0	GTPase Der	0.00e+00	6.19e-70	2.70e-154	0.9134
1. PBF	Q8EQA8	GTPase Der	0.00e+00	1.13e-67	2.12e-146	0.905
1. PBF	A0RLR2	tRNA modification GTPase MnmE	2.55e-04	5.06e-06	1.59e-16	0.7402
1. PBF	Q8P979	GTPase Der	0.00e+00	1.00e-38	6.67e-88	0.7829
1. PBF	B1AJ22	GTPase Der	0.00e+00	9.89e-66	2.32e-140	0.6815
1. PBF	A5UY19	tRNA modification GTPase MnmE	1.13e-03	2.85e-04	2.23e-18	0.4202
1. PBF	Q6GGT6	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9286
1. PBF	Q5M5X5	GTPase Der	0.00e+00	6.60e-66	2.76e-142	0.9201
1. PBF	Q21CM0	tRNA modification GTPase MnmE	7.65e-03	7.53e-05	2.33e-08	0.6942
1. PBF	B1IHR9	tRNA modification GTPase MnmE	4.46e-03	2.35e-05	1.82e-17	0.6167
1. PBF	Q5LR04	GTPase Der	0.00e+00	3.77e-46	1.76e-75	0.6265
1. PBF	Q0HKV5	GTPase Der	0.00e+00	8.53e-38	2.60e-86	0.8238
1. PBF	Q83C83	GTPase Der	0.00e+00	8.47e-59	5.52e-84	0.8704
1. PBF	A0RBV9	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.911
1. PBF	B7J1B2	tRNA modification GTPase MnmE	7.23e-04	1.54e-04	5.75e-12	0.7655
1. PBF	Q2JSU8	tRNA modification GTPase MnmE	3.62e-04	5.91e-04	1.50e-16	0.7205
1. PBF	B6JM65	GTPase Der	0.00e+00	3.54e-47	1.21e-72	0.596
1. PBF	P0A175	tRNA modification GTPase MnmE	1.48e-03	5.09e-05	2.16e-13	0.3827
1. PBF	Q2W7M7	GTPase Der	0.00e+00	1.47e-48	1.25e-78	0.593
1. PBF	P64058	GTPase Der	0.00e+00	3.26e-40	3.24e-88	0.6114
1. PBF	P97043	tRNA modification GTPase MnmE	2.31e-03	2.62e-04	2.02e-10	0.7174
1. PBF	Q1GXL7	tRNA modification GTPase MnmE	9.64e-04	2.15e-05	4.69e-13	0.6439
1. PBF	B4SSW8	GTPase Der	0.00e+00	2.10e-38	1.35e-86	0.8453
1. PBF	B1AI04	tRNA modification GTPase MnmE	1.07e-02	3.29e-04	7.99e-11	0.6595
1. PBF	Q8CMN5	tRNA modification GTPase MnmE	3.20e-04	2.74e-06	4.62e-17	0.6766
1. PBF	P73839	tRNA modification GTPase MnmE	3.31e-04	3.83e-05	1.03e-17	0.6627
1. PBF	Q0I0Z2	tRNA modification GTPase MnmE	3.88e-03	6.89e-06	2.25e-12	0.6601
1. PBF	Q2JIE6	tRNA modification GTPase MnmE	2.67e-04	3.08e-04	7.97e-16	0.7942
1. PBF	Q5NFD2	GTPase Der	0.00e+00	3.60e-46	6.71e-73	0.7859
1. PBF	Q1QS99	tRNA modification GTPase MnmE	2.63e-03	7.11e-06	4.44e-12	0.6714
1. PBF	A7FW89	GTPase Der	0.00e+00	2.15e-70	3.47e-135	0.9414
1. PBF	O84709	GTPase Der	0.00e+00	8.73e-40	1.59e-69	0.5565
1. PBF	Q48LZ0	GTPase Der	0.00e+00	3.45e-34	4.70e-86	0.8603
1. PBF	Q92UK6	GTPase Der	0.00e+00	3.75e-45	1.82e-84	0.63
1. PBF	B9L7G9	GTPase Der	0.00e+00	2.35e-52	2.06e-84	0.6212
1. PBF	B1JSA4	GTPase Der	0.00e+00	2.02e-36	7.33e-88	0.8578
1. PBF	B0BR82	tRNA modification GTPase MnmE	6.01e-03	1.81e-05	5.37e-13	0.6552
1. PBF	B0B8S9	GTPase Der	0.00e+00	6.57e-39	4.99e-69	0.5571
1. PBF	A3NPX5	tRNA modification GTPase MnmE	2.66e-03	1.99e-03	9.70e-13	0.646
1. PBF	Q603B5	GTPase Der	0.00e+00	2.01e-41	3.87e-94	0.7789
1. PBF	A0QH59	GTPase Der	0.00e+00	2.46e-37	5.95e-90	0.7719
1. PBF	Q88RX5	tRNA modification GTPase MnmE	3.08e-04	1.47e-04	2.50e-17	0.7142
1. PBF	C0RH89	GTPase Der	0.00e+00	3.38e-43	1.35e-84	0.6546
1. PBF	B1I766	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9182
1. PBF	Q0ATU5	tRNA modification GTPase MnmE	8.83e-04	3.82e-04	1.14e-13	0.4094
1. PBF	Q4FPR8	tRNA modification GTPase MnmE	9.69e-04	1.06e-04	1.29e-14	0.6927
1. PBF	Q5GTT5	tRNA modification GTPase MnmE	2.87e-04	2.78e-05	8.40e-13	0.6958
1. PBF	C3LT16	GTPase Der	0.00e+00	3.13e-39	4.34e-96	0.8447
1. PBF	A5N451	tRNA modification GTPase MnmE	5.93e-04	4.52e-05	1.31e-16	0.6351
1. PBF	Q8CX54	tRNA modification GTPase MnmE	7.38e-04	1.18e-05	1.95e-16	0.7303
1. PBF	B3EFY1	GTPase Der	0.00e+00	2.28e-64	5.93e-114	0.7533
1. PBF	B2IJQ3	tRNA modification GTPase MnmE	8.51e-04	4.82e-03	5.35e-11	0.4044
1. PBF	A8ZU05	GTPase Der	0.00e+00	1.01e-39	2.77e-114	0.8639
1. PBF	Q814F6	tRNA modification GTPase MnmE	2.26e-04	1.37e-06	9.80e-17	0.7289
1. PBF	Q058F5	tRNA modification GTPase MnmE	1.66e-03	2.49e-06	1.24e-08	0.6642
1. PBF	P75309	GTPase Der	0.00e+00	1.25e-56	3.53e-134	0.7599
1. PBF	C5BES7	GTPase Der	0.00e+00	2.38e-39	6.81e-89	0.8582
1. PBF	Q1QD14	GTPase Der	0.00e+00	3.47e-27	9.48e-97	0.8611
1. PBF	A6SZW6	GTPase Der	0.00e+00	1.03e-57	1.03e-94	0.8279
1. PBF	Q2RFI8	tRNA modification GTPase MnmE	1.03e-04	8.04e-06	6.71e-19	0.7457
1. PBF	Q2FGW7	GTPase Der	0.00e+00	1.33e-67	1.70e-153	0.9307
1. PBF	A4SYD7	GTPase Der	0.00e+00	5.01e-47	8.33e-85	0.7947
1. PBF	B5RL05	tRNA modification GTPase MnmE	4.14e-04	2.05e-04	1.09e-14	0.4132
1. PBF	A5IC36	GTPase Der	0.00e+00	1.25e-42	8.69e-100	0.8008
1. PBF	B2SUV8	tRNA modification GTPase MnmE	1.25e-03	2.70e-05	5.76e-13	0.6898
1. PBF	Q2SRR7	GTPase Der	0.00e+00	2.03e-93	0.0	0.9885
1. PBF	Q662I5	tRNA modification GTPase MnmE	3.88e-04	1.55e-04	1.18e-10	0.7798
1. PBF	Q3JXI0	tRNA modification GTPase MnmE	1.74e-03	2.15e-03	9.36e-13	0.6821
1. PBF	Q47WC5	GTPase Der	0.00e+00	2.43e-36	2.53e-88	0.8555
1. PBF	C1KWN7	GTPase Der	0.00e+00	6.91e-72	1.47e-155	0.8987
1. PBF	B1XAY6	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8431
1. PBF	A3MS17	tRNA modification GTPase MnmE	1.65e-03	1.99e-03	9.70e-13	0.6841
1. PBF	A1RHQ7	GTPase Der	0.00e+00	4.31e-37	1.26e-86	0.8149
1. PBF	B3QLF4	GTPase Der	0.00e+00	1.40e-65	1.01e-101	0.8614
1. PBF	C1CSX0	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9183
1. PBF	Q9Z762	GTPase Der	0.00e+00	7.21e-40	4.30e-53	0.6217
1. PBF	Q5PNI6	GTPase Der	0.00e+00	3.41e-39	3.74e-93	0.837
1. PBF	B7M7L5	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8413
1. PBF	Q74JL6	GTPase Der	0.00e+00	6.19e-70	7.65e-149	0.9145
1. PBF	A6TXE5	tRNA modification GTPase MnmE	1.00e-03	2.17e-05	2.42e-19	0.6391
1. PBF	Q8KH12	GTPase Der	0.00e+00	9.60e-73	1.71e-135	0.9078
1. PBF	Q986D9	GTPase Der	0.00e+00	1.70e-42	5.27e-87	0.6753
1. PBF	B9KRT2	GTPase Der	0.00e+00	3.56e-44	1.03e-71	0.6272
1. PBF	Q820T0	tRNA modification GTPase MnmE	2.70e-04	1.90e-04	5.16e-15	0.7342
1. PBF	B8D8G4	GTPase Der	0.00e+00	9.43e-54	1.55e-73	0.8183
1. PBF	Q4UUM0	GTPase Der	0.00e+00	1.00e-38	6.67e-88	0.8406
1. PBF	B0TAB6	tRNA modification GTPase MnmE	5.56e-04	8.63e-05	1.04e-17	0.7145
1. PBF	Q030L6	GTPase Der	0.00e+00	3.35e-69	2.28e-139	0.9076
1. PBF	Q64NV3	GTPase Der	0.00e+00	9.59e-64	9.56e-121	0.8805
1. PBF	Q63DM8	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9189
1. PBF	Q3ANQ3	tRNA modification GTPase MnmE	5.68e-04	6.02e-05	3.62e-11	0.7506
1. PBF	B1XU78	GTPase Der	0.00e+00	1.35e-45	1.74e-82	0.8098
1. PBF	Q5L8K8	GTPase Der	0.00e+00	9.59e-64	9.56e-121	0.8853
1. PBF	A1AHP0	tRNA modification GTPase MnmE	2.46e-03	8.71e-05	6.12e-12	0.6512
1. PBF	Q085U2	GTPase Der	0.00e+00	9.65e-37	5.33e-87	0.8122
1. PBF	Q72WU3	tRNA modification GTPase MnmE	3.75e-04	3.99e-06	1.05e-16	0.7381
1. PBF	A1TZQ4	GTPase Der	0.00e+00	2.62e-31	1.15e-90	0.8352
1. PBF	Q3KKZ6	tRNA modification GTPase MnmE	3.27e-04	3.26e-05	3.04e-17	0.7219
1. PBF	B9E1C8	GTPase Der	0.00e+00	3.98e-68	1.23e-128	0.9267
1. PBF	Q5P7B7	GTPase Der	0.00e+00	3.53e-58	1.55e-90	0.7914
1. PBF	Q30T75	tRNA modification GTPase MnmE	2.25e-04	2.36e-04	1.17e-18	0.6203
1. PBF	B2V5W6	GTPase Der	0.00e+00	2.24e-52	3.83e-115	0.631
1. PBF	Q5ZV99	GTPase Der	0.00e+00	1.85e-42	7.72e-100	0.7996
1. PBF	B4RV85	GTPase Der	0.00e+00	4.40e-40	9.65e-92	0.7782
1. PBF	A8FM10	tRNA modification GTPase MnmE	5.41e-04	3.38e-04	4.10e-19	0.691
1. PBF	C4LC41	GTPase Der	0.00e+00	2.05e-39	3.56e-88	0.8324
1. PBF	B1MYB5	GTPase Der	0.00e+00	5.38e-68	1.39e-142	0.8859
1. PBF	Q81SW9	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9025
1. PBF	C5CXH0	GTPase Der	0.00e+00	6.86e-54	2.46e-92	0.7641
1. PBF	Q9X1F8	GTPase Der	0.00e+00	7.08e-59	1.02e-79	0.5745
1. PBF	P50743	GTPase Der	0.00e+00	9.28e-69	3.67e-155	0.8996
1. PBF	Q8ZCT9	GTPase Der	0.00e+00	2.02e-36	7.33e-88	0.8606
1. PBF	A1B4S0	GTPase Der	0.00e+00	2.08e-40	4.64e-75	0.6936
1. PBF	B9DTQ3	GTPase Der	0.00e+00	3.74e-69	5.55e-145	0.9259
1. PBF	C1DE52	GTPase Der	0.00e+00	2.31e-34	2.59e-87	0.8634
1. PBF	B9KFN5	GTPase Der	0.00e+00	5.56e-50	1.72e-86	0.5715
1. PBF	A4XY28	GTPase Der	0.00e+00	1.72e-36	3.10e-89	0.8452
1. PBF	A2RGB0	GTPase Der	0.00e+00	9.82e-68	3.95e-142	0.9245
1. PBF	B7VJU2	GTPase Der	0.00e+00	9.99e-41	4.34e-93	0.8404
1. PBF	P57812	GTPase Der	0.00e+00	4.95e-38	1.39e-87	0.8552
1. PBF	Q6HL51	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9179
1. PBF	A9KLK7	GTPase Der	0.00e+00	5.96e-63	3.69e-125	0.8844
1. PBF	Q8XJK1	GTPase Der	0.00e+00	2.51e-71	5.80e-134	0.8932
1. PBF	C6DBH0	GTPase Der	0.00e+00	1.02e-38	1.89e-91	0.8387
1. PBF	A1KT93	GTPase Der	0.00e+00	1.02e-20	3.16e-87	0.8356
1. PBF	Q7M901	tRNA modification GTPase MnmE	1.66e-04	3.46e-05	1.37e-18	0.7624
1. PBF	Q9EWW8	GTPase Der	0.00e+00	1.11e-36	8.13e-89	0.8479
1. PBF	Q2STM2	tRNA modification GTPase MnmE	8.80e-04	7.06e-03	1.36e-12	0.642
1. PBF	A7ZPV4	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8294
1. PBF	Q87S12	GTPase Der	0.00e+00	1.96e-39	5.40e-91	0.8136
1. PBF	Q4FNR7	tRNA modification GTPase MnmE	5.80e-03	1.90e-06	4.83e-11	0.5094
1. PBF	Q11KI3	GTPase Der	0.00e+00	1.94e-46	3.25e-91	0.61
1. PBF	Q181S7	tRNA modification GTPase MnmE	1.44e-03	1.81e-05	7.15e-18	0.7482
1. PBF	A8G2J5	tRNA modification GTPase MnmE	1.98e-04	5.10e-04	1.63e-11	0.7714
1. PBF	C0PYN4	GTPase Der	0.00e+00	2.38e-39	3.25e-93	0.8521
1. PBF	A5I4V0	GTPase Der	0.00e+00	2.15e-70	3.47e-135	0.9444
1. PBF	Q931E1	tRNA modification GTPase MnmE	2.10e-04	2.92e-06	3.46e-16	0.6623
1. PBF	Q3JCW1	GTPase Der	0.00e+00	3.74e-42	6.77e-97	0.8204
1. PBF	B2SXS6	GTPase Der	0.00e+00	1.08e-50	6.48e-95	0.8153
1. PBF	B5FAX6	GTPase Der	0.00e+00	2.38e-39	5.19e-94	0.7449
1. PBF	A8F732	tRNA modification GTPase MnmE	8.86e-05	9.98e-05	8.92e-21	0.831
1. PBF	Q0SMZ9	GTPase Der	0.00e+00	3.30e-61	1.72e-67	0.555
1. PBF	A1KW66	tRNA modification GTPase MnmE	4.69e-03	1.06e-04	5.07e-12	0.7262
1. PBF	Q10VJ7	tRNA modification GTPase MnmE	1.36e-04	6.32e-05	3.81e-17	0.736
1. PBF	B2V3Z1	GTPase Der	0.00e+00	2.58e-72	5.37e-130	0.8956
1. PBF	Q7M7W8	GTPase Der	0.00e+00	4.81e-45	1.18e-84	0.5689
1. PBF	A7GN41	GTPase Der	0.00e+00	3.64e-66	2.70e-154	0.9097
1. PBF	B5RQZ8	tRNA modification GTPase MnmE	3.66e-04	2.13e-04	9.94e-15	0.4135
1. PBF	Q49UI4	tRNA modification GTPase MnmE	1.94e-03	7.11e-06	5.48e-15	0.4006
1. PBF	B7MYE6	GTPase Der	0.00e+00	1.26e-38	1.05e-91	0.8436
1. PBF	Q3SL66	GTPase Der	0.00e+00	5.59e-30	4.62e-85	0.8049
1. PBF	A1V9V1	GTPase Der	0.00e+00	9.56e-36	3.64e-52	0.5741
1. PBF	Q2NX54	tRNA modification GTPase MnmE	1.23e-03	2.81e-05	9.11e-13	0.6748
1. PBF	Q5QZJ5	tRNA modification GTPase MnmE	2.22e-03	1.65e-05	5.81e-12	0.6587
1. PBF	Q3AQ22	GTPase Der	0.00e+00	1.38e-56	7.28e-107	0.7339
1. PBF	A8EZN9	GTPase Der	0.00e+00	8.38e-58	9.49e-104	0.8156
1. PBF	Q0BW92	tRNA modification GTPase MnmE	7.72e-04	2.34e-04	1.08e-10	0.7186
1. PBF	A6U595	tRNA modification GTPase MnmE	2.83e-04	2.24e-06	4.18e-16	0.6546
1. PBF	Q0VNE4	GTPase Der	0.00e+00	1.70e-44	5.81e-89	0.8456
1. PBF	Q1IWI7	GTPase Der	0.00e+00	1.74e-53	4.31e-102	0.5805
1. PBF	B9KZ43	GTPase Der	0.00e+00	5.44e-58	1.50e-120	0.8758
1. PBF	B3EMI7	GTPase Der	0.00e+00	8.62e-64	2.89e-109	0.8633
1. PBF	Q3AZ65	GTPase Der	0.00e+00	1.11e-52	7.12e-108	0.7314
1. PBF	O51881	GTPase Der	0.00e+00	1.09e-47	1.14e-68	0.8315
1. PBF	B1IWF0	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8326
1. PBF	B9DNV9	GTPase Der	0.00e+00	5.10e-70	2.27e-150	0.9161
1. PBF	B0K8N3	GTPase Der	0.00e+00	4.69e-68	3.49e-139	0.9231
1. PBF	B2S9M3	GTPase Der	0.00e+00	4.93e-43	1.18e-84	0.6581
1. PBF	Q1IHC2	tRNA modification GTPase MnmE	2.09e-03	2.72e-04	1.87e-13	0.7227
1. PBF	Q6KH82	tRNA modification GTPase MnmE	2.02e-03	4.78e-04	1.96e-15	0.6309
1. PBF	A5WBB6	tRNA modification GTPase MnmE	1.61e-03	5.09e-05	2.16e-13	0.6006
1. PBF	Q9PLM9	tRNA modification GTPase MnmE	4.35e-04	5.84e-05	7.90e-16	0.6902
1. PBF	B3QZ96	GTPase Der	0.00e+00	1.72e-70	1.11e-118	0.8246
1. PBF	Q57EY6	GTPase Der	2.22e-16	4.93e-43	1.18e-84	0.6586
1. PBF	A6W3V0	tRNA modification GTPase MnmE	3.06e-03	4.39e-05	1.06e-11	0.6669
1. PBF	B2USZ4	GTPase Der	0.00e+00	6.46e-49	1.47e-74	0.5847
1. PBF	Q03SA1	GTPase Der	0.00e+00	1.90e-71	5.13e-150	0.903
1. PBF	Q46HI4	tRNA modification GTPase MnmE	1.38e-04	3.26e-04	9.31e-12	0.7058
1. PBF	Q11TG8	tRNA modification GTPase MnmE	5.96e-03	6.75e-06	2.96e-12	0.7361
1. PBF	B1IIN2	GTPase Der	0.00e+00	7.87e-69	4.91e-131	0.9361
1. PBF	Q5HUK3	tRNA modification GTPase MnmE	2.68e-03	4.39e-04	4.80e-19	0.7016
1. PBF	B0V4V6	GTPase Der	0.00e+00	1.07e-36	4.34e-84	0.8445
1. PBF	Q4K6V3	GTPase Der	0.00e+00	6.95e-35	1.76e-89	0.8687
1. PBF	B2SF94	GTPase Der	0.00e+00	2.82e-48	7.38e-73	0.8162
1. PBF	Q04J64	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9281
1. PBF	B8ZMH4	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9223
1. PBF	Q6LU45	GTPase Der	0.00e+00	1.45e-41	1.33e-93	0.8361
1. PBF	Q7NS92	GTPase Der	0.00e+00	1.68e-34	1.62e-84	0.829
1. PBF	A8G3A3	GTPase Der	0.00e+00	2.81e-47	8.00e-105	0.7988
1. PBF	B1KLB1	GTPase Der	0.00e+00	4.70e-40	6.13e-87	0.8109
1. PBF	P96128	GTPase Der	0.00e+00	2.96e-48	4.51e-73	0.6531
1. PBF	Q8KPU2	tRNA modification GTPase MnmE	2.30e-04	1.10e-05	9.70e-19	0.7196
1. PBF	Q5KXT0	GTPase Der	0.00e+00	8.35e-71	1.45e-150	0.9065
1. PBF	Q7MNE7	GTPase Der	0.00e+00	1.38e-40	8.59e-92	0.8203
1. PBF	A3QCG6	GTPase Der	0.00e+00	2.94e-39	2.44e-88	0.8075
1. PBF	Q9JWB7	tRNA modification GTPase MnmE	1.61e-03	7.46e-05	2.72e-11	0.6878
1. PBF	Q6YPI0	tRNA modification GTPase MnmE	6.14e-04	4.02e-05	2.67e-18	0.7159
1. PBF	Q040F3	tRNA modification GTPase MnmE	2.79e-04	6.83e-05	8.31e-14	0.6569
1. PBF	P64065	GTPase Der	0.00e+00	1.82e-69	3.33e-143	0.9292
1. PBF	B0TZQ0	GTPase Der	0.00e+00	5.26e-45	1.51e-74	0.8204
1. PBF	A1WUL5	GTPase Der	0.00e+00	2.58e-35	1.75e-86	0.7669
1. PBF	B7HHQ7	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9122
1. PBF	Q6D280	GTPase Der	0.00e+00	1.00e-38	1.04e-88	0.8608
1. PBF	Q8UD28	GTPase Der	0.00e+00	2.38e-44	4.34e-82	0.7221
1. PBF	Q17WL7	GTPase Der	0.00e+00	1.77e-48	4.41e-70	0.6079
1. PBF	Q73AZ1	GTPase Der	0.00e+00	6.19e-70	1.08e-154	0.9325
1. PBF	P47571	GTPase Der	0.00e+00	2.41e-59	8.36e-132	0.9075
1. PBF	Q30YQ7	tRNA modification GTPase MnmE	1.06e-03	1.82e-03	3.02e-10	0.779
1. PBF	Q74H94	tRNA modification GTPase MnmE	2.36e-04	6.76e-05	7.27e-16	0.606
1. PBF	Q46ZI7	GTPase Der	0.00e+00	1.60e-55	1.86e-97	0.7836
1. PBF	A6VV10	GTPase Der	0.00e+00	4.44e-58	4.04e-101	0.8346
1. PBF	Q1J8C9	GTPase Der	0.00e+00	1.38e-69	8.98e-143	0.9268
1. PBF	A7MZE5	GTPase Der	0.00e+00	1.10e-39	4.75e-91	0.7498
1. PBF	Q3KKZ1	GTPase Der	0.00e+00	9.31e-40	1.75e-69	0.5599
1. PBF	A1JT87	tRNA modification GTPase MnmE	3.40e-03	3.02e-05	6.69e-12	0.633
1. PBF	Q31CZ2	tRNA modification GTPase MnmE	2.19e-04	5.05e-04	4.54e-10	0.6817
1. PBF	B2UMV5	GTPase Der	0.00e+00	2.30e-52	9.29e-96	0.5864
1. PBF	Q13SH7	tRNA modification GTPase MnmE	2.17e-03	2.27e-03	9.35e-14	0.6623
1. PBF	Q30TK8	GTPase Der	0.00e+00	3.91e-30	1.44e-58	0.5976
1. PBF	Q725L9	GTPase Der	0.00e+00	9.31e-40	3.73e-52	0.5773
1. PBF	P64060	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9305
1. PBF	Q31CE7	GTPase Der	0.00e+00	1.69e-50	7.82e-105	0.6947
1. PBF	Q1RK21	GTPase Der	0.00e+00	5.23e-54	5.23e-95	0.6018
1. PBF	A3CNB0	tRNA modification GTPase MnmE	3.37e-04	7.84e-07	2.83e-20	0.4342
1. PBF	Q72VY6	tRNA modification GTPase MnmE	1.74e-03	4.31e-04	2.86e-10	0.7238
1. PBF	Q7URJ8	GTPase Der	0.00e+00	3.89e-50	2.07e-89	0.7163
1. PBF	B0CK66	GTPase Der	0.00e+00	7.50e-43	1.65e-84	0.6663
1. PBF	B4SED0	GTPase Der	0.00e+00	3.02e-66	4.96e-111	0.6845
1. PBF	A0LE48	tRNA modification GTPase MnmE	2.80e-04	1.74e-02	2.36e-12	0.6434
1. PBF	B7JGY9	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9094
1. PBF	A3M215	GTPase Der	0.00e+00	1.07e-36	4.34e-84	0.8569
1. PBF	A8GHW1	GTPase Der	0.00e+00	8.71e-38	1.00e-88	0.838
1. PBF	Q8DF02	GTPase Der	0.00e+00	1.64e-40	8.23e-92	0.8302
1. PBF	Q1CK87	GTPase Der	0.00e+00	2.02e-36	7.33e-88	0.8557
1. PBF	A2RM49	GTPase Der	0.00e+00	3.35e-69	2.28e-139	0.9165
1. PBF	B1X0B0	GTPase Der	0.00e+00	3.89e-50	1.49e-108	0.697
1. PBF	C3L0M1	GTPase Der	0.00e+00	5.47e-67	1.35e-131	0.9358
1. PBF	Q3MBM5	tRNA modification GTPase MnmE	4.93e-04	6.19e-05	3.51e-19	0.7059
1. PBF	Q2IXA7	GTPase Der	0.00e+00	5.83e-50	2.39e-89	0.6251
1. PBF	A6U1U3	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9323
1. PBF	Q5M1D9	GTPase Der	0.00e+00	6.60e-66	2.76e-142	0.9251
1. PBF	Q4UMV9	GTPase Der	0.00e+00	4.58e-59	1.78e-99	0.597
1. PBF	A3DHY8	tRNA modification GTPase MnmE	2.59e-04	1.85e-05	4.45e-17	0.7426
1. PBF	Q3BTW0	GTPase Der	0.00e+00	1.56e-38	6.82e-88	0.8285
1. PBF	Q3AG56	tRNA modification GTPase MnmE	4.17e-04	1.04e-04	9.77e-14	0.6536
1. PBF	C1FSU2	GTPase Der	0.00e+00	2.00e-67	5.19e-131	0.9399
1. PBF	Q2LSF6	tRNA modification GTPase MnmE	3.12e-04	1.68e-04	1.88e-12	0.7908
1. PBF	A9N205	GTPase Der	0.00e+00	2.23e-39	9.71e-92	0.8309
1. PBF	Q1MPF1	tRNA modification GTPase MnmE	2.35e-04	2.41e-04	1.92e-09	0.7229
1. PBF	Q9JZY1	GTPase Der	0.00e+00	5.24e-21	3.96e-87	0.8314
1. PBF	A4ITX1	tRNA modification GTPase MnmE	3.37e-04	2.19e-05	6.47e-19	0.7108
1. PBF	A9AH00	GTPase Der	0.00e+00	3.06e-55	1.94e-98	0.8158
1. PBF	Q24VA2	GTPase Der	0.00e+00	1.76e-62	2.63e-141	0.9546
1. PBF	Q3A4Q5	GTPase Der	0.00e+00	6.01e-60	6.99e-123	0.8816
1. PBF	Q0HX53	GTPase Der	0.00e+00	5.50e-38	3.19e-86	0.814
1. PBF	B8E9T1	GTPase Der	0.00e+00	3.43e-37	8.10e-87	0.8149
1. PBF	Q895X8	GTPase Der	0.00e+00	2.12e-68	2.19e-132	0.9417
1. PBF	A1W581	GTPase Der	0.00e+00	2.28e-53	1.48e-81	0.8044
1. PBF	Q5N638	tRNA modification GTPase MnmE	2.29e-04	1.16e-05	5.87e-18	0.7303
1. PBF	B0BUT3	GTPase Der	0.00e+00	7.55e-57	4.25e-98	0.8006
1. PBF	A5IXJ1	tRNA modification GTPase MnmE	1.98e-03	1.36e-05	9.09e-16	0.3994
1. PBF	A1VNF8	GTPase Der	0.00e+00	6.82e-52	1.88e-91	0.774
1. PBF	A0KJ48	GTPase Der	0.00e+00	2.09e-39	2.18e-93	0.824
1. PBF	A5CDT2	GTPase Der	0.00e+00	4.60e-50	3.83e-76	0.8229
1. PBF	A0KBN1	tRNA modification GTPase MnmE	2.63e-03	8.76e-03	3.53e-13	0.7074
1. PBF	Q9KTW7	GTPase Der	0.00e+00	3.13e-39	4.34e-96	0.8231
1. PBF	Q3ICZ9	GTPase Der	0.00e+00	7.67e-43	1.43e-91	0.8278
1. PBF	Q17ZA7	tRNA modification GTPase MnmE	4.68e-03	5.90e-05	2.69e-22	0.4272
1. PBF	Q8Y026	GTPase Der	0.00e+00	1.11e-57	2.03e-97	0.7768
1. PBF	A4VWD1	tRNA modification GTPase MnmE	3.94e-04	3.34e-06	7.44e-19	0.4729
1. PBF	A7GVP7	tRNA modification GTPase MnmE	2.30e-04	1.46e-06	3.92e-18	0.7342
1. PBF	Q7WHN4	GTPase Der	0.00e+00	3.23e-52	1.15e-92	0.8368
1. PBF	P74120	GTPase Der	0.00e+00	4.28e-50	3.06e-113	0.6375
1. PBF	Q0BEX1	GTPase Der	0.00e+00	9.25e-56	6.40e-99	0.8224
1. PBF	Q0SPQ3	tRNA modification GTPase MnmE	4.23e-03	1.38e-04	4.14e-18	0.6862
1. PBF	P64061	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9345
1. PBF	A7MGU7	GTPase Der	0.00e+00	2.33e-38	9.22e-92	0.8282
1. PBF	B4RKD2	GTPase Der	0.00e+00	2.61e-19	4.20e-85	0.8227
1. PBF	Q15R60	GTPase Der	0.00e+00	8.02e-40	1.10e-88	0.7686
1. PBF	Q1MDD6	GTPase Der	0.00e+00	8.91e-44	4.00e-87	0.5843
1. PBF	C3MG60	GTPase Der	0.00e+00	5.63e-45	1.47e-83	0.6944
1. PBF	Q5HFU8	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9334
1. PBF	A4IQA2	GTPase Der	0.00e+00	3.09e-70	4.43e-152	0.9071
1. PBF	B6I583	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8338
1. PBF	O83561	tRNA modification GTPase MnmE	3.48e-04	6.02e-05	2.35e-11	0.6683
1. PBF	Q039G4	GTPase Der	0.00e+00	6.02e-70	9.79e-148	0.8562
1. PBF	B6J7Q3	GTPase Der	0.00e+00	8.47e-59	5.52e-84	0.8652
1. PBF	Q5WAG3	tRNA modification GTPase MnmE	1.58e-04	6.51e-05	1.81e-14	0.7198
1. PBF	A4G4K6	GTPase Der	0.00e+00	8.78e-57	7.25e-95	0.8084
1. PBF	A5IWD7	tRNA modification GTPase MnmE	3.18e-04	2.24e-06	4.18e-16	0.4074
1. PBF	B1LNG6	GTPase Der	0.00e+00	9.22e-39	8.26e-92	0.8392
1. PBF	C1CM45	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9259
1. PBF	A4WUI6	GTPase Der	0.00e+00	2.98e-44	3.55e-72	0.6186
1. PBF	A7NN19	tRNA modification GTPase MnmE	1.18e-03	9.79e-05	1.52e-14	0.4065
1. PBF	Q9RS19	GTPase Der	0.00e+00	1.52e-58	1.43e-99	0.573
1. PBF	Q9Z768	tRNA modification GTPase MnmE	6.27e-04	5.33e-06	2.15e-16	0.3842
1. PBF	Q04KR8	tRNA modification GTPase MnmE	1.54e-04	2.27e-06	3.86e-19	0.7334
1. PBF	A4VX53	GTPase Der	0.00e+00	1.85e-68	3.25e-140	0.9299
1. PBF	B5BAY9	GTPase Der	0.00e+00	3.41e-39	3.74e-93	0.8253
1. PBF	Q5QYB3	GTPase Der	0.00e+00	5.82e-41	5.32e-97	0.829
1. PBF	Q7V491	tRNA modification GTPase MnmE	2.90e-04	3.17e-04	4.18e-09	0.6865
1. PBF	A6TCD0	GTPase Der	0.00e+00	2.82e-39	2.37e-95	0.8258
1. PBF	Q2K5L2	GTPase Der	0.00e+00	8.98e-46	4.39e-88	0.6766
1. PBF	Q0I6N5	tRNA modification GTPase MnmE	2.82e-04	3.80e-03	2.16e-17	0.7362
1. PBF	A4JEN6	GTPase Der	0.00e+00	2.21e-55	2.99e-98	0.8274
1. PBF	Q8DY73	GTPase Der	0.00e+00	2.94e-68	2.03e-140	0.9208
1. PBF	B0C1P2	GTPase Der	0.00e+00	2.47e-52	4.48e-109	0.8182
1. PBF	Q21W32	GTPase Der	0.00e+00	3.19e-49	5.04e-94	0.7999
1. PBF	P9WNL2	GTPase Der	0.00e+00	3.26e-40	3.24e-88	0.6012
1. PBF	B4S433	GTPase Der	0.00e+00	2.35e-61	1.53e-108	0.7227
1. PBF	A3PJF0	GTPase Der	0.00e+00	3.56e-44	1.03e-71	0.6195
1. PBF	A7HYV8	GTPase Der	0.00e+00	7.44e-49	6.90e-84	0.6212
1. PBF	Q9XCI8	GTPase Der	0.00e+00	3.41e-39	3.74e-93	0.8447
1. PBF	Q828Y7	GTPase Der	0.00e+00	6.91e-25	3.12e-89	0.8609
1. PBF	Q87B41	GTPase Der	0.00e+00	1.37e-39	8.95e-85	0.8135
1. PBF	Q02RV3	GTPase Der	0.00e+00	1.75e-34	1.07e-89	0.8574
1. PBF	A1VUS4	tRNA modification GTPase MnmE	8.37e-04	5.44e-04	5.02e-09	0.6643
1. PBF	Q1Q7V4	tRNA modification GTPase MnmE	1.20e-03	3.78e-04	6.06e-16	0.6668
1. PBF	A5CY46	tRNA modification GTPase MnmE	4.51e-04	1.36e-05	1.66e-18	0.6841
1. PBF	A7NAB1	GTPase Der	0.00e+00	1.25e-47	6.23e-73	0.786
1. PBF	Q9PLM3	GTPase Der	0.00e+00	6.62e-41	6.59e-74	0.5706
1. PBF	B2A470	tRNA modification GTPase MnmE	1.52e-04	1.41e-04	1.62e-16	0.767
1. PBF	B5E756	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9188
1. PBF	C1EN01	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.908
1. PBF	C1A8T3	GTPase Der	0.00e+00	3.69e-65	6.13e-110	0.8565
1. PBF	A9R7Z8	GTPase Der	0.00e+00	2.02e-36	7.33e-88	0.8622
1. PBF	B7KHD2	GTPase Der	0.00e+00	1.16e-50	2.89e-114	0.7475
1. PBF	A3N480	tRNA modification GTPase MnmE	2.35e-03	1.99e-03	9.70e-13	0.6463
1. PBF	Q4ZX19	GTPase Der	0.00e+00	1.90e-33	9.13e-86	0.8439
1. PBF	Q97ID7	GTPase Der	0.00e+00	7.17e-67	1.26e-127	0.8659
1. PBF	Q1LU74	GTPase Der	0.00e+00	1.52e-44	3.28e-83	0.8277
1. PBF	Q9TLX6	Probable tRNA modification GTPase MnmE	9.55e-05	5.62e-07	4.97e-13	0.7794
1. PBF	Q7VE01	tRNA modification GTPase MnmE	2.60e-04	8.63e-04	1.01e-11	0.6908
1. PBF	Q5X522	GTPase Der	0.00e+00	1.25e-42	8.69e-100	0.8002
1. PBF	A5UID5	tRNA modification GTPase MnmE	2.23e-03	1.67e-05	8.17e-12	0.6045
1. PBF	B8D8C1	GTPase Der	0.00e+00	1.21e-53	1.86e-73	0.8097
1. PBF	Q3B1B4	tRNA modification GTPase MnmE	4.42e-04	7.18e-04	1.41e-15	0.3986
1. PBF	O51830	tRNA modification GTPase MnmE	9.46e-04	1.94e-05	4.58e-12	0.6616
1. PBF	Q07LA7	GTPase Der	0.00e+00	1.58e-47	1.46e-92	0.79
1. PBF	A1BHZ8	GTPase Der	0.00e+00	1.79e-64	4.03e-115	0.7839
1. PBF	B1YQJ5	tRNA modification GTPase MnmE	8.38e-04	3.10e-03	1.41e-12	0.674
1. PBF	A8LYU3	GTPase Der	0.00e+00	2.87e-42	1.35e-86	0.6202
1. PBF	B5R578	GTPase Der	0.00e+00	3.20e-39	4.54e-93	0.8414
1. PBF	Q2Y6F9	GTPase Der	0.00e+00	4.02e-38	3.52e-94	0.8177
1. PBF	Q7U3V6	tRNA modification GTPase MnmE	1.38e-02	6.49e-04	4.72e-17	0.6737
1. PBF	A4W3F7	GTPase Der	0.00e+00	1.85e-68	3.25e-140	0.926
1. PBF	A3PBA9	GTPase Der	0.00e+00	2.80e-46	1.36e-104	0.794
1. PBF	A5IZG5	GTPase Der	0.00e+00	2.11e-62	2.55e-125	0.8233
1. PBF	A1KJD0	GTPase Der	0.00e+00	3.26e-40	3.24e-88	0.6031
1. PBF	A1URU0	GTPase Der	0.00e+00	7.80e-49	2.04e-90	0.6148
1. PBF	Q5L4W4	GTPase Der	0.00e+00	1.86e-49	1.39e-82	0.5599
1. PBF	C4K7P4	tRNA modification GTPase MnmE	1.72e-03	3.56e-06	8.01e-12	0.6217
1. PBF	Q8EWH6	GTPase Der	0.00e+00	4.05e-67	6.48e-142	0.5941
1. PBF	B7UWJ2	GTPase Der	0.00e+00	6.93e-34	3.96e-91	0.8508
1. PBF	Q12AC2	GTPase Der	0.00e+00	3.85e-49	8.76e-88	0.7674
1. PBF	A4IXH0	GTPase Der	0.00e+00	4.89e-47	1.83e-73	0.7855
1. PBF	B0KPJ1	GTPase Der	0.00e+00	1.33e-32	1.48e-91	0.8203
1. PBF	Q81JD9	tRNA modification GTPase MnmE	2.53e-04	4.03e-06	1.77e-16	0.7143
1. PBF	B8HSJ3	tRNA modification GTPase MnmE	2.43e-04	4.26e-05	1.78e-17	0.7424
1. PBF	A9BMU9	GTPase Der	0.00e+00	6.82e-53	9.01e-82	0.8266
1. PBF	A5VJK4	GTPase Der	0.00e+00	1.30e-70	4.40e-149	0.8962
1. PBF	B2VE93	GTPase Der	0.00e+00	2.88e-34	4.18e-90	0.844
1. PBF	A5IMD9	GTPase Der	0.00e+00	6.56e-59	5.80e-80	0.5754
1. PBF	P66972	tRNA modification GTPase MnmE	3.06e-04	2.24e-06	4.18e-16	0.6513
1. PBF	Q8PKY6	GTPase Der	0.00e+00	1.00e-38	6.74e-88	0.7981
1. PBF	Q9ZCP6	GTPase Der	0.00e+00	1.65e-58	5.88e-96	0.5871
1. PBF	Q740D6	GTPase Der	0.00e+00	3.31e-36	2.44e-90	0.7878
1. PBF	B8I442	GTPase Der	0.00e+00	2.47e-65	2.69e-133	0.9139
1. PBF	Q135K8	GTPase Der	0.00e+00	1.09e-47	3.95e-90	0.6365
1. PBF	B0JFL6	GTPase Der	0.00e+00	1.42e-54	9.57e-109	0.603
1. PBF	A4TMT3	GTPase Der	0.00e+00	2.02e-36	7.33e-88	0.8439
1. PBF	B5RCY8	GTPase Der	0.00e+00	1.09e-38	4.84e-93	0.8486
1. PBF	Q89MZ0	GTPase Der	0.00e+00	2.47e-52	1.52e-91	0.7269
1. PBF	A1VER5	tRNA modification GTPase MnmE	1.20e-03	5.38e-06	6.57e-12	0.7006
1. PBF	P0DA91	GTPase Der	0.00e+00	4.69e-68	3.02e-143	0.9293
1. PBF	Q3AGU7	tRNA modification GTPase MnmE	2.79e-04	1.36e-03	6.34e-16	0.5837
1. PBF	A8MKR9	tRNA modification GTPase MnmE	2.11e-03	1.06e-04	6.47e-17	0.3984
1. PBF	Q0AE46	GTPase Der	0.00e+00	6.76e-40	1.37e-84	0.8175
1. PBF	B2K868	tRNA modification GTPase MnmE	2.41e-03	2.78e-05	2.19e-11	0.6224
1. PBF	A8HVL5	GTPase Der	0.00e+00	9.92e-48	1.82e-88	0.5884
1. PBF	C3L9F4	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9112
1. PBF	Q38WW3	GTPase Der	0.00e+00	1.19e-67	2.46e-146	0.8988
1. PBF	Q7V395	tRNA modification GTPase MnmE	1.00e-03	1.27e-03	3.45e-08	0.6947
1. PBF	A3MK70	GTPase Der	0.00e+00	3.12e-54	2.13e-97	0.8145
1. PBF	A0Q534	GTPase Der	0.00e+00	6.16e-47	8.22e-74	0.7779
1. PBF	Q9CHH6	GTPase Der	0.00e+00	9.65e-70	2.74e-137	0.904
1. PBF	A0M5P1	GTPase Der	0.00e+00	2.61e-65	1.07e-112	0.8757
1. PBF	Q9ZL09	GTPase Der	0.00e+00	2.13e-47	1.94e-72	0.5982
1. PBF	B0VKR4	GTPase Der	0.00e+00	2.64e-36	4.94e-84	0.8441
1. PBF	A6WQP3	GTPase Der	0.00e+00	3.43e-37	8.10e-87	0.8146
1. PBF	Q2SDW8	GTPase Der	0.00e+00	4.98e-29	5.34e-96	0.8375
1. PBF	B0SJ24	tRNA modification GTPase MnmE	1.05e-03	1.73e-04	4.07e-09	0.7177
1. PBF	Q7NBV2	GTPase Der	0.00e+00	1.14e-54	2.16e-141	0.6001
1. PBF	O67749	GTPase Der	0.00e+00	1.11e-52	3.92e-100	0.5688
1. PBF	Q9ZJG6	tRNA modification GTPase MnmE	1.95e-04	1.83e-04	2.76e-22	0.4551
1. PBF	A7ZAW1	tRNA modification GTPase MnmE	2.74e-04	5.91e-06	2.06e-15	0.4037
1. PBF	Q4A647	tRNA modification GTPase MnmE	2.93e-04	3.48e-04	1.59e-17	0.5864
1. PBF	Q8KAS1	tRNA modification GTPase MnmE	9.00e-04	9.46e-04	1.75e-13	0.4187
1. PBF	B4EZS9	GTPase Der	0.00e+00	1.66e-39	3.61e-85	0.8442
1. PBF	C3PPD1	GTPase Der	0.00e+00	8.14e-57	1.54e-98	0.7926
1. PBF	Q8R9J1	GTPase Der	0.00e+00	1.39e-62	6.04e-146	0.9224
1. PBF	Q2A515	GTPase Der	0.00e+00	1.25e-47	6.23e-73	0.809
1. PBF	Q89A14	GTPase Der	0.00e+00	5.43e-42	1.18e-52	0.8079
1. PBF	Q5FKF4	GTPase Der	0.00e+00	2.24e-72	1.33e-142	0.9254
1. PBF	Q1JIH4	GTPase Der	0.00e+00	1.38e-69	8.98e-143	0.9267
1. PBF	Q65VC3	tRNA modification GTPase MnmE	1.81e-03	2.95e-06	1.56e-14	0.6148
1. PBF	C6E0Y6	GTPase Der	0.00e+00	3.77e-68	1.04e-122	0.8908
1. PBF	Q1GHZ2	GTPase Der	0.00e+00	1.17e-42	1.79e-76	0.6087
1. PBF	A5G9V3	tRNA modification GTPase MnmE	2.44e-03	6.37e-04	3.03e-15	0.6842
1. PBF	A2BUG6	tRNA modification GTPase MnmE	1.66e-03	2.23e-03	6.45e-11	0.781
1. PBF	C4ZX86	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8404
1. PBF	B3PVJ6	GTPase Der	9.99e-16	5.08e-46	6.70e-89	0.6276
1. PBF	Q4FTW3	GTPase Der	0.00e+00	9.00e-33	3.60e-97	0.834
1. PBF	B1I6S2	tRNA modification GTPase MnmE	2.23e-04	5.54e-03	1.34e-20	0.4132
1. PBF	Q0AB37	GTPase Der	0.00e+00	1.11e-44	5.69e-94	0.7896
1. PBF	A7GGA7	GTPase Der	0.00e+00	8.56e-68	3.47e-131	0.9439
1. PBF	B2JIU7	GTPase Der	0.00e+00	4.52e-52	1.14e-94	0.8173
1. PBF	B2K9P6	GTPase Der	0.00e+00	5.98e-36	7.57e-88	0.8591
1. PBF	B5EE25	GTPase Der	0.00e+00	1.85e-68	7.06e-122	0.9017
1. PBF	A7ZCZ1	tRNA modification GTPase MnmE	2.31e-04	1.06e-04	1.09e-18	0.6939
1. PBF	B4T0P5	GTPase Der	0.00e+00	3.41e-39	3.74e-93	0.8212
1. PBF	A9KWW9	GTPase Der	0.00e+00	3.43e-37	8.10e-87	0.8185
1. PBF	A1T0N0	tRNA modification GTPase MnmE	1.37e-03	8.88e-05	6.69e-14	0.6341
1. PBF	A7FPM0	tRNA modification GTPase MnmE	2.16e-02	2.35e-05	1.82e-17	0.6188
1. PBF	B1LBI4	GTPase Der	0.00e+00	3.46e-59	4.12e-79	0.5753
1. PBF	A9NBA7	tRNA modification GTPase MnmE	1.22e-03	3.52e-06	1.44e-15	0.7049
1. PBF	Q21KS9	GTPase Der	0.00e+00	4.93e-35	2.54e-85	0.8604
1. PBF	A1SU43	GTPase Der	0.00e+00	1.01e-39	5.68e-89	0.8583
1. PBF	Q256D0	tRNA modification GTPase MnmE	8.39e-04	1.09e-06	9.18e-16	0.6345
1. PBF	B0TLI8	GTPase Der	0.00e+00	1.70e-37	4.64e-87	0.8226
1. PBF	A5VYT9	GTPase Der	0.00e+00	2.36e-33	8.21e-93	0.7563
1. PBF	B7HL14	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9074
1. PBF	A4WD89	GTPase Der	0.00e+00	1.23e-39	2.92e-93	0.8462
1. PBF	Q821L2	tRNA modification GTPase MnmE	7.05e-04	9.61e-07	4.01e-16	0.6642
1. PBF	Q8Z4P6	GTPase Der	0.00e+00	3.48e-39	4.17e-93	0.8537
1. PBF	B1JDV4	GTPase Der	0.00e+00	3.88e-32	1.84e-93	0.8103
1. PBF	B8DBY9	GTPase Der	0.00e+00	6.91e-72	1.47e-155	0.8925
1. PBF	Q6AGF6	GTPase Der	0.00e+00	6.41e-27	4.70e-96	0.8003
1. PBF	A5GPA1	tRNA modification GTPase MnmE	2.09e-04	9.90e-04	5.89e-14	0.6885
1. PBF	Q92GU2	GTPase Der	0.00e+00	4.67e-58	1.43e-98	0.6413
1. PBF	P0A6P6	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8428
1. PBF	Q5E768	GTPase Der	0.00e+00	2.38e-39	5.19e-94	0.7
1. PBF	A8MH56	GTPase Der	0.00e+00	3.26e-67	1.30e-143	0.8987
1. PBF	C4K2K1	GTPase Der	0.00e+00	8.60e-58	3.26e-99	0.665
1. PBF	Q9PQA7	GTPase Der	0.00e+00	9.89e-66	2.32e-140	0.686
1. PBF	A5IT03	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9284
1. PBF	A8Z454	GTPase Der	0.00e+00	1.33e-67	1.70e-153	0.9307
1. PBF	Q0T208	GTPase Der	0.00e+00	4.49e-39	3.18e-92	0.8402
1. PBF	A5EY43	tRNA modification GTPase MnmE	9.36e-04	3.02e-05	2.14e-12	0.5907
1. PBF	O25991	tRNA modification GTPase MnmE	2.45e-04	1.15e-04	4.63e-22	0.6196
1. PBF	A5VNV9	GTPase Der	0.00e+00	2.66e-44	5.19e-84	0.661
1. PBF	Q9PNX9	tRNA modification GTPase MnmE	3.12e-04	5.15e-04	1.58e-18	0.7174
1. PBF	Q5HCD7	tRNA modification GTPase MnmE	1.84e-02	1.16e-03	3.17e-06	0.5639
1. PBF	B8F4X7	GTPase Der	0.00e+00	8.01e-37	7.73e-87	0.8385
1. PBF	A2S2A6	GTPase Der	0.00e+00	3.12e-54	2.13e-97	0.825
1. PBF	B0BAF8	GTPase Der	0.00e+00	6.57e-39	4.99e-69	0.5643
1. PBF	Q04AY6	GTPase Der	0.00e+00	9.60e-73	1.71e-135	0.9146
1. PBF	Q1QTK4	GTPase Der	0.00e+00	1.13e-34	1.71e-78	0.7627
1. PBF	A7GWZ2	GTPase Der	0.00e+00	1.70e-53	3.35e-90	0.5799
1. PBF	Q7VJY2	tRNA modification GTPase MnmE	2.75e-04	3.79e-06	3.05e-15	0.5225
1. PBF	B9JZQ5	GTPase Der	0.00e+00	1.29e-46	3.31e-84	0.561
1. PBF	Q39BQ4	tRNA modification GTPase MnmE	3.14e-03	6.09e-03	5.57e-13	0.6623
1. PBF	B0SAE4	tRNA modification GTPase MnmE	2.06e-03	1.73e-04	4.07e-09	0.722
1. PBF	Q0C441	GTPase Der	0.00e+00	2.29e-35	7.56e-79	0.6929
1. PBF	A9IQH4	GTPase Der	0.00e+00	3.38e-47	6.63e-90	0.5938
1. PBF	B1HPM3	tRNA modification GTPase MnmE	2.23e-04	5.30e-05	1.12e-14	0.4141
1. PBF	A1APR9	GTPase Der	0.00e+00	3.66e-61	2.56e-121	0.8972
1. PBF	C1ANY6	GTPase Der	0.00e+00	3.26e-40	3.24e-88	0.6068
1. PBF	B1JT88	GTPase Der	0.00e+00	2.11e-54	5.76e-100	0.8284
1. PBF	B9K8E0	GTPase Der	0.00e+00	1.09e-60	5.51e-83	0.5755
1. PBF	A1K3Z3	GTPase Der	0.00e+00	1.54e-57	3.58e-90	0.8005
1. PBF	B9IVM6	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9081
1. PBF	A7IIE4	GTPase Der	0.00e+00	1.54e-46	1.53e-84	0.5699
1. PBF	Q03MB1	GTPase Der	0.00e+00	3.10e-66	3.28e-142	0.9254
1. PBF	A2C018	tRNA modification GTPase MnmE	2.50e-04	4.60e-04	2.46e-12	0.6369
1. PBF	Q49884	GTPase Der	0.00e+00	1.05e-36	7.82e-89	0.7505
1. PBF	A8H249	GTPase Der	0.00e+00	7.69e-37	1.33e-86	0.8207
1. PBF	Q630B8	tRNA modification GTPase MnmE	2.72e-04	5.55e-06	1.50e-16	0.7368
1. PBF	P25811	tRNA modification GTPase MnmE	2.19e-04	5.06e-06	2.43e-15	0.7215
1. PBF	Q88PJ3	GTPase Der	0.00e+00	8.49e-33	4.50e-93	0.8015
1. PBF	B1IBH5	tRNA modification GTPase MnmE	2.22e-04	2.04e-06	3.90e-19	0.7338
1. PBF	A9M8F4	GTPase Der	2.22e-16	3.86e-43	5.14e-84	0.6185
1. PBF	B2I7V0	GTPase Der	0.00e+00	1.37e-39	8.95e-85	0.8283
1. PBF	C5BLV6	GTPase Der	0.00e+00	1.46e-39	2.45e-89	0.8417
1. PBF	Q98RJ5	tRNA modification GTPase MnmE	4.42e-04	5.73e-06	7.99e-15	0.6414
1. PBF	Q1IEH7	GTPase Der	0.00e+00	1.43e-30	2.85e-93	0.8062
1. PBF	A9VMB3	GTPase Der	0.00e+00	4.56e-70	1.05e-153	0.8942
1. PBF	Q3J2Y1	GTPase Der	0.00e+00	3.56e-44	1.03e-71	0.6229
1. PBF	B2TXT6	GTPase Der	0.00e+00	7.07e-38	1.00e-91	0.8455
1. PBF	Q5WWG8	GTPase Der	0.00e+00	1.70e-42	4.85e-100	0.8211
1. PBF	Q6G988	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9339
1. PBF	A4J3P1	GTPase Der	0.00e+00	1.85e-68	3.37e-130	0.9441
1. PBF	A4SNZ8	GTPase Der	0.00e+00	1.44e-38	5.85e-93	0.8359
1. PBF	Q63US9	GTPase Der	0.00e+00	3.12e-54	2.13e-97	0.8192
1. PBF	Q8NQK6	GTPase Der	0.00e+00	4.99e-10	7.33e-92	0.5803
1. PBF	A7I145	tRNA modification GTPase MnmE	4.71e-03	8.02e-04	7.86e-14	0.4932
1. PBF	Q2FDE8	tRNA modification GTPase MnmE	2.13e-04	1.80e-06	4.14e-16	0.6161
1. PBF	Q1WTQ4	GTPase Der	0.00e+00	2.64e-68	3.81e-149	0.9074
1. PBF	A6QH24	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9319
1. PBF	B3DXK2	GTPase Der	0.00e+00	2.80e-46	3.54e-95	0.8512
1. PBF	B2I3F0	GTPase Der	0.00e+00	1.07e-36	4.34e-84	0.8512
1. PBF	B0V5S5	tRNA modification GTPase MnmE	1.19e-03	1.42e-05	1.16e-11	0.6988
1. PBF	B8HQE1	GTPase Der	0.00e+00	2.46e-49	1.38e-105	0.6221
1. PBF	Q31KP9	GTPase Der	0.00e+00	3.26e-51	6.93e-106	0.7871
1. PBF	A2SHB1	GTPase Der	0.00e+00	2.37e-57	1.59e-93	0.8267
1. PBF	B2A4M9	GTPase Der	0.00e+00	3.33e-63	3.44e-121	0.8166
1. PBF	A3MZC1	GTPase Der	0.00e+00	1.21e-38	2.14e-87	0.844
1. PBF	Q886Y6	GTPase Der	0.00e+00	9.98e-35	1.60e-86	0.8653
1. PBF	C0QT02	GTPase Der	0.00e+00	5.48e-53	3.12e-110	0.5884
1. PBF	B2S3E2	tRNA modification GTPase MnmE	2.49e-04	6.02e-05	2.35e-11	0.6164
1. PBF	A9IJ97	tRNA modification GTPase MnmE	1.28e-02	5.73e-05	2.62e-13	0.659
1. PBF	A4YUE1	GTPase Der	0.00e+00	6.66e-53	3.09e-89	0.7521
1. PBF	Q9RCA7	tRNA modification GTPase MnmE	3.07e-04	5.51e-05	1.54e-13	0.7203
1. PBF	Q13X32	GTPase Der	0.00e+00	3.92e-55	3.83e-94	0.8259
1. PBF	B2HRU9	GTPase Der	0.00e+00	2.15e-35	7.58e-89	0.7352
1. PBF	Q39FR3	GTPase Der	0.00e+00	1.86e-54	3.28e-99	0.8295
1. PBF	C1C8U6	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9231
1. PBF	A1V7D3	tRNA modification GTPase MnmE	2.19e-03	1.99e-03	9.70e-13	0.6455
1. PBF	A9KLX9	tRNA modification GTPase MnmE	3.25e-03	2.08e-05	1.16e-21	0.4549
1. PBF	Q1C0B3	tRNA modification GTPase MnmE	2.66e-03	2.99e-05	2.13e-11	0.6227
1. PBF	A8FEL8	GTPase Der	0.00e+00	5.34e-71	1.52e-152	0.9105
1. PBF	A8GPH5	GTPase Der	0.00e+00	7.02e-60	7.37e-98	0.6484
1. PBF	Q65I15	GTPase Der	0.00e+00	1.48e-68	2.37e-154	0.8925
1. PBF	Q62EM6	tRNA modification GTPase MnmE	2.17e-03	1.99e-03	9.70e-13	0.6843
1. PBF	B1XLH8	GTPase Der	0.00e+00	1.03e-50	2.25e-111	0.6058
1. PBF	B2J1L2	GTPase Der	0.00e+00	6.09e-48	1.40e-112	0.734
1. PBF	Q71Y78	GTPase Der	0.00e+00	6.91e-72	1.47e-155	0.9101
1. PBF	B4EAW5	GTPase Der	0.00e+00	1.33e-53	2.02e-99	0.8211
1. PBF	Q12PT0	GTPase Der	0.00e+00	2.20e-35	6.66e-86	0.8163
1. PBF	B3ETF1	GTPase Der	0.00e+00	6.00e-61	1.37e-116	0.7993
1. PBF	Q89WP4	tRNA modification GTPase MnmE	3.78e-03	1.79e-04	4.67e-08	0.5528
1. PBF	B1XXK9	GTPase Der	0.00e+00	9.32e-55	2.21e-82	0.8227
1. PBF	A8GT93	GTPase Der	0.00e+00	4.83e-56	5.63e-98	0.6483
1. PBF	P64064	GTPase Der	0.00e+00	1.82e-69	3.33e-143	0.9245
1. PBF	Q5XDR3	GTPase Der	0.00e+00	1.82e-69	3.33e-143	0.9249
1. PBF	Q6MB45	GTPase Der	0.00e+00	6.09e-31	7.34e-109	0.5636
1. PBF	Q47BS0	GTPase Der	0.00e+00	6.66e-52	1.77e-88	0.8123
1. PBF	A8LHW1	GTPase Der	0.00e+00	3.10e-41	1.21e-77	0.6723
1. PBF	B8GTN1	GTPase Der	0.00e+00	9.03e-39	1.72e-94	0.8415
1. PBF	B7H065	GTPase Der	0.00e+00	1.07e-36	4.34e-84	0.8614
1. PBF	A7FFZ3	GTPase Der	0.00e+00	2.02e-36	7.33e-88	0.8623
1. PBF	Q14GT5	GTPase Der	0.00e+00	3.60e-46	6.71e-73	0.8161
1. PBF	A4XHX9	GTPase Der	0.00e+00	1.01e-67	1.92e-124	0.9377
1. PBF	Q8CX52	tRNA modification GTPase MnmE	3.84e-03	1.27e-04	6.51e-13	0.6242
1. PBF	B2UVJ7	tRNA modification GTPase MnmE	2.17e-04	3.43e-05	1.62e-22	0.6354
1. PBF	P94612	tRNA modification GTPase MnmE	1.90e-03	3.52e-06	1.44e-15	0.6842
1. PBF	P64059	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9292
1. PBF	Q8G6A8	GTPase Der	0.00e+00	1.11e-43	4.68e-96	0.6441
1. PBF	B0U489	GTPase Der	0.00e+00	3.26e-40	9.16e-84	0.8202
1. PBF	Q8KBK3	GTPase Der	0.00e+00	1.22e-67	2.16e-107	0.9134
1. PBF	B3PDM5	GTPase Der	0.00e+00	6.78e-38	1.35e-87	0.8248
1. PBF	A3M8Y8	tRNA modification GTPase MnmE	1.41e-03	1.18e-05	1.18e-11	0.6892
1. PBF	Q0BAQ4	tRNA modification GTPase MnmE	3.14e-03	3.67e-03	1.43e-12	0.6757
1. PBF	B5XJW0	GTPase Der	0.00e+00	1.82e-69	3.33e-143	0.9279
1. PBF	A7GJN9	tRNA modification GTPase MnmE	2.19e-03	1.18e-05	9.24e-18	0.6139
1. PBF	Q2S6H2	tRNA modification GTPase MnmE	6.51e-04	1.17e-03	8.80e-11	0.6659
1. PBF	A3PAQ7	tRNA modification GTPase MnmE	6.45e-04	9.37e-04	2.74e-10	0.6775
1. PBF	A7HK07	tRNA modification GTPase MnmE	1.55e-03	3.90e-05	3.07e-13	0.7885
1. PBF	A9KFU3	GTPase Der	0.00e+00	8.47e-59	5.52e-84	0.8671
1. PBF	A3D6V5	GTPase Der	0.00e+00	7.69e-37	1.06e-86	0.8041
1. PBF	Q2Y5A9	tRNA modification GTPase MnmE	5.72e-04	8.55e-06	4.58e-14	0.6563
1. PBF	A7H372	tRNA modification GTPase MnmE	6.13e-04	4.69e-04	2.74e-20	0.7116
1. PBF	A5D1U6	GTPase Der	0.00e+00	6.43e-67	7.39e-126	0.9257
1. PBF	A8YV35	GTPase Der	0.00e+00	2.58e-72	4.90e-142	0.9384
1. PBF	Q73KN7	tRNA modification GTPase MnmE	1.69e-04	1.35e-03	4.26e-15	0.773
1. PBF	Q3JZR6	GTPase Der	0.00e+00	2.94e-68	2.03e-140	0.9164
1. PBF	B6IZN3	GTPase Der	0.00e+00	1.52e-59	3.73e-85	0.8482
1. PBF	B1JFV3	tRNA modification GTPase MnmE	1.27e-03	3.71e-05	7.31e-13	0.2724
1. PBF	Q39T85	GTPase Der	0.00e+00	7.76e-66	1.55e-124	0.9188
1. PBF	P44536	GTPase Der	0.00e+00	1.47e-38	2.28e-86	0.8376
1. PBF	A9KBS9	tRNA modification GTPase MnmE	5.12e-03	3.52e-06	1.44e-15	0.7156
1. PBF	B3R1J8	GTPase Der	0.00e+00	2.50e-55	7.14e-98	0.7763
1. PBF	Q9JV01	GTPase Der	0.00e+00	9.22e-21	9.16e-86	0.8336
1. PBF	A8AD75	GTPase Der	0.00e+00	2.33e-38	2.42e-91	0.8479
1. PBF	Q0SS66	GTPase Der	0.00e+00	2.51e-71	5.80e-134	0.8888
1. PBF	B2VCE7	tRNA modification GTPase MnmE	1.96e-03	9.69e-05	1.31e-13	0.6717
1. PBF	A8Z608	GTPase Der	0.00e+00	7.08e-59	1.32e-102	0.8082
1. PBF	P64062	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9242
1. PBF	Q88VZ6	GTPase Der	0.00e+00	1.14e-69	6.95e-144	0.902
1. PBF	B7N699	GTPase Der	0.00e+00	9.22e-39	8.26e-92	0.8477
1. PBF	A9WKE3	tRNA modification GTPase MnmE	4.36e-04	2.30e-05	1.54e-11	0.7635
1. PBF	P59569	tRNA modification GTPase MnmE	4.03e-03	1.70e-05	1.22e-09	0.7149
1. PBF	B8CKR5	GTPase Der	0.00e+00	6.64e-38	1.53e-86	0.8254
1. PBF	Q2NIG1	tRNA modification GTPase MnmE	3.51e-04	5.24e-05	2.44e-20	0.7144
1. PBF	A2BNY4	tRNA modification GTPase MnmE	6.22e-04	3.48e-04	1.48e-10	0.6723
1. PBF	B2FNR1	GTPase Der	0.00e+00	3.71e-39	2.81e-87	0.8177
1. PBF	B0URU2	tRNA modification GTPase MnmE	1.77e-03	3.79e-06	2.10e-12	0.6438
1. PBF	Q67NS9	GTPase Der	0.00e+00	2.09e-37	3.16e-135	0.893
1. PBF	Q8DS90	GTPase Der	0.00e+00	5.49e-64	5.78e-142	0.918
1. PBF	A1S859	GTPase Der	0.00e+00	5.79e-39	2.00e-85	0.8101
1. PBF	Q39ZT0	tRNA modification GTPase MnmE	3.83e-04	1.08e-03	2.09e-16	0.7705
1. PBF	P64063	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.9244
1. PBF	O51461	GTPase Der	0.00e+00	8.19e-60	8.98e-63	0.5614
1. PBF	Q68W59	GTPase Der	0.00e+00	3.91e-58	2.49e-92	0.6314
1. PBF	Q1QMP4	GTPase Der	0.00e+00	6.99e-52	2.57e-86	0.6118
1. PBF	A4JJ44	tRNA modification GTPase MnmE	2.71e-03	3.27e-03	7.95e-14	0.664
1. PBF	A3DAS7	tRNA modification GTPase MnmE	3.10e-03	1.49e-05	1.06e-12	0.6512
1. PBF	Q8YFH2	GTPase Der	0.00e+00	3.38e-43	1.35e-84	0.636
1. PBF	A5WI36	tRNA modification GTPase MnmE	4.28e-03	5.27e-06	1.37e-12	0.6091
1. PBF	B5ZBM9	GTPase Der	0.00e+00	1.29e-65	8.45e-145	0.8226
1. PBF	A2S8D8	tRNA modification GTPase MnmE	2.56e-03	1.99e-03	9.70e-13	0.6454
1. PBF	A0PSX2	GTPase Der	0.00e+00	6.90e-36	6.02e-88	0.735
1. PBF	A8FT74	GTPase Der	0.00e+00	1.19e-40	2.39e-85	0.8176
1. PBF	Q1CT35	GTPase Der	0.00e+00	3.51e-49	9.17e-74	0.5484
1. PBF	Q0TEX4	GTPase Der	0.00e+00	1.07e-38	1.75e-91	0.8359
1. PBF	Q24M98	tRNA modification GTPase MnmE	2.42e-04	4.18e-05	1.26e-17	0.6788
1. PBF	Q28QC6	GTPase Der	0.00e+00	1.33e-43	1.15e-80	0.793
1. PBF	Q6G0H5	GTPase Der	0.00e+00	1.69e-46	7.61e-82	0.6035
1. PBF	Q48TS5	tRNA modification GTPase MnmE	1.63e-03	3.41e-06	1.04e-17	0.5308
1. PBF	B8G2P9	GTPase Der	0.00e+00	1.21e-62	1.10e-141	0.9558
1. PBF	Q2GA15	GTPase Der	0.00e+00	3.76e-51	2.90e-79	0.5485
1. PBF	Q2RIV4	GTPase Der	0.00e+00	3.20e-68	1.08e-140	0.9275
1. PBF	A1QYX4	tRNA modification GTPase MnmE	3.79e-04	4.73e-04	1.25e-13	0.7786
1. PBF	Q6G5J7	GTPase Der	0.00e+00	4.33e-46	7.16e-87	0.6786
1. PBF	A5WGA8	GTPase Der	0.00e+00	1.67e-30	2.19e-97	0.8005
1. PBF	B9MFY0	GTPase Der	0.00e+00	5.90e-53	7.62e-82	0.7541
1. PBF	A7X2I1	GTPase Der	0.00e+00	6.31e-69	6.91e-155	0.9256
1. PBF	A9NDV6	GTPase Der	0.00e+00	8.47e-59	5.52e-84	0.8708
1. PBF	B0S1N2	GTPase Der	0.00e+00	2.28e-64	1.19e-132	0.958
1. PBF	Q92A71	GTPase Der	0.00e+00	4.79e-72	5.08e-154	0.905
1. PBF	Q6N586	GTPase Der	0.00e+00	7.44e-49	5.67e-92	0.7594
1. PBF	Q1JNC4	GTPase Der	0.00e+00	1.82e-69	3.33e-143	0.9286
1. PBF	Q8E3T9	GTPase Der	0.00e+00	3.17e-67	6.51e-140	0.9173
1. PBF	B7LCQ1	GTPase Der	0.00e+00	9.82e-39	9.20e-92	0.8374
1. PBF	A0KQZ6	tRNA modification GTPase MnmE	1.96e-03	1.90e-06	6.79e-12	0.6629
1. PBF	A1TA72	GTPase Der	0.00e+00	2.82e-33	3.41e-85	0.7521
1. PBF	Q5HP70	GTPase Der	0.00e+00	5.50e-69	3.38e-152	0.9276
1. PBF	Q67J33	tRNA modification GTPase MnmE	9.88e-04	6.14e-04	1.34e-12	0.7787
1. PBF	A5FIR0	GTPase Der	0.00e+00	2.22e-64	4.09e-116	0.8876
1. PBF	Q8FTK5	GTPase Der	0.00e+00	6.86e-08	8.59e-92	0.5872
1. PBF	A1R5C7	GTPase Der	0.00e+00	6.05e-24	1.76e-90	0.8676
1. PBF	Q5KU57	tRNA modification GTPase MnmE	7.36e-04	3.57e-05	1.50e-18	0.3875
1. PBF	B6EGZ1	GTPase Der	0.00e+00	5.50e-38	1.14e-95	0.781
1. PBF	Q49XS9	GTPase Der	0.00e+00	1.42e-70	1.50e-155	0.9053
1. PBF	P0C8N9	tRNA modification GTPase MnmE	4.69e-04	8.12e-06	7.20e-17	0.7606
1. PBF	A4X692	GTPase Der	0.00e+00	5.12e-40	3.29e-83	0.5957
1. PBF	Q6MTJ6	GTPase Der	0.00e+00	2.45e-93	0.0	0.9745
1. PBF	Q1C5J2	GTPase Der	0.00e+00	2.02e-36	7.33e-88	0.8507
1. PBF	A6WW65	GTPase Der	0.00e+00	3.46e-41	1.07e-87	0.643
1. PBF	B1KUB2	tRNA modification GTPase MnmE	2.82e-03	2.62e-05	1.84e-17	0.6094
1. PBF	O25505	GTPase Der	0.00e+00	1.57e-48	1.83e-74	0.5831
1. PBF	Q85FG3	Probable tRNA modification GTPase MnmE	2.45e-04	5.06e-06	5.00e-12	0.6767
1. PBF	B6YQB9	GTPase Der	0.00e+00	1.68e-70	3.76e-110	0.8723
1. PBF	Q2NS44	GTPase Der	0.00e+00	3.27e-39	2.84e-91	0.8465
1. PBF	B8CWY9	GTPase Der	0.00e+00	2.79e-68	6.54e-129	0.9107
1. PBF	A3NA49	GTPase Der	0.00e+00	3.12e-54	2.13e-97	0.8263
1. PBF	B7MHZ6	GTPase Der	0.00e+00	1.26e-38	1.05e-91	0.8534
1. PBF	Q0AE55	tRNA modification GTPase MnmE	4.80e-03	8.04e-06	6.07e-17	0.6394
1. PBF	B1XKC3	tRNA modification GTPase MnmE	3.98e-04	2.57e-04	1.12e-17	0.6974
1. PBF	Q256C5	GTPase Der	0.00e+00	3.35e-42	1.41e-80	0.5497
1. PBF	Q9RL97	tRNA modification GTPase MnmE	8.55e-04	5.62e-05	8.67e-16	0.7307
1. PBF	Q2P2T5	GTPase Der	0.00e+00	1.70e-38	5.13e-87	0.78
1. PBF	A1KCP8	tRNA modification GTPase MnmE	1.09e-03	9.06e-05	2.15e-13	0.6332
1. PBF	Q899S2	tRNA modification GTPase MnmE	4.78e-03	6.48e-06	1.15e-16	0.6561
1. PBF	Q04W28	tRNA modification GTPase MnmE	1.07e-03	3.85e-04	2.46e-10	0.7447
1. PBF	A3DE77	GTPase Der	0.00e+00	1.40e-65	2.29e-136	0.9357
1. PBF	Q03WN4	GTPase Der	0.00e+00	1.05e-69	5.27e-141	0.8977
1. PBF	Q7WDI4	tRNA modification GTPase MnmE	1.17e-02	1.02e-04	2.06e-11	0.6396
1. PBF	A6V0W4	GTPase Der	0.00e+00	4.21e-34	1.44e-90	0.8412
1. PBF	Q9HXJ8	GTPase Der	0.00e+00	4.21e-34	1.44e-90	0.8567
1. PBF	Q821L7	GTPase Der	0.00e+00	7.02e-43	5.91e-83	0.5449
1. PBF	Q3K7C0	GTPase Der	0.00e+00	3.26e-32	1.04e-88	0.8641
1. PBF	Q04XE4	tRNA modification GTPase MnmE	1.23e-03	3.85e-04	2.46e-10	0.7441
1. PBF	Q8E5T7	tRNA modification GTPase MnmE	2.99e-04	3.79e-06	2.66e-17	0.6202
1. PBF	Q5HCI3	tRNA modification GTPase MnmE	2.20e-04	1.80e-06	4.14e-16	0.6464
1. PBF	Q21QM5	tRNA modification GTPase MnmE	1.36e-03	2.38e-04	5.63e-10	0.6783
1. PBF	Q1BSF9	tRNA modification GTPase MnmE	2.93e-03	8.76e-03	3.53e-13	0.7046
1. PBF	Q98DZ0	tRNA modification GTPase MnmE	9.87e-03	1.50e-04	1.05e-05	0.6731
1. PBF	Q169E2	GTPase Der	0.00e+00	4.71e-43	8.82e-72	0.6062
1. PBF	A5F3E6	GTPase Der	0.00e+00	3.13e-39	4.34e-96	0.8211
1. PBF	Q6F1R7	GTPase Der	0.00e+00	1.17e-78	0.0	0.9303
1. PBF	B7LKC7	GTPase Der	0.00e+00	1.16e-38	4.58e-92	0.8404
1. PBF	A4VNW7	GTPase Der	0.00e+00	1.65e-34	8.62e-88	0.8598
1. PBF	A7GYZ1	tRNA modification GTPase MnmE	3.45e-04	2.70e-04	2.78e-20	0.6998
1. PBF	Q033L0	tRNA modification GTPase MnmE	1.84e-04	1.68e-04	2.28e-18	0.3824
1. PBF	O87407	GTPase Der	0.00e+00	1.09e-19	4.67e-85	0.8179
1. PBF	Q82XU6	GTPase Der	0.00e+00	1.66e-42	9.43e-86	0.8126
1. PBF	B2U9V3	GTPase Der	0.00e+00	2.70e-55	9.87e-96	0.7771
1. PBF	A2CDC4	tRNA modification GTPase MnmE	2.06e-04	1.04e-03	2.96e-09	0.7317
1. PBF	Q3SR12	GTPase Der	0.00e+00	9.14e-53	7.42e-86	0.5821
1. PBF	Q8CP62	GTPase Der	0.00e+00	5.50e-69	3.38e-152	0.9108
1. PBF	B0K3E4	GTPase Der	0.00e+00	6.00e-68	2.49e-139	0.9264
1. PBF	Q8YN91	tRNA modification GTPase MnmE	1.59e-04	2.00e-05	4.44e-19	0.729
1. PBF	Q5L4W0	tRNA modification GTPase MnmE	6.15e-04	4.06e-07	4.19e-14	0.6958
1. PBF	Q1MS56	GTPase Der	0.00e+00	1.48e-46	2.20e-86	0.5827
1. PBF	Q81FR5	GTPase Der	0.00e+00	5.24e-70	6.40e-155	0.9174
1. PBF	A8AXP0	tRNA modification GTPase MnmE	4.43e-04	6.68e-07	3.15e-19	0.6782
1. PBF	B7NQW0	GTPase Der	0.00e+00	1.07e-38	1.75e-91	0.852
1. PBF	B7IP82	GTPase Der	0.00e+00	3.27e-70	4.86e-154	0.9102
1. PBF	B3WE80	GTPase Der	0.00e+00	1.31e-69	4.05e-148	0.9232
1. PBF	A0K7T2	GTPase Der	0.00e+00	2.11e-54	5.76e-100	0.823
1. PBF	Q1CRH7	tRNA modification GTPase MnmE	3.55e-04	1.54e-04	9.01e-22	0.6111
1. PBF	A6GXB2	tRNA modification GTPase MnmE	1.28e-04	2.13e-06	2.22e-13	0.719
1. PBF	C1CFT0	GTPase Der	0.00e+00	1.16e-67	4.93e-139	0.924
1. PBF	B0CBB0	tRNA modification GTPase MnmE	4.74e-04	2.94e-04	8.11e-18	0.7323
1. PBF	P0DA90	GTPase Der	0.00e+00	4.69e-68	3.02e-143	0.9276
1. PBF	B2G718	GTPase Der	0.00e+00	1.30e-70	4.40e-149	0.92
1. PBF	Q6HAF2	tRNA modification GTPase MnmE	3.12e-04	4.03e-06	1.77e-16	0.7387
1. PBF	Q3AAU6	GTPase Der	0.00e+00	9.87e-71	2.58e-133	0.5839
1. PBF	A5F485	tRNA modification GTPase MnmE	1.35e-03	2.84e-05	2.52e-12	0.635
1. PBF	B9J7W1	GTPase Der	0.00e+00	1.19e-43	3.84e-87	0.6019
1. PBF	B1K0Y2	tRNA modification GTPase MnmE	3.06e-03	7.57e-03	3.34e-13	0.7045
1. PBF	Q63YV9	tRNA modification GTPase MnmE	3.01e-03	1.99e-03	9.70e-13	0.6679
1. PBF	A5U372	GTPase Der	0.00e+00	3.26e-40	3.24e-88	0.6069
1. PBF	B9E6L5	GTPase Der	0.00e+00	1.05e-69	1.91e-148	0.8822
1. PBF	A5EI59	GTPase Der	0.00e+00	3.90e-53	1.04e-93	0.7083
1. PBF	Q9KCD4	GTPase Der	0.00e+00	2.47e-69	3.24e-144	0.9469
1. PBF	B8FM51	GTPase Der	0.00e+00	2.49e-57	7.36e-118	0.9142
1. PBF	Q6APY7	tRNA modification GTPase MnmE	3.04e-04	4.06e-05	4.32e-16	0.7951
1. PBF	A6LSI6	GTPase Der	0.00e+00	1.48e-67	4.66e-130	0.8934
1. PBF	B0TFW3	GTPase Der	0.00e+00	2.47e-69	1.66e-140	0.9083
1. PBF	A4Y8T6	GTPase Der	0.00e+00	9.45e-37	5.39e-87	0.8252
1. PBF	B0BTQ8	GTPase Der	0.00e+00	4.99e-39	4.57e-87	0.8486
1. PBF	Q1BGX0	GTPase Der	0.00e+00	2.11e-54	5.76e-100	0.8265
1. PBF	A9VTM0	tRNA modification GTPase MnmE	2.22e-04	5.91e-06	6.81e-17	0.7264
1. PBF	Q48V63	GTPase Der	0.00e+00	2.40e-69	2.25e-143	0.9226
1. PBF	B2GC35	GTPase Der	0.00e+00	1.20e-69	6.13e-145	0.9021
1. PBF	A6TS39	GTPase Der	0.00e+00	5.47e-66	4.61e-149	0.8917
1. PBF	Q99ZU0	tRNA modification GTPase MnmE	2.20e-04	4.29e-06	1.34e-18	0.5302
1. PBF	A8AVL8	GTPase Der	0.00e+00	6.86e-69	5.07e-140	0.9246
1. PBF	Q1LLJ5	GTPase Der	0.00e+00	3.82e-57	1.45e-98	0.7887
1. PBF	A3NVW6	GTPase Der	0.00e+00	3.12e-54	2.13e-97	0.8177
1. PBF	Q57LJ0	GTPase Der	0.00e+00	2.38e-39	3.25e-93	0.8429
1. PBF	A8GXR7	GTPase Der	0.00e+00	8.77e-54	1.14e-94	0.7463
1. PBF	O84704	tRNA modification GTPase MnmE	3.76e-04	4.10e-05	2.65e-17	0.612
1. PBF	B3H0R7	GTPase Der	0.00e+00	1.59e-38	7.25e-87	0.8431
1. PBF	Q1JDF1	GTPase Der	0.00e+00	1.82e-69	3.33e-143	0.9275
1. PBF	A4SDB8	GTPase Der	0.00e+00	1.76e-62	3.89e-121	0.7736
1. PBF	A6H103	GTPase Der	0.00e+00	1.86e-63	4.73e-112	0.8839
1. PBF	P75104	tRNA modification GTPase MnmE	6.58e-04	5.73e-05	3.29e-17	0.4451
1. PBF	Q3B5U3	GTPase Der	0.00e+00	6.61e-67	1.96e-121	0.7402
1. PBF	A0PX77	tRNA modification GTPase MnmE	4.58e-04	8.46e-05	1.09e-16	0.7002
1. PBF	Q2YM98	GTPase Der	1.11e-16	4.93e-43	1.18e-84	0.643
1. PBF	Q38UE9	tRNA modification GTPase MnmE	5.11e-04	1.67e-05	2.59e-16	0.7158
1. PBF	P57662	GTPase Der	0.00e+00	9.43e-54	1.55e-73	0.8037
1. PBF	Q03N64	tRNA modification GTPase MnmE	2.06e-04	7.75e-05	2.51e-17	0.5105
3. BF	A0AIR3	GTPase Era	9.13e-08	NA	7.73e-13	0.4618
3. BF	C1CRT1	GTPase Era	1.54e-07	NA	1.71e-12	0.4526
3. BF	A7FXK1	GTPase Era	1.97e-07	NA	2.08e-11	0.4482
3. BF	O69162	GTPase Era	3.29e-07	NA	1.47e-07	0.428
3. BF	P0C0C0	GTPase Era (Fragment)	2.06e-06	NA	7.40e-13	0.7636
3. BF	Q1H4T4	Probable GTP-binding protein EngB	9.15e-07	NA	0.002	0.6396
3. BF	P0A3C3	GTPase Era	1.19e-07	NA	1.71e-12	0.4531
3. BF	Q0TNU5	GTPase Era	2.40e-07	NA	8.44e-14	0.4524
3. BF	A1APR8	GTPase Era	2.82e-07	NA	1.37e-19	0.4284
3. BF	O83552	GTPase Era	5.84e-07	NA	1.23e-08	0.5275
3. BF	A6LL68	GTPase Era	8.23e-08	NA	8.41e-12	0.4498
3. BF	Q9KD52	GTPase Era	9.14e-08	NA	6.30e-16	0.4469
3. BF	Q0SRG1	GTPase Era	2.24e-07	NA	1.21e-13	0.4617
3. BF	B0K708	GTPase Era	3.44e-07	NA	2.23e-10	0.449
3. BF	Q71ZK8	GTPase Era	8.30e-08	NA	2.93e-12	0.4599
3. BF	B8ZP66	GTPase Era	1.49e-07	NA	1.78e-12	0.4529
3. BF	Q1JI67	GTPase Era	7.35e-08	NA	7.96e-12	0.4556
3. BF	Q5HAY9	GTPase Era	4.68e-07	NA	3.45e-08	0.4613
3. BF	Q831T9	GTPase Era	1.21e-07	NA	1.91e-13	0.4447
3. BF	B1HTJ0	GTPase Era	1.55e-07	NA	4.86e-15	0.5821
3. BF	Q6G900	GTPase Era	1.23e-07	NA	5.95e-14	0.4547
3. BF	A5IT95	GTPase Era	1.30e-07	NA	5.95e-14	0.4522
3. BF	Q8Y750	GTPase Era	8.99e-08	NA	2.93e-12	0.4735
3. BF	B8I736	GTPase Era	9.94e-08	NA	2.98e-12	0.4531
3. BF	C1CXC1	GTPase Era	1.08e-06	NA	9.25e-13	0.4292
3. BF	Q3AEZ3	GTPase Era	1.97e-07	NA	9.21e-18	0.4795
3. BF	B7K414	GTPase Era	2.18e-06	NA	1.15e-12	0.3903
3. BF	P0DA97	GTPase Era	7.94e-08	NA	8.81e-12	0.4542
3. BF	Q5XDG3	GTPase Era	7.37e-08	NA	8.81e-12	0.4543
3. BF	A3Q264	GTPase Era	2.02e-07	NA	5.31e-06	0.4484
3. BF	A5N6N6	GTPase Era	3.67e-07	NA	3.73e-13	0.4427
3. BF	Q031W8	GTPase Era	1.36e-07	NA	1.64e-14	0.4304
3. BF	A2RG20	GTPase Era	6.58e-08	NA	8.81e-12	0.455
3. BF	P64084	GTPase Era	1.04e-07	NA	5.95e-14	0.4515
3. BF	P0C0B9	GTPase Era	8.07e-08	NA	6.31e-12	0.4545
3. BF	B9DNL3	GTPase Era	1.14e-07	NA	1.74e-12	0.4496
3. BF	Q038T2	GTPase Era	1.42e-07	NA	3.22e-12	0.4793
3. BF	A8Z4A6	GTPase Era	1.18e-07	NA	5.95e-14	0.4513
3. BF	B3ETC6	GTPase Era	9.00e-07	NA	3.85e-10	0.4271
3. BF	Q8NNB9	GTPase Era	3.53e-07	NA	1.31e-09	0.4402
3. BF	Q1B6C5	GTPase Era	1.76e-07	NA	5.13e-06	0.4514
3. BF	Q8DYI1	GTPase Era	6.38e-08	NA	7.26e-12	0.4544
3. BF	B5RMK6	GTPase Era	2.71e-07	NA	2.57e-10	0.4235
3. BF	B1KZM3	GTPase Era	2.13e-07	NA	2.30e-11	0.4357
3. BF	B5XK74	GTPase Era	8.35e-08	NA	8.81e-12	0.4544
3. BF	P37214	GTPase Era	1.04e-07	NA	3.01e-14	0.4538
3. BF	Q9RDF2	GTPase Era	2.21e-07	NA	5.41e-08	0.4235
3. BF	A4VW74	GTPase Era	1.20e-07	NA	2.12e-13	0.4544
3. BF	Q8G1P9	GTPase Era	5.47e-07	NA	1.83e-06	0.4301
3. BF	A4YWC7	GTPase Era	3.05e-07	NA	5.13e-09	0.4269
3. BF	Q92R46	GTPase Era	4.87e-07	NA	7.61e-09	0.4274
3. BF	Q6AEC6	GTPase Era	2.05e-07	NA	2.34e-07	0.5814
3. BF	Q48UW6	GTPase Era	7.55e-08	NA	8.81e-12	0.4548
3. BF	B0KA54	GTPase Era	3.46e-07	NA	2.23e-10	0.4515
3. BF	A1K9D3	Probable GTP-binding protein EngB	7.31e-05	NA	1.86e-04	0.615
3. BF	Q92BP8	GTPase Era	8.49e-08	NA	3.74e-13	0.4627
3. BF	A7GHG2	GTPase Era	2.01e-07	NA	2.64e-11	0.4481
3. BF	Q8UGK1	GTPase Era	4.95e-07	NA	1.29e-09	0.4302
3. BF	Q88VS0	GTPase Era	1.98e-07	NA	2.86e-14	0.4843
3. BF	B2TMB9	GTPase Era	2.77e-07	NA	2.50e-12	0.4533
3. BF	Q0SMJ3	GTPase Era	1.98e-07	NA	2.30e-08	0.4514
3. BF	B9DRF9	GTPase Era	7.99e-08	NA	2.48e-12	0.4539
3. BF	A5G693	GTPase Era	8.55e-08	NA	1.92e-16	0.459
3. BF	Q16AA3	Probable GTP-binding protein EngB	1.67e-05	NA	0.003	0.6503
3. BF	A8LLE0	GTPase Era	2.72e-07	NA	3.80e-10	0.4821
3. BF	A6U7A9	GTPase Era	3.86e-07	NA	7.81e-08	0.4225
3. BF	P42182	GTPase Era	1.10e-07	NA	6.75e-15	0.4397
3. BF	Q2GGZ1	GTPase Era	6.28e-07	NA	2.21e-08	0.4388
3. BF	Q68XY6	GTPase Era	1.82e-07	NA	4.17e-07	0.4222
3. BF	B9E055	GTPase Era	3.90e-07	NA	3.73e-13	0.435
3. BF	Q83NI3	GTPase Era	1.71e-07	NA	1.48e-06	0.4607
3. BF	Q6NG20	GTPase Era	4.14e-07	NA	1.33e-08	0.4311
3. BF	A5EKL6	GTPase Era	3.12e-07	NA	5.81e-09	0.4023
3. BF	B5RQ02	GTPase Era	2.28e-07	NA	5.89e-11	0.4473
3. BF	A8MG70	GTPase Era	1.78e-07	NA	1.38e-18	0.4493
3. BF	A1UIQ1	GTPase Era	1.64e-07	NA	5.13e-06	0.4515
3. BF	B4U458	GTPase Era	6.36e-08	NA	1.12e-11	0.4504
3. BF	B7J2L5	GTPase Era	2.07e-07	NA	5.17e-08	0.4509
3. BF	Q1RHA4	GTPase Era	1.50e-07	NA	9.51e-11	0.4257
3. BF	A5IIT6	GTPase Era	1.88e-07	NA	1.60e-13	0.4244
3. BF	Q04KV9	GTPase Era	1.13e-07	NA	1.71e-12	0.4526
3. BF	A8GUZ8	GTPase Era	1.42e-07	NA	9.60e-11	0.4261
3. BF	P64088	GTPase Era	8.35e-08	NA	8.81e-12	0.4543
3. BF	Q5WHD9	GTPase Era	1.33e-07	NA	2.64e-14	0.4386
3. BF	Q03F63	GTPase Era	3.16e-07	NA	5.72e-11	0.4342
3. BF	A4W2H9	GTPase Era	1.27e-07	NA	2.12e-13	0.4544
3. BF	Q83MZ2	GTPase Era	1.73e-07	NA	1.48e-06	0.457
3. BF	Q9RWM0	GTPase Era	1.14e-06	NA	4.69e-08	0.4039
3. BF	Q892S2	GTPase Era	2.57e-07	NA	1.42e-12	0.4308
3. BF	Q03Y33	GTPase Era	2.77e-07	NA	4.56e-16	0.4421
3. BF	B1WT49	GTPase Era	1.83e-06	NA	1.71e-12	0.4439
3. BF	C1FVS6	GTPase Era	2.64e-07	NA	1.62e-11	0.4481
3. BF	Q9WZV1	GTPase Era	1.30e-07	NA	3.02e-13	0.4413
3. BF	A8EXI4	GTPase Era	1.53e-07	NA	6.98e-08	0.4387
3. BF	P0A3C1	GTPase Era	1.31e-07	NA	1.65e-14	0.4823
3. BF	A5I626	GTPase Era	1.94e-07	NA	2.08e-11	0.4352
3. BF	Q73LG9	GTPase Era	3.09e-07	NA	3.88e-09	0.4365
3. BF	Q8E443	GTPase Era	8.68e-08	NA	7.26e-12	0.4543
3. BF	C1KVA9	GTPase Era	8.61e-08	NA	2.93e-12	0.4738
3. BF	Q3K022	GTPase Era	8.38e-08	NA	7.26e-12	0.4544
3. BF	Q39T84	GTPase Era	1.44e-07	NA	5.77e-13	0.4484
3. BF	Q182C3	GTPase Era	1.80e-07	NA	5.40e-13	0.4211
3. BF	O51604	GTPase Era	2.31e-07	NA	5.17e-08	0.4508
3. BF	Q5SM23	GTPase Era	8.68e-07	NA	2.58e-10	0.4247
3. BF	B1MYE3	GTPase Era	3.18e-07	NA	7.78e-18	0.4401
3. BF	Q4UKB0	GTPase Era	1.53e-07	NA	2.95e-07	0.423
3. BF	C7LZP1	GTPase Era	3.73e-07	NA	7.84e-09	0.4447
3. BF	A3CP94	GTPase Era	1.03e-07	NA	1.86e-13	0.4577
3. BF	A6L4J3	Probable GTP-binding protein EngB	2.02e-07	NA	0.013	0.6675
3. BF	C0MBF0	GTPase Era	6.34e-08	NA	1.56e-11	0.4544
3. BF	B2IPC3	GTPase Era	1.24e-07	NA	1.71e-12	0.4531
3. BF	Q660L0	GTPase Era	2.12e-07	NA	9.05e-09	0.447
3. BF	A8F6R1	GTPase Era	1.15e-07	NA	2.21e-13	0.4309
3. BF	B1IBC9	GTPase Era	1.39e-07	NA	1.78e-12	0.4527
3. BF	C1CDW4	GTPase Era	1.19e-07	NA	2.96e-12	0.4597
3. BF	P9WNK8	GTPase Era	4.00e-07	NA	2.08e-04	0.4459
3. BF	Q1JN21	GTPase Era	8.79e-08	NA	8.81e-12	0.4567
3. BF	A5IXQ6	GTPase Era	5.59e-07	NA	2.10e-10	0.4476
3. BF	A1SHZ4	GTPase Era	4.23e-07	NA	1.06e-04	0.4349
3. BF	B9M913	GTPase Era	7.84e-08	NA	1.00e-14	0.4591
3. BF	A5U557	GTPase Era	4.13e-07	NA	2.08e-04	0.4462
3. BF	C1CK50	GTPase Era	1.16e-07	NA	1.71e-12	0.4526
3. BF	Q4UYM8	Probable GTP-binding protein EngB	2.23e-06	NA	6.68e-04	0.6069
3. BF	P64086	GTPase Era	1.52e-07	NA	5.95e-14	0.4517
3. BF	A0QEB0	GTPase Era	1.92e-07	NA	2.71e-04	0.4515
3. BF	A0Q1Q0	GTPase Era	3.35e-07	NA	5.97e-15	0.4361
3. BF	B8DE49	GTPase Era	1.12e-07	NA	3.13e-12	0.4626
3. BF	B7IH25	GTPase Era	8.48e-08	NA	5.01e-10	0.4509
3. BF	A7X2W5	GTPase Era	1.13e-07	NA	5.95e-14	0.4516
3. BF	Q2YT12	GTPase Era	1.24e-07	NA	1.42e-14	0.4515
3. BF	Q8XIU8	GTPase Era	2.36e-07	NA	8.21e-14	0.4553
3. BF	Q5HFJ3	GTPase Era	1.21e-07	NA	5.95e-14	0.4517
3. BF	C6E2H7	GTPase Era	2.29e-07	NA	1.08e-14	0.5563
3. BF	Q1JD46	GTPase Era	7.99e-08	NA	8.81e-12	0.4544
3. BF	Q2FGF6	GTPase Era	1.14e-07	NA	5.95e-14	0.458
3. BF	C3L3F3	GTPase Era	1.97e-07	NA	2.45e-11	0.4354
3. BF	A6TSJ8	GTPase Era	2.07e-07	NA	4.97e-15	0.4432
3. BF	C1C6U6	GTPase Era	1.07e-07	NA	1.71e-12	0.4611
3. BF	B3WEL1	GTPase Era	1.05e-07	NA	2.48e-13	0.486
3. BF	A6QHB0	GTPase Era	1.22e-07	NA	5.95e-14	0.4518
3. BF	Q8CP21	GTPase Era	1.63e-07	NA	1.84e-13	0.4514
3. BF	Q4L6R7	GTPase Era	1.12e-07	NA	2.43e-13	0.4509
3. BF	Q5HNY0	GTPase Era	1.27e-07	NA	1.86e-13	0.4514
3. BF	Q98QI1	GTPase Era	5.47e-07	NA	2.18e-09	0.4401
3. BF	O24756	GTPase Era	1.05e-07	NA	1.01e-13	0.4548
3. BF	Q73Y13	GTPase Era	1.94e-07	NA	1.90e-04	0.4514
3. BF	A6LRP9	GTPase Era	4.76e-07	NA	3.12e-13	0.4416
3. BF	Q2LVR8	GTPase Era	8.92e-08	NA	1.34e-13	0.4435
3. BF	C0MCD8	GTPase Era	7.15e-08	NA	1.99e-11	0.4545
3. BF	B6JGG2	GTPase Era	3.43e-07	NA	2.32e-09	0.5687
3. BF	P0A3C4	GTPase Era	1.14e-07	NA	1.71e-12	0.4527
3. BF	Q8EPY0	GTPase Era	1.03e-07	NA	6.93e-12	0.4617
3. BF	P0A563	GTPase Era	4.15e-07	NA	2.08e-04	0.4467
3. BF	B1ILK9	GTPase Era	2.37e-07	NA	2.69e-11	0.4355
3. BF	Q5FFN4	GTPase Era	3.95e-07	NA	3.36e-08	0.4406
3. BF	C1AQS7	GTPase Era	3.75e-07	NA	2.08e-04	0.4452
3. BF	Q1J822	GTPase Era	7.79e-08	NA	1.27e-11	0.4556
3. BF	Q985A5	GTPase Era	5.33e-07	NA	1.77e-09	0.4227
3. BF	B2S103	GTPase Era	2.56e-07	NA	2.65e-10	0.4621
3. BF	B5ZBZ8	GTPase Era	2.14e-06	NA	1.17e-14	0.4548
3. BF	Q8YG75	GTPase Era	4.36e-07	NA	2.25e-06	0.4292
3. BF	Q8YYD8	GTPase Era	2.30e-06	NA	5.06e-17	0.4181
3. BF	B1AJD1	GTPase Era	4.14e-06	NA	5.33e-15	0.4437
3. BF	P0A3C2	GTPase Era	1.07e-07	NA	1.65e-14	0.4426
3. BF	P64085	GTPase Era	1.37e-07	NA	5.95e-14	0.4545
3. BF	A1KL54	GTPase Era	3.99e-07	NA	2.08e-04	0.4469
3. BF	Q1IXB4	GTPase Era	7.56e-07	NA	1.12e-11	0.4097
3. BF	Q9PPZ9	GTPase Era	2.37e-06	NA	5.33e-15	0.448
3. BF	B2V2K0	GTPase Era	2.74e-07	NA	3.58e-12	0.4566
3. BF	Q97JI5	GTPase Era	1.55e-07	NA	1.82e-12	0.4696
3. BF	Q49Y10	GTPase Era	1.01e-07	NA	2.00e-12	0.4507
3. BF	Q92JA9	GTPase Era	2.82e-07	NA	2.59e-07	0.4271
3. BF	B0TAF1	GTPase Era	1.52e-07	NA	2.22e-15	0.443
3. BF	Q55526	GTPase Era	2.16e-06	NA	1.61e-14	0.4433
3. BF	A1R085	GTPase Era	2.81e-07	NA	7.35e-11	0.4591
3. BF	A6U239	GTPase Era	1.52e-07	NA	5.95e-14	0.4517
3. BF	Q8RGM1	GTPase Era	6.34e-08	NA	8.22e-18	0.4579
3. BF	Q6GGD3	GTPase Era	1.29e-07	NA	5.95e-14	0.4512
3. BF	Q1WTU6	GTPase Era	1.74e-07	NA	5.98e-12	0.4477
3. BF	A8GM80	GTPase Era	1.19e-07	NA	3.00e-07	0.4286
3. BF	Q3YRS0	GTPase Era	5.05e-07	NA	2.55e-07	0.4185
3. BF	Q8RB50	GTPase Era	2.86e-07	NA	2.18e-12	0.4357
3. BF	B2S3D3	GTPase Era	5.86e-07	NA	1.23e-08	0.5327
3. BF	P0DA96	GTPase Era	6.38e-08	NA	8.81e-12	0.4546
3. BF	B8CXI2	GTPase Era	2.08e-07	NA	3.09e-12	0.4425
3. BF	Q9ZE30	GTPase Era	2.01e-07	NA	6.85e-08	0.4247
4. PB	Q11CN2	tRNA modification GTPase MnmE	7.24e-04	1.88e-04	5.97e-17	NA
4. PB	P94478	GTPase HflX	7.14e-04	6.57e-05	0.045	NA
4. PB	A8Z5X0	tRNA modification GTPase MnmE	5.12e-04	2.60e-05	7.30e-11	NA
4. PB	Q5WSF0	tRNA modification GTPase MnmE	2.42e-03	1.72e-05	2.20e-13	NA
4. PB	A0LJ92	GTPase Der	0.00e+00	3.28e-59	2.42e-114	NA
4. PB	Q07VS7	tRNA modification GTPase MnmE	2.92e-03	2.52e-05	8.59e-13	NA
4. PB	P43730	tRNA modification GTPase MnmE	2.69e-03	1.13e-05	1.64e-11	NA
4. PB	B0UJI9	tRNA modification GTPase MnmE	9.33e-04	2.30e-04	2.52e-09	NA
4. PB	B1L9N6	tRNA modification GTPase MnmE	2.10e-04	8.24e-04	1.11e-17	NA
4. PB	Q5M4H3	tRNA modification GTPase MnmE	2.03e-04	5.11e-06	1.83e-19	NA
4. PB	Q2SR47	tRNA modification GTPase MnmE	4.73e-04	2.93e-05	3.49e-14	NA
4. PB	A1AXX6	tRNA modification GTPase MnmE	3.03e-03	3.30e-03	1.08e-08	NA
4. PB	Q8P161	tRNA modification GTPase MnmE	2.20e-04	3.41e-06	1.37e-18	NA
4. PB	A6KXK1	GTPase Der	0.00e+00	1.69e-67	1.65e-121	NA
4. PB	A5CFM7	tRNA modification GTPase MnmE	3.77e-04	7.48e-06	3.57e-12	NA
4. PB	A1UQU6	tRNA modification GTPase MnmE	8.20e-04	3.83e-05	5.19e-10	NA
4. PB	A9WHH9	GTPase Der	0.00e+00	4.64e-60	1.20e-121	NA
4. PB	Q2GC37	tRNA modification GTPase MnmE	1.44e-03	1.71e-02	2.07e-05	NA
4. PB	B1I462	GTPase Der	0.00e+00	3.64e-69	5.22e-124	NA
4. PB	A7NCL5	tRNA modification GTPase MnmE	2.10e-03	3.85e-07	1.87e-08	NA
4. PB	A8EZV9	tRNA modification GTPase MnmE	1.68e-03	1.96e-05	1.93e-10	NA
4. PB	Q8P340	tRNA modification GTPase MnmE	1.71e-03	1.02e-04	1.22e-13	NA
4. PB	Q601N0	tRNA modification GTPase MnmE	2.15e-03	5.04e-05	2.03e-14	NA
4. PB	A9IZY1	tRNA modification GTPase MnmE	1.43e-03	8.81e-06	2.09e-08	NA
4. PB	B2THQ9	GTPase Der	0.00e+00	9.95e-72	3.29e-130	NA
4. PB	A3QJT0	tRNA modification GTPase MnmE	3.80e-03	1.13e-05	5.79e-13	NA
4. PB	A5GR60	GTPase Der	0.00e+00	3.41e-56	8.94e-110	NA
4. PB	Q8FBV3	tRNA modification GTPase MnmE	2.48e-03	8.71e-05	6.12e-12	NA
4. PB	B1IX32	tRNA modification GTPase MnmE	2.76e-03	1.11e-04	6.06e-12	NA
4. PB	P57132	tRNA modification GTPase MnmE	2.21e-03	1.98e-05	6.08e-11	NA
4. PB	B4SYB2	tRNA modification GTPase MnmE	2.29e-03	4.31e-05	1.92e-11	NA
4. PB	Q3YT72	tRNA modification GTPase MnmE	1.19e-02	2.21e-03	9.09e-08	NA
4. PB	A4XN51	tRNA modification GTPase MnmE	3.39e-04	2.90e-05	6.45e-14	NA
4. PB	Q3SF39	tRNA modification GTPase MnmE	7.42e-03	3.50e-05	1.27e-13	NA
4. PB	A3N2D8	tRNA modification GTPase MnmE	2.70e-03	2.13e-05	4.41e-13	NA
4. PB	B1ZWP5	tRNA modification GTPase MnmE	6.80e-03	8.80e-05	1.98e-11	NA
4. PB	Q28VZ6	tRNA modification GTPase MnmE	1.03e-02	1.85e-03	1.16e-07	NA
4. PB	B1JRQ1	tRNA modification GTPase MnmE	3.59e-03	2.68e-05	2.01e-11	NA
4. PB	Q1LTV8	tRNA modification GTPase MnmE	3.63e-03	2.93e-05	1.95e-12	NA
4. PB	Q8PEH9	tRNA modification GTPase MnmE	5.55e-03	1.27e-04	7.33e-13	NA
4. PB	C0QXH9	tRNA modification GTPase MnmE	5.32e-04	3.44e-04	2.54e-09	NA
4. PB	B0CJG2	tRNA modification GTPase MnmE	3.03e-03	1.52e-03	2.60e-10	NA
4. PB	A4Y199	tRNA modification GTPase MnmE	2.37e-03	1.76e-05	3.86e-13	NA
4. PB	B1LL33	tRNA modification GTPase MnmE	2.37e-03	7.38e-05	5.80e-12	NA
4. PB	Q7VSR5	tRNA modification GTPase MnmE	1.46e-02	8.54e-05	1.91e-11	NA
4. PB	Q8Z9U2	tRNA modification GTPase MnmE	1.98e-03	1.44e-05	2.04e-11	NA
4. PB	Q72HR4	GTPase Obg	7.24e-03	6.28e-06	0.035	NA
4. PB	Q7V2S6	GTPase Der	0.00e+00	8.70e-47	6.16e-106	NA
4. PB	Q9HT07	tRNA modification GTPase MnmE	1.93e-03	7.24e-05	3.79e-15	NA
4. PB	Q6MFA3	tRNA modification GTPase MnmE	5.07e-03	2.65e-04	2.80e-15	NA
4. PB	P47254	tRNA modification GTPase MnmE	1.02e-03	6.37e-04	1.45e-16	NA
4. PB	Q02VP7	tRNA modification GTPase MnmE	5.15e-04	4.61e-06	4.88e-17	NA
4. PB	A6LNG7	GTPase Der	1.44e-15	8.80e-56	6.24e-79	NA
4. PB	Q5FHQ5	tRNA modification GTPase MnmE	4.14e-04	3.40e-05	1.03e-15	NA
4. PB	Q74AX4	GTPase Der	0.00e+00	2.84e-67	8.02e-120	NA
4. PB	Q1J154	tRNA modification GTPase MnmE	4.60e-04	5.83e-03	9.22e-13	NA
4. PB	A5G169	tRNA modification GTPase MnmE	7.73e-04	1.15e-04	5.21e-09	NA
4. PB	Q7U344	tRNA modification GTPase MnmE	3.87e-03	2.40e-05	6.71e-12	NA
4. PB	B5BIL9	tRNA modification GTPase MnmE	2.81e-03	4.61e-05	6.56e-11	NA
4. PB	B7NF24	tRNA modification GTPase MnmE	2.71e-03	7.10e-05	5.64e-12	NA
4. PB	A1RQE8	tRNA modification GTPase MnmE	2.65e-03	5.55e-06	1.37e-12	NA
4. PB	A4GAN2	tRNA modification GTPase MnmE	7.40e-03	1.76e-04	1.99e-15	NA
4. PB	P25522	tRNA modification GTPase MnmE	2.67e-03	1.11e-04	6.06e-12	NA
4. PB	Q6LW56	tRNA modification GTPase MnmE	1.38e-03	2.81e-05	6.25e-12	NA
4. PB	Q07UP2	tRNA modification GTPase MnmE	2.93e-03	5.35e-05	9.78e-09	NA
4. PB	Q3IYH3	tRNA modification GTPase MnmE	1.31e-03	1.61e-04	1.51e-11	NA
4. PB	Q16CZ5	tRNA modification GTPase MnmE	6.52e-03	7.53e-05	2.41e-08	NA
4. PB	A4WVZ0	tRNA modification GTPase MnmE	2.19e-03	2.13e-03	9.52e-11	NA
4. PB	B7N211	tRNA modification GTPase MnmE	2.44e-03	7.38e-05	5.80e-12	NA
4. PB	Q8R6K8	tRNA modification GTPase MnmE	4.74e-04	7.66e-04	4.85e-19	NA
4. PB	B5YXB0	tRNA modification GTPase MnmE	2.08e-03	1.32e-04	6.34e-12	NA
4. PB	Q9ZCI1	tRNA modification GTPase MnmE	2.71e-04	3.71e-05	6.51e-14	NA
4. PB	Q9PIB6	GTPase Der	0.00e+00	6.11e-50	7.04e-86	NA
4. PB	B3E421	GTPase Der	0.00e+00	1.98e-57	1.06e-120	NA
4. PB	Q04ZS1	GTPase Der	0.00e+00	1.80e-41	1.34e-65	NA
4. PB	Q4UK70	tRNA modification GTPase MnmE	8.62e-03	1.23e-04	2.52e-12	NA
4. PB	A8YTQ7	tRNA modification GTPase MnmE	3.00e-04	2.02e-05	4.14e-16	NA
4. PB	A5GJ79	GTPase Der	0.00e+00	8.70e-53	1.35e-110	NA
4. PB	A8EV95	tRNA modification GTPase MnmE	3.06e-04	1.44e-05	1.20e-19	NA
4. PB	A6M3M5	tRNA modification GTPase MnmE	5.11e-03	3.96e-04	1.80e-16	NA
4. PB	Q5LZW3	tRNA modification GTPase MnmE	1.87e-04	4.29e-06	1.83e-19	NA
4. PB	A5IIK3	tRNA modification GTPase MnmE	2.17e-03	1.76e-05	7.28e-13	NA
4. PB	A1U7J3	tRNA modification GTPase MnmE	1.61e-03	1.23e-04	3.61e-14	NA
4. PB	Q7VDI8	GTPase Der	0.00e+00	1.03e-50	4.09e-108	NA
4. PB	B0B8S4	tRNA modification GTPase MnmE	3.89e-03	4.10e-05	2.65e-17	NA
4. PB	B4RRB9	tRNA modification GTPase MnmE	5.71e-03	9.32e-05	2.84e-11	NA
4. PB	A8GPN6	tRNA modification GTPase MnmE	2.86e-04	2.30e-05	4.89e-13	NA
4. PB	Q8RHA2	tRNA modification GTPase MnmE	4.03e-04	2.32e-06	1.15e-15	NA
4. PB	Q83PL3	tRNA modification GTPase MnmE	2.89e-03	1.03e-04	5.80e-12	NA
4. PB	Q9RVL1	tRNA modification GTPase MnmE	6.67e-04	2.64e-03	1.79e-13	NA
4. PB	Q6GD92	tRNA modification GTPase MnmE	1.67e-04	2.24e-06	4.18e-16	NA
4. PB	Q1MA18	tRNA modification GTPase MnmE	2.54e-02	3.08e-04	1.15e-13	NA
4. PB	Q02DE1	tRNA modification GTPase MnmE	1.46e-03	5.56e-05	3.59e-15	NA
4. PB	Q8Y5W8	GTPase Der	0.00e+00	6.91e-72	1.47e-155	NA
4. PB	A5UD71	tRNA modification GTPase MnmE	2.85e-03	1.20e-05	4.49e-12	NA
4. PB	B8GW34	tRNA modification GTPase MnmE	2.90e-03	5.44e-06	1.70e-10	NA
4. PB	Q5FF19	tRNA modification GTPase MnmE	8.18e-03	1.35e-03	3.25e-06	NA
4. PB	Q8Y3H5	tRNA modification GTPase MnmE	9.46e-04	1.12e-03	1.98e-11	NA
4. PB	Q5FS11	tRNA modification GTPase MnmE	7.26e-03	1.62e-03	3.40e-09	NA
4. PB	B0BAF3	tRNA modification GTPase MnmE	3.58e-03	4.10e-05	2.65e-17	NA
4. PB	B0JVV0	tRNA modification GTPase MnmE	3.40e-03	4.27e-04	1.73e-16	NA
4. PB	Q7UJI3	tRNA modification GTPase MnmE	8.53e-03	1.15e-04	5.55e-06	NA
4. PB	B0K5N4	tRNA modification GTPase MnmE	3.05e-04	1.76e-04	5.98e-18	NA
4. PB	A4YCM1	tRNA modification GTPase MnmE	3.19e-03	5.44e-06	1.34e-12	NA
4. PB	A8FJG0	tRNA modification GTPase MnmE	3.27e-04	6.89e-06	2.20e-14	NA
4. PB	A1WSU0	tRNA modification GTPase MnmE	1.64e-03	5.49e-04	8.07e-11	NA
4. PB	A9M9E5	tRNA modification GTPase MnmE	7.63e-03	2.53e-03	3.51e-09	NA
4. PB	Q65CN1	tRNA modification GTPase MnmE	4.82e-04	8.81e-06	2.59e-15	NA
4. PB	A5VT20	tRNA modification GTPase MnmE	4.91e-03	1.95e-03	7.28e-10	NA
4. PB	Q68VZ0	tRNA modification GTPase MnmE	2.95e-04	4.44e-05	7.72e-12	NA
4. PB	A0M2N6	tRNA modification GTPase MnmE	1.11e-04	4.83e-07	8.19e-17	NA
4. PB	A6LMN4	tRNA modification GTPase MnmE	2.93e-04	1.16e-04	1.36e-14	NA
4. PB	Q9KVY5	tRNA modification GTPase MnmE	2.47e-03	8.12e-06	2.54e-12	NA
4. PB	Q8DKI1	GTPase Der	0.00e+00	7.46e-55	2.02e-110	NA
4. PB	B5XZP4	tRNA modification GTPase MnmE	2.95e-03	5.04e-05	1.83e-11	NA
4. PB	Q4QLQ9	tRNA modification GTPase MnmE	3.30e-03	1.23e-05	4.45e-12	NA
4. PB	Q746Q3	tRNA modification GTPase MnmE	1.91e-04	4.06e-05	4.02e-15	NA
4. PB	A8A6G8	tRNA modification GTPase MnmE	2.63e-03	9.23e-05	5.70e-12	NA
4. PB	B1KQ64	tRNA modification GTPase MnmE	3.53e-03	1.04e-05	4.27e-12	NA
4. PB	A9BK05	GTPase Obg	9.88e-03	7.87e-04	0.014	NA
4. PB	Q5NFF3	tRNA modification GTPase MnmE	1.96e-03	1.62e-07	1.90e-08	NA
4. PB	A0AK49	GTPase Der	0.00e+00	4.79e-72	2.38e-156	NA
4. PB	B1X9T5	tRNA modification GTPase MnmE	2.20e-03	1.11e-04	6.06e-12	NA
4. PB	Q661B2	GTPase Der	0.00e+00	4.22e-58	1.26e-63	NA
4. PB	A4STS4	tRNA modification GTPase MnmE	2.73e-03	5.44e-06	5.29e-12	NA
4. PB	A8FKH3	GTPase Der	0.00e+00	2.36e-50	1.27e-84	NA
4. PB	Q21DG1	tRNA modification GTPase MnmE	2.21e-03	4.26e-05	5.09e-11	NA
4. PB	A8GUF3	tRNA modification GTPase MnmE	3.13e-04	3.71e-05	5.74e-13	NA
4. PB	A8LPC2	tRNA modification GTPase MnmE	2.15e-03	1.69e-04	1.19e-10	NA
4. PB	A6QKK2	tRNA modification GTPase MnmE	1.43e-04	1.80e-06	4.14e-16	NA
4. PB	B0BV57	tRNA modification GTPase MnmE	2.56e-04	3.60e-05	1.09e-12	NA
4. PB	B6I3T9	tRNA modification GTPase MnmE	2.52e-03	1.11e-04	6.06e-12	NA
4. PB	A7H4Z1	GTPase Der	0.00e+00	5.90e-52	4.33e-84	NA
4. PB	Q12HM9	tRNA modification GTPase MnmE	3.66e-03	1.76e-05	8.67e-13	NA
4. PB	B4RD04	tRNA modification GTPase MnmE	2.96e-03	4.80e-05	1.79e-08	NA
4. PB	Q05FY9	tRNA modification GTPase MnmE	1.55e-02	5.44e-04	4.40e-04	NA
4. PB	Q3M929	GTPase Der	0.00e+00	1.31e-51	2.98e-111	NA
4. PB	Q2KTI2	tRNA modification GTPase MnmE	2.48e-03	7.53e-05	4.58e-13	NA
4. PB	Q7MAX1	tRNA modification GTPase MnmE	3.03e-03	3.05e-05	7.31e-12	NA
4. PB	Q8YZH7	GTPase Der	0.00e+00	8.08e-51	5.49e-110	NA
4. PB	A1WWE4	tRNA modification GTPase MnmE	9.24e-04	1.75e-03	5.25e-10	NA
4. PB	B3ETH9	tRNA modification GTPase MnmE	5.11e-04	2.00e-06	5.61e-12	NA
4. PB	Q6G5W4	tRNA modification GTPase MnmE	2.91e-04	5.33e-06	4.34e-16	NA
4. PB	Q44633	tRNA modification GTPase MnmE	1.75e-03	2.52e-05	9.42e-11	NA
4. PB	B7MGC8	tRNA modification GTPase MnmE	2.37e-03	8.71e-05	6.12e-12	NA
4. PB	A7FPC2	tRNA modification GTPase MnmE	2.04e-03	2.02e-05	5.45e-12	NA
4. PB	Q663S6	tRNA modification GTPase MnmE	2.40e-03	2.78e-05	2.19e-11	NA
4. PB	Q57AJ6	tRNA modification GTPase MnmE	2.59e-03	1.97e-03	7.41e-10	NA
4. PB	A8I264	tRNA modification GTPase MnmE	1.61e-02	1.06e-03	2.46e-10	NA
4. PB	A0KR31	tRNA modification GTPase MnmE	3.30e-03	1.98e-05	1.36e-12	NA
4. PB	A9MX84	tRNA modification GTPase MnmE	3.27e-03	4.31e-05	1.92e-11	NA
4. PB	Q9UTE7	tRNA modification GTPase mss1, mitochondrial	2.45e-04	5.67e-05	7.23e-07	NA
4. PB	Q0HPE7	tRNA modification GTPase MnmE	3.38e-03	1.31e-05	5.34e-13	NA
4. PB	C0Q2L4	tRNA modification GTPase MnmE	2.61e-03	2.93e-05	1.66e-11	NA
4. PB	B2UPK5	tRNA modification GTPase MnmE	4.60e-03	7.80e-06	8.28e-14	NA
4. PB	Q2WBH0	tRNA modification GTPase MnmE	3.11e-04	1.67e-05	1.54e-06	NA
4. PB	Q11QK1	GTPase Der	0.00e+00	1.61e-68	3.26e-113	NA
4. PB	B7K1S0	GTPase Der	0.00e+00	2.36e-50	2.94e-112	NA
4. PB	B8GAY7	GTPase Der	0.00e+00	1.34e-60	1.07e-121	NA
4. PB	Q3IK56	tRNA modification GTPase MnmE	2.19e-03	8.29e-06	4.60e-12	NA
4. PB	B5Y805	GTPase Obg	1.19e-02	9.96e-06	0.007	NA
4. PB	C6C0G0	GTPase Der	0.00e+00	4.30e-53	1.61e-91	NA
4. PB	Q92KW1	tRNA modification GTPase MnmE	2.07e-02	3.23e-05	1.48e-12	NA
4. PB	B0S3V2	tRNA modification GTPase MnmE	5.05e-04	5.27e-06	1.33e-16	NA
4. PB	A1VYA6	GTPase Der	0.00e+00	3.71e-50	1.00e-85	NA
4. PB	A5GW82	tRNA modification GTPase MnmE	1.08e-04	2.36e-04	1.42e-17	NA
4. PB	A9BE09	GTPase Der	0.00e+00	7.44e-49	3.03e-107	NA
4. PB	Q4K396	tRNA modification GTPase MnmE	1.08e-03	5.73e-05	6.17e-13	NA
4. PB	A7N0X8	tRNA modification GTPase MnmE	1.72e-03	1.81e-05	2.80e-12	NA
4. PB	P32559	tRNA modification GTPase MSS1, mitochondrial	2.56e-04	1.85e-03	1.35e-16	NA
4. PB	Q501Z5	tRNA modification GTPase GTPBP3, mitochondrial	2.99e-04	1.08e-02	1.03e-06	NA
4. PB	Q87TS2	tRNA modification GTPase MnmE	1.87e-03	1.34e-05	3.18e-14	NA
4. PB	Q72PQ1	GTPase Der	0.00e+00	2.43e-38	9.30e-67	NA
4. PB	Q1LH94	tRNA modification GTPase MnmE	3.02e-03	7.11e-06	2.75e-12	NA
4. PB	Q9WYA4	tRNA modification GTPase MnmE	1.41e-04	6.55e-04	9.95e-18	NA
4. PB	C4ZD63	GTPase Der	0.00e+00	1.65e-64	3.01e-135	NA
4. PB	Q119L7	GTPase Der	0.00e+00	9.56e-52	3.43e-114	NA
4. PB	Q0TPJ9	GTPase Der	0.00e+00	2.51e-71	5.80e-134	NA
4. PB	Q2NQ72	tRNA modification GTPase MnmE	8.71e-03	5.91e-06	3.78e-14	NA
4. PB	B0TQH0	tRNA modification GTPase MnmE	2.48e-03	2.28e-05	6.62e-13	NA
4. PB	Q03KR8	tRNA modification GTPase MnmE	4.21e-04	4.29e-06	1.83e-19	NA
4. PB	Q0AWJ4	GTPase Obg	2.03e-02	1.35e-03	0.028	NA
4. PB	Q5NKZ8	tRNA modification GTPase MnmE	4.34e-03	3.78e-04	3.94e-11	NA
4. PB	Q879S5	tRNA modification GTPase MnmE	9.82e-04	3.20e-04	1.01e-14	NA
4. PB	A9IK66	GTPase Der	0.00e+00	6.22e-54	3.05e-89	NA
4. PB	Q3K429	tRNA modification GTPase MnmE	9.31e-04	2.28e-05	1.57e-14	NA
4. PB	A5FP49	GTPase Obg	1.55e-02	6.19e-04	3.19e-06	NA
4. PB	A0RQK2	GTPase Der	0.00e+00	8.05e-48	2.34e-87	NA
4. PB	Q0HD65	tRNA modification GTPase MnmE	3.05e-03	1.42e-05	5.06e-13	NA
4. PB	A9B567	GTPase Der	0.00e+00	2.54e-58	3.70e-119	NA
4. PB	Q8XB41	tRNA modification GTPase MnmE	3.04e-03	1.32e-04	6.34e-12	NA
4. PB	Q64X55	tRNA modification GTPase MnmE	6.36e-05	8.19e-07	2.44e-15	NA
4. PB	A4WGH1	tRNA modification GTPase MnmE	2.68e-03	3.86e-05	1.75e-11	NA
4. PB	Q2N6I9	tRNA modification GTPase MnmE	6.02e-03	5.49e-03	6.35e-11	NA
4. PB	B2TUS2	tRNA modification GTPase MnmE	2.63e-03	1.11e-04	6.06e-12	NA
4. PB	A6VQS6	tRNA modification GTPase MnmE	1.65e-03	5.50e-06	2.00e-13	NA
4. PB	C4Z0C8	GTPase Der	0.00e+00	4.29e-66	6.08e-133	NA
4. PB	Q5P9B1	tRNA modification GTPase MnmE	1.40e-03	8.99e-03	7.74e-12	NA
4. PB	Q1D5X5	GTPase Der	0.00e+00	6.31e-49	7.79e-117	NA
4. PB	A0Q7G4	tRNA modification GTPase MnmE	4.45e-03	3.80e-07	1.84e-08	NA
4. PB	A7MN03	tRNA modification GTPase MnmE	3.42e-03	3.83e-05	2.64e-12	NA
4. PB	A4J9S1	tRNA modification GTPase MnmE	7.11e-03	2.19e-04	3.53e-21	NA
4. PB	A2REM7	tRNA modification GTPase MnmE	3.37e-04	3.91e-06	1.30e-18	NA
4. PB	Q5JGB4	GTPase HflX	1.54e-04	3.86e-08	4.69e-06	NA
4. PB	Q89Z26	tRNA modification GTPase MnmE	1.17e-04	6.53e-07	2.70e-16	NA
4. PB	A8F2P7	tRNA modification GTPase MnmE	2.85e-04	1.63e-04	1.03e-11	NA
4. PB	Q6ND14	tRNA modification GTPase MnmE	1.01e-02	9.15e-05	5.54e-08	NA
4. PB	Q2FYG0	GTPase Der	0.00e+00	6.31e-69	6.91e-155	NA
4. PB	B5RFY2	tRNA modification GTPase MnmE	2.38e-03	4.57e-05	1.82e-11	NA
4. PB	Q8RBA5	GTPase Obg	5.41e-02	1.26e-02	0.013	NA
4. PB	Q97R24	tRNA modification GTPase MnmE	2.25e-04	2.13e-06	6.24e-19	NA
4. PB	Q4ZL12	tRNA modification GTPase MnmE	3.31e-03	9.79e-05	9.97e-14	NA
4. PB	Q2JM09	GTPase Der	0.00e+00	2.54e-50	9.44e-103	NA
4. PB	A2SMI8	tRNA modification GTPase MnmE	1.07e-03	3.42e-03	8.07e-12	NA
4. PB	Q1CVG4	tRNA modification GTPase MnmE	4.73e-04	1.44e-02	2.06e-08	NA
4. PB	Q2GI42	tRNA modification GTPase MnmE	1.25e-02	2.81e-03	2.70e-06	NA
4. PB	Q5E8Z9	tRNA modification GTPase MnmE	1.71e-03	4.02e-05	2.12e-12	NA
4. PB	A6T4D6	tRNA modification GTPase MnmE	6.98e-03	8.46e-05	1.06e-14	NA
4. PB	A4YJT5	tRNA modification GTPase MnmE	8.38e-03	2.21e-04	7.02e-07	NA
4. PB	Q72K85	tRNA modification GTPase MnmE	9.77e-04	1.68e-04	3.22e-10	NA
4. PB	Q0BLL9	tRNA modification GTPase MnmE	2.88e-03	4.94e-07	1.87e-08	NA
4. PB	Q8Z2N8	tRNA modification GTPase MnmE	2.56e-03	4.80e-05	6.17e-11	NA
4. PB	Q0KFG6	tRNA modification GTPase MnmE	1.91e-03	9.15e-05	1.97e-11	NA
4. PB	Q02A42	tRNA modification GTPase MnmE	2.08e-03	2.65e-05	5.66e-18	NA
4. PB	A1AV43	tRNA modification GTPase MnmE	5.18e-04	1.49e-05	5.09e-15	NA
4. PB	Q4A6N4	GTPase Obg	1.71e-02	8.25e-03	0.005	NA
4. PB	Q8DTT8	tRNA modification GTPase MnmE	1.00e-04	1.71e-06	1.95e-18	NA
4. PB	B7IE34	GTPase Der	0.00e+00	2.29e-59	4.34e-80	NA
4. PB	B1M0E0	tRNA modification GTPase MnmE	3.29e-04	2.80e-04	2.02e-10	NA
4. PB	B4F0U0	tRNA modification GTPase MnmE	6.15e-03	2.19e-05	5.59e-11	NA
4. PB	Q73GH3	tRNA modification GTPase MnmE	2.17e-02	2.06e-02	1.07e-04	NA
4. PB	B4TN11	tRNA modification GTPase MnmE	2.10e-03	4.31e-05	1.92e-11	NA
4. PB	B1GYZ9	tRNA modification GTPase MnmE	2.15e-03	1.35e-05	2.49e-15	NA
4. PB	Q3J6L9	tRNA modification GTPase MnmE	1.12e-03	1.87e-03	2.78e-07	NA
4. PB	A6QAL0	tRNA modification GTPase MnmE	3.30e-04	2.24e-05	1.34e-18	NA
4. PB	B0T6E0	tRNA modification GTPase MnmE	3.05e-03	2.27e-06	9.21e-10	NA
4. PB	O67030	tRNA modification GTPase MnmE	9.77e-04	2.65e-05	9.75e-21	NA
4. PB	A7HSK9	tRNA modification GTPase MnmE	1.29e-03	1.07e-03	7.31e-08	NA
4. PB	B3QZT1	GTPase Obg	1.76e-02	1.02e-03	3.93e-04	NA
4. PB	Q047F9	tRNA modification GTPase MnmE	3.64e-04	2.28e-05	5.85e-17	NA
4. PB	Q97CW2	tRNA modification GTPase MnmE	8.41e-04	1.03e-04	7.29e-17	NA
4. PB	A5IKF4	tRNA modification GTPase MnmE	2.15e-04	3.82e-04	1.16e-17	NA
4. PB	A8G7P7	tRNA modification GTPase MnmE	3.15e-03	5.19e-05	2.05e-12	NA
4. PB	Q1JLX3	tRNA modification GTPase MnmE	2.28e-04	3.04e-06	1.39e-18	NA
4. PB	C0R405	tRNA modification GTPase MnmE	4.61e-02	6.31e-04	9.96e-05	NA
4. PB	Q9CDH8	tRNA modification GTPase MnmE	3.14e-04	9.56e-06	2.48e-17	NA
4. PB	Q3SWH5	tRNA modification GTPase MnmE	1.66e-03	1.16e-05	2.82e-09	NA
4. PB	Q15MS9	tRNA modification GTPase MnmE	2.64e-03	1.81e-05	3.42e-11	NA
4. PB	Q6G1K8	tRNA modification GTPase MnmE	6.47e-04	1.64e-05	1.86e-08	NA
4. PB	Q926U7	tRNA modification GTPase MnmE	1.45e-04	4.76e-06	3.19e-14	NA
4. PB	Q7W6Q0	GTPase Der	0.00e+00	3.23e-52	1.15e-92	NA
4. PB	C4XIQ6	GTPase Der	0.00e+00	1.43e-61	5.96e-90	NA
4. PB	B7UMH3	tRNA modification GTPase MnmE	2.71e-03	4.52e-05	6.28e-12	NA
4. PB	Q4A8F6	tRNA modification GTPase MnmE	4.77e-04	4.80e-05	2.28e-14	NA
4. PB	P66973	tRNA modification GTPase MnmE	3.72e-04	2.24e-06	4.18e-16	NA
4. PB	Q6F2A3	tRNA modification GTPase MnmE	4.89e-04	1.57e-04	1.08e-13	NA
4. PB	Q7VWL4	GTPase Der	0.00e+00	3.23e-52	1.15e-92	NA
4. PB	B1ZGG9	tRNA modification GTPase MnmE	9.73e-04	2.50e-04	5.56e-10	NA
4. PB	A6UEE9	tRNA modification GTPase MnmE	1.32e-03	7.98e-05	2.48e-12	NA
4. PB	A0AMD2	tRNA modification GTPase MnmE	1.34e-04	2.68e-05	2.99e-14	NA
4. PB	B2S3S8	GTPase Der	2.22e-16	2.96e-48	4.51e-73	NA
4. PB	Q5HW81	GTPase Der	0.00e+00	6.11e-50	7.04e-86	NA
4. PB	A8GTM1	tRNA modification GTPase MnmE	2.90e-04	3.60e-05	1.09e-12	NA
4. PB	Q92GE8	tRNA modification GTPase MnmE	3.40e-04	3.40e-05	1.07e-12	NA
4. PB	Q5LLM7	tRNA modification GTPase MnmE	3.23e-03	1.19e-03	5.68e-08	NA
4. PB	C6DK97	tRNA modification GTPase MnmE	2.55e-03	4.52e-05	2.17e-11	NA
4. PB	Q7MT48	GTPase Der	0.00e+00	1.66e-66	1.62e-114	NA
4. PB	Q6FYB8	tRNA modification GTPase MnmE	5.34e-03	1.79e-05	8.53e-08	NA
4. PB	Q8Y3M4	tRNA modification GTPase MnmE	1.68e-04	4.20e-06	3.34e-14	NA
4. PB	A8FP41	tRNA modification GTPase MnmE	3.25e-03	5.51e-05	8.75e-13	NA
4. PB	A6Q3D6	tRNA modification GTPase MnmE	2.37e-04	1.88e-04	3.58e-21	NA
4. PB	Q5SHE9	GTPase Obg	7.55e-03	5.97e-06	0.032	NA
4. PB	A6TG09	tRNA modification GTPase MnmE	2.61e-03	6.26e-05	3.49e-11	NA
4. PB	Q7U8G2	GTPase Der	0.00e+00	7.71e-53	1.25e-110	NA
4. PB	A9MJT6	tRNA modification GTPase MnmE	2.80e-03	1.10e-04	9.39e-12	NA
4. PB	C5CIV1	GTPase Der	0.00e+00	5.31e-57	2.87e-86	NA
4. PB	Q477Q5	tRNA modification GTPase MnmE	2.25e-03	3.11e-05	1.38e-12	NA
4. PB	Q3BLZ9	tRNA modification GTPase MnmE	3.48e-04	3.75e-05	2.40e-14	NA
4. PB	Q6MTG9	GTPase Obg	4.73e-02	2.33e-03	0.002	NA
4. PB	Q1JH22	tRNA modification GTPase MnmE	9.36e-04	3.41e-06	1.37e-18	NA
4. PB	Q46H20	GTPase Der	0.00e+00	1.62e-45	6.74e-105	NA
4. PB	Q0BWA8	tRNA modification GTPase MnmE	1.21e-03	1.57e-05	1.04e-08	NA
4. PB	Q7NGF9	GTPase Der	0.00e+00	4.04e-51	8.74e-108	NA
4. PB	Q47U36	tRNA modification GTPase MnmE	1.66e-03	1.32e-05	1.51e-11	NA
4. PB	C0QA05	GTPase Der	0.00e+00	1.41e-26	4.23e-117	NA
4. PB	Q3K1I2	tRNA modification GTPase MnmE	4.37e-04	3.56e-06	1.22e-17	NA
4. PB	B7NR09	tRNA modification GTPase MnmE	2.49e-03	7.75e-05	5.45e-12	NA
4. PB	P0DG22	tRNA modification GTPase MnmE	2.18e-04	2.68e-06	1.44e-18	NA
4. PB	A2C0J7	GTPase Der	0.00e+00	5.49e-47	4.01e-104	NA
4. PB	Q6F0U3	GTPase Obg	3.79e-02	2.28e-02	1.55e-04	NA
4. PB	Q04TV4	GTPase Der	0.00e+00	1.80e-41	1.34e-65	NA
4. PB	Q1I2H5	tRNA modification GTPase MnmE	1.40e-03	3.20e-05	2.36e-13	NA
4. PB	A0RNG2	tRNA modification GTPase MnmE	2.16e-04	7.37e-03	4.57e-16	NA
4. PB	Q5LG80	tRNA modification GTPase MnmE	5.89e-05	9.21e-07	2.55e-15	NA
4. PB	Q3ZAJ2	GTPase Obg	1.91e-02	7.66e-04	3.84e-06	NA
4. PB	A4T0N1	tRNA modification GTPase MnmE	6.52e-03	2.93e-05	1.51e-10	NA
4. PB	Q7VQV3	tRNA modification GTPase MnmE	2.90e-03	7.68e-05	3.25e-12	NA
4. PB	C1D094	GTPase Der	0.00e+00	6.07e-51	1.35e-96	NA
4. PB	A5FGE0	tRNA modification GTPase MnmE	1.28e-04	4.16e-06	2.05e-13	NA
4. PB	Q5SJS7	tRNA modification GTPase MnmE	3.90e-03	1.41e-04	2.09e-10	NA
4. PB	Q2GIJ8	tRNA modification GTPase MnmE	1.47e-03	6.02e-05	3.40e-11	NA
4. PB	Q0AKE8	tRNA modification GTPase MnmE	5.26e-03	4.56e-04	8.21e-09	NA
4. PB	Q1CCJ3	tRNA modification GTPase MnmE	2.88e-03	2.99e-05	2.13e-11	NA
4. PB	Q8RGV7	GTPase Der	0.00e+00	9.94e-74	1.67e-132	NA
4. PB	Q2YZB8	tRNA modification GTPase MnmE	2.11e-04	2.55e-06	4.11e-16	NA
4. PB	Q5X0M3	tRNA modification GTPase MnmE	2.50e-03	1.81e-05	1.29e-11	NA
4. PB	B7L851	tRNA modification GTPase MnmE	2.32e-03	9.23e-05	5.70e-12	NA
4. PB	A9M0N5	tRNA modification GTPase MnmE	1.38e-02	7.46e-05	2.84e-11	NA
4. PB	Q7NAD9	tRNA modification GTPase MnmE	3.05e-04	9.51e-05	3.06e-15	NA
4. PB	Q5F529	tRNA modification GTPase MnmE	5.30e-03	9.32e-05	2.84e-11	NA
4. PB	Q5XCB7	tRNA modification GTPase MnmE	2.30e-04	3.67e-06	4.10e-18	NA
4. PB	A4W2N6	tRNA modification GTPase MnmE	3.12e-04	3.34e-06	7.44e-19	NA
4. PB	Q8YJS6	tRNA modification GTPase MnmE	9.47e-04	1.97e-03	6.97e-10	NA
4. PB	Q602M5	tRNA modification GTPase MnmE	1.65e-03	7.95e-04	5.40e-14	NA
4. PB	B1Y0F6	tRNA modification GTPase MnmE	1.10e-03	3.23e-05	3.85e-13	NA
4. PB	Q1GP64	tRNA modification GTPase MnmE	3.00e-03	4.57e-05	1.08e-08	NA
4. PB	Q7V8X0	GTPase Der	0.00e+00	5.48e-53	6.09e-110	NA
4. PB	C1D6H7	tRNA modification GTPase MnmE	8.15e-03	3.07e-03	4.75e-15	NA
4. PB	Q71VV0	tRNA modification GTPase MnmE	1.60e-04	3.91e-06	3.10e-14	NA
4. PB	Q3AFV0	GTPase HflX	1.35e-03	2.09e-06	0.006	NA
4. PB	P0CAX2	tRNA modification GTPase MnmE	2.16e-03	5.44e-06	1.70e-10	NA
4. PB	B5YFX9	GTPase Der	0.00e+00	1.34e-64	1.50e-92	NA
4. PB	A1S1G4	tRNA modification GTPase MnmE	4.47e-03	7.41e-06	8.91e-13	NA
4. PB	A5E8G7	tRNA modification GTPase MnmE	3.35e-03	1.81e-04	2.79e-07	NA
4. PB	A8ACL8	tRNA modification GTPase MnmE	2.40e-03	4.31e-05	1.83e-11	NA
4. PB	Q48BF3	tRNA modification GTPase MnmE	2.29e-03	4.06e-05	9.88e-14	NA
4. PB	A2BV51	GTPase Der	0.00e+00	8.19e-46	9.91e-107	NA
4. PB	A9R5S1	tRNA modification GTPase MnmE	2.86e-03	2.99e-05	2.13e-11	NA
4. PB	A8YYS1	tRNA modification GTPase MnmE	3.13e-04	1.80e-06	4.14e-16	NA
4. PB	A9NE34	tRNA modification GTPase MnmE	4.40e-04	4.81e-06	1.66e-20	NA
4. PB	B0K8H9	tRNA modification GTPase MnmE	5.57e-03	2.50e-04	6.03e-18	NA
4. PB	Q1QRZ0	tRNA modification GTPase MnmE	1.10e-03	1.54e-05	1.45e-07	NA
4. PB	A5G692	GTPase Der	0.00e+00	1.61e-65	6.29e-119	NA
4. PB	Q0A4L6	tRNA modification GTPase MnmE	1.25e-03	1.74e-05	2.01e-07	NA
4. PB	A9CHB2	tRNA modification GTPase MnmE	7.68e-04	4.78e-04	8.10e-10	NA
4. PB	B9M914	GTPase Der	0.00e+00	6.26e-67	8.73e-120	NA
4. PB	Q7NPT9	tRNA modification GTPase MnmE	6.86e-03	3.29e-04	1.69e-11	NA
4. PB	A6VF44	tRNA modification GTPase MnmE	1.29e-03	6.07e-05	2.35e-15	NA
4. PB	B5QUQ5	tRNA modification GTPase MnmE	3.06e-03	4.31e-05	1.92e-11	NA
4. PB	Q121L2	tRNA modification GTPase MnmE	1.63e-03	1.71e-03	6.90e-09	NA
4. PB	Q3AVY3	tRNA modification GTPase MnmE	4.07e-04	1.18e-03	5.92e-16	NA
4. PB	Q5P4P5	tRNA modification GTPase MnmE	3.77e-03	1.90e-04	1.54e-12	NA
4. PB	B0RMM4	tRNA modification GTPase MnmE	7.75e-03	6.13e-05	1.20e-13	NA
4. PB	A6L6E8	tRNA modification GTPase MnmE	1.92e-04	1.15e-05	1.56e-15	NA
4. PB	A9HE16	tRNA modification GTPase MnmE	6.05e-03	7.90e-03	7.55e-12	NA
4. PB	Q55C52	tRNA modification GTPase gtpbp3, mitochondrial	4.30e-04	1.45e-04	1.18e-08	NA
4. PB	B7JC34	GTPase Der	0.00e+00	3.64e-55	1.70e-99	NA
4. PB	A6WUK3	tRNA modification GTPase MnmE	2.91e-03	1.35e-05	1.09e-12	NA
4. PB	Q8ZKY3	tRNA modification GTPase MnmE	2.34e-03	4.39e-05	1.82e-11	NA
4. PB	Q8CY34	tRNA modification GTPase MnmE	3.88e-03	3.70e-03	3.35e-09	NA
4. PB	B5EJF7	GTPase Der	0.00e+00	3.64e-55	1.70e-99	NA
4. PB	Q1WVH7	tRNA modification GTPase MnmE	2.76e-04	1.26e-05	2.51e-17	NA
4. PB	Q494C0	tRNA modification GTPase MnmE	6.54e-04	3.57e-05	7.01e-15	NA
4. PB	Q39PQ9	tRNA modification GTPase MnmE	3.15e-04	1.45e-05	1.87e-15	NA
4. PB	Q5HS36	tRNA modification GTPase MnmE	5.08e-04	2.74e-06	4.62e-17	NA
4. PB	Q82XA1	tRNA modification GTPase MnmE	2.73e-03	1.20e-05	3.84e-17	NA
4. PB	Q7W2J0	tRNA modification GTPase MnmE	2.48e-02	1.07e-04	2.11e-11	NA
4. PB	Q1R4M8	tRNA modification GTPase MnmE	2.46e-03	8.71e-05	6.12e-12	NA
4. PB	C4K4J2	GTPase Der	0.00e+00	1.50e-40	4.48e-82	NA
4. PB	Q03D59	tRNA modification GTPase MnmE	3.68e-04	6.48e-06	2.54e-15	NA
4. PB	Q0VKU8	tRNA modification GTPase MnmE	2.07e-03	4.66e-05	4.54e-12	NA
4. PB	A9KX19	tRNA modification GTPase MnmE	2.76e-03	1.14e-05	1.76e-12	NA
4. PB	Q9PRC7	tRNA modification GTPase MnmE	1.66e-03	3.29e-04	7.99e-11	NA
4. PB	A3PNS7	tRNA modification GTPase MnmE	1.27e-03	9.32e-05	2.01e-11	NA
4. PB	Q13E22	tRNA modification GTPase MnmE	9.04e-03	7.72e-06	2.85e-09	NA
4. PB	B7M559	tRNA modification GTPase MnmE	2.59e-03	1.11e-04	6.06e-12	NA
4. PB	Q46VM0	tRNA modification GTPase MnmE	3.51e-03	1.23e-04	1.27e-11	NA
4. PB	A1TWI4	tRNA modification GTPase MnmE	1.49e-03	8.80e-05	2.07e-09	NA
4. PB	Q1RKJ6	tRNA modification GTPase MnmE	3.52e-04	4.94e-05	6.57e-13	NA
4. PB	B0KRC0	tRNA modification GTPase MnmE	1.64e-03	5.09e-05	4.51e-13	NA
4. PB	Q8F6K1	GTPase Der	0.00e+00	8.12e-39	1.97e-66	NA
4. PB	A8HAH9	tRNA modification GTPase MnmE	3.87e-03	1.88e-05	1.37e-12	NA
4. PB	Q5N167	GTPase Der	0.00e+00	3.26e-51	6.93e-106	NA
4. PB	P0DG23	tRNA modification GTPase MnmE	2.81e-04	2.68e-06	1.44e-18	NA
4. PB	A6LDT9	tRNA modification GTPase MnmE	2.67e-03	2.49e-05	2.31e-17	NA
4. PB	A8F7S2	GTPase Der	0.00e+00	9.11e-51	3.09e-76	NA
4. PB	Q6MUE7	tRNA modification GTPase MnmE	4.81e-04	3.79e-05	6.92e-14	NA
4. PB	B3CMJ7	tRNA modification GTPase MnmE	6.93e-03	1.40e-04	1.02e-04	NA
4. PB	Q8EUV6	tRNA modification GTPase MnmE	2.44e-04	9.06e-05	2.98e-12	NA
4. PB	P0A6P5	GTPase Der	0.00e+00	9.82e-39	9.20e-92	NA
4. PB	A1WE12	GTPase Der	0.00e+00	2.08e-46	1.88e-74	NA
4. PB	Q0SYP6	tRNA modification GTPase MnmE	3.03e-03	1.03e-04	5.80e-12	NA
4. PB	B3Q8A8	tRNA modification GTPase MnmE	1.09e-02	1.02e-04	5.26e-08	NA
4. PB	A2RP37	tRNA modification GTPase MnmE	4.82e-04	4.11e-06	5.35e-17	NA
4. PB	Q2YR11	tRNA modification GTPase MnmE	3.22e-03	1.97e-03	7.41e-10	NA
4. PB	Q5ZR82	tRNA modification GTPase MnmE	4.43e-03	1.67e-05	6.25e-13	NA
4. PB	A5CVJ3	tRNA modification GTPase MnmE	1.55e-03	1.42e-05	4.58e-12	NA
4. PB	Q0ICK8	GTPase Der	0.00e+00	4.33e-49	5.32e-107	NA
4. PB	Q2SRV9	GTPase Obg	4.23e-02	2.60e-03	0.001	NA
4. PB	A5IYU8	GTPase Obg	2.06e-02	2.56e-02	0.011	NA
4. PB	Q329B1	tRNA modification GTPase MnmE	2.91e-03	1.05e-04	6.45e-12	NA
4. PB	Q31DJ0	tRNA modification GTPase MnmE	2.42e-03	3.14e-06	1.66e-14	NA
4. PB	Q6F6L1	tRNA modification GTPase MnmE	1.02e-03	5.70e-04	9.40e-13	NA
4. PB	Q31UW0	tRNA modification GTPase MnmE	3.04e-03	1.11e-04	6.06e-12	NA
4. PB	Q2A342	tRNA modification GTPase MnmE	2.77e-03	3.85e-07	1.87e-08	NA
4. PB	Q2RN77	tRNA modification GTPase MnmE	1.69e-03	8.91e-03	1.68e-11	NA
4. PB	Q4UNL0	tRNA modification GTPase MnmE	1.46e-03	1.02e-04	1.22e-13	NA
4. PB	A7ZTR2	tRNA modification GTPase MnmE	2.37e-03	9.23e-05	6.01e-12	NA
4. PB	Q0TLZ4	tRNA modification GTPase MnmE	1.00e-03	1.66e-04	2.91e-17	NA
4. PB	Q8DPZ8	tRNA modification GTPase MnmE	3.62e-04	2.27e-06	3.86e-19	NA
4. PB	Q4AAC5	tRNA modification GTPase MnmE	4.48e-04	5.62e-05	2.03e-14	NA
4. PB	A7X7A8	tRNA modification GTPase MnmE	2.41e-03	2.92e-06	3.46e-16	NA
4. PB	Q6CYQ9	tRNA modification GTPase MnmE	3.50e-03	2.78e-05	3.30e-11	NA
4. PB	A4IX14	tRNA modification GTPase MnmE	3.06e-03	2.35e-07	1.82e-08	NA
4. PB	A4VS81	tRNA modification GTPase MnmE	1.50e-03	3.57e-05	5.64e-14	NA
4. PB	Q2S6M6	tRNA modification GTPase MnmE	2.36e-03	2.04e-05	6.99e-12	NA
4. PB	Q2GD53	tRNA modification GTPase MnmE	4.13e-02	1.71e-02	9.17e-09	NA
4. PB	Q87TR6	tRNA modification GTPase MnmE	2.50e-03	1.76e-05	2.83e-12	NA
4. PB	Q3AI13	GTPase Der	0.00e+00	5.92e-54	2.16e-110	NA
4. PB	Q6MGL5	tRNA modification GTPase MnmE	8.98e-04	6.19e-07	9.18e-14	NA
4. PB	B7LK49	tRNA modification GTPase MnmE	2.70e-03	7.38e-05	5.80e-12	NA
4. PB	A6WX76	tRNA modification GTPase MnmE	8.66e-03	4.35e-04	1.90e-10	NA
4. PB	Q14GV5	tRNA modification GTPase MnmE	4.16e-03	1.62e-07	1.90e-08	NA
4. PB	A7HZI3	GTPase Der	0.00e+00	4.24e-51	1.10e-89	NA
4. PB	Q2FUQ2	tRNA modification GTPase MnmE	3.02e-03	2.24e-06	4.18e-16	NA
4. PB	Q9CLQ1	tRNA modification GTPase MnmE	4.21e-03	6.09e-06	8.52e-14	NA
4. PB	P9WNL3	GTPase Der	0.00e+00	3.26e-40	3.24e-88	NA
4. PB	Q5GTQ0	tRNA modification GTPase MnmE	8.73e-03	4.73e-04	2.01e-04	NA
4. PB	Q1GCM0	tRNA modification GTPase MnmE	1.04e-02	1.20e-02	1.21e-07	NA
4. PB	Q9JXL4	tRNA modification GTPase MnmE	5.21e-03	8.46e-05	2.79e-11	NA
4. PB	B9LBT6	GTPase Der	0.00e+00	4.64e-60	1.20e-121	NA
4. PB	A0LLH5	tRNA modification GTPase MnmE	2.74e-04	5.78e-05	3.07e-17	NA
4. PB	Q5PKU1	tRNA modification GTPase MnmE	3.10e-03	5.84e-05	6.62e-11	NA
4. PB	Q3ZW89	GTPase Obg	1.19e-02	6.19e-04	3.19e-06	NA
4. PB	B0TYD1	tRNA modification GTPase MnmE	4.43e-03	1.24e-06	4.04e-08	NA
4. PB	C4ZYY4	tRNA modification GTPase MnmE	2.31e-03	1.11e-04	6.06e-12	NA
4. PB	C0ZCB6	GTPase Der	0.00e+00	8.44e-67	6.04e-135	NA
4. PB	Q7NHT3	tRNA modification GTPase MnmE	2.61e-04	1.42e-05	4.31e-20	NA
4. PB	A5VA82	tRNA modification GTPase MnmE	1.50e-03	1.49e-02	1.67e-09	NA
4. PB	A1AXR3	tRNA modification GTPase MnmE	4.72e-03	2.27e-04	8.88e-12	NA
4. PB	A9BHZ7	tRNA modification GTPase MnmE	1.13e-02	6.49e-04	3.92e-16	NA
4. PB	Q7MQK6	tRNA modification GTPase MnmE	1.46e-03	8.22e-05	3.35e-12	NA
4. PB	Q2J357	tRNA modification GTPase MnmE	6.19e-03	4.83e-07	2.87e-09	NA
4. PB	Q0TB01	tRNA modification GTPase MnmE	2.83e-03	8.71e-05	6.12e-12	NA
4. PB	Q9P9U3	tRNA modification GTPase MnmE	5.14e-03	4.08e-04	5.08e-15	NA
4. PB	A1WDB4	tRNA modification GTPase MnmE	4.85e-03	3.40e-05	1.53e-10	NA
4. PB	Q57HZ6	tRNA modification GTPase MnmE	2.45e-03	4.31e-05	1.92e-11	NA
4. PB	P0A176	tRNA modification GTPase MnmE	1.26e-03	5.09e-05	2.16e-13	NA
4. PB	A4TSL0	tRNA modification GTPase MnmE	3.44e-03	2.99e-05	2.13e-11	NA
4. PB	Q3YWA7	tRNA modification GTPase MnmE	2.03e-03	7.60e-05	6.17e-12	NA
4. PB	Q1J6U1	tRNA modification GTPase MnmE	2.26e-04	2.65e-06	1.35e-18	NA
4. PB	Q2K2S0	tRNA modification GTPase MnmE	1.69e-02	9.42e-05	5.86e-07	NA
5. P	Q4A8X1	GTPase Obg	3.97e-02	4.73e-04	NA	NA
5. P	A5ITG8	GTPase Obg	4.83e-02	1.05e-02	NA	NA
5. P	B9DSH7	GTPase Obg	2.08e-02	1.88e-03	NA	NA
5. P	C0MBS1	GTPase Obg	1.40e-02	4.73e-03	NA	NA
5. P	A9VIR5	GTPase Obg	2.59e-02	3.84e-02	NA	NA
5. P	A4IRC7	GTPase Obg	2.61e-02	1.63e-02	NA	NA
5. P	Q9Z873	GTPase HflX	9.16e-04	1.35e-05	NA	NA
5. P	B8FUR9	GTPase Obg	4.66e-02	5.54e-04	NA	NA
5. P	Q24SP0	GTPase Obg	3.19e-02	8.55e-04	NA	NA
5. P	Q04KK7	GTPase Obg	1.77e-02	1.88e-02	NA	NA
5. P	B1I5V8	GTPase Obg	2.14e-02	3.83e-03	NA	NA
5. P	A7X361	GTPase Obg	2.41e-02	1.05e-02	NA	NA
5. P	Q72ZY5	GTPase Obg	3.47e-02	3.87e-02	NA	NA
5. P	A8Z2H2	GTPase Obg	2.43e-02	1.05e-02	NA	NA
5. P	B7GIR2	GTPase Obg	2.88e-02	1.35e-03	NA	NA
5. P	Q817U6	GTPase Obg	1.79e-02	3.31e-02	NA	NA
5. P	A7FXU6	GTPase Obg	7.70e-03	3.13e-02	NA	NA
5. P	Q5KWP5	GTPase Obg	4.05e-02	2.01e-02	NA	NA
5. P	D3FTV4	GTPase HflX	2.19e-03	9.15e-05	NA	NA
5. P	A8AWM9	GTPase Obg	1.96e-02	2.21e-02	NA	NA
5. P	A9AXD9	GTPase Obg	6.49e-02	4.43e-04	NA	NA
5. P	Q6GG60	GTPase Obg	2.10e-02	6.53e-03	NA	NA
5. P	Q2RKZ8	GTPase Obg	3.33e-02	1.36e-03	NA	NA
5. P	Q99TK9	GTPase Obg	5.32e-02	1.05e-02	NA	NA
5. P	B1H0I4	GTPase Obg	7.94e-03	1.95e-02	NA	NA
5. P	A3CM33	GTPase Obg	1.97e-02	2.95e-02	NA	NA
5. P	B8ZPS8	GTPase Obg	2.73e-02	4.49e-03	NA	NA
5. P	Q2FG83	GTPase Obg	1.50e-02	1.05e-02	NA	NA
5. P	C1F407	GTPase HflX	8.20e-04	7.38e-04	NA	NA
5. P	B9LC30	GTPase Obg	2.48e-02	1.19e-03	NA	NA
5. P	Q8DPV8	GTPase Obg	2.17e-02	1.88e-02	NA	NA
5. P	B3PMC1	GTPase Obg	1.98e-02	2.44e-03	NA	NA
5. P	B5XLZ0	GTPase Obg	2.26e-02	9.99e-04	NA	NA
5. P	Q4AAV4	GTPase Obg	1.98e-02	5.10e-04	NA	NA
5. P	Q1WT46	GTPase Obg	2.15e-02	8.09e-04	NA	NA
5. P	A3DBS5	GTPase Obg	2.48e-02	6.65e-03	NA	NA
5. P	Q8XIJ2	GTPase Obg	1.04e-02	7.90e-03	NA	NA
5. P	Q0SR54	GTPase Obg	9.20e-03	7.90e-03	NA	NA
5. P	Q8DYL0	GTPase Obg	2.45e-02	1.20e-02	NA	NA
5. P	Q9CP90	Ribosome-binding ATPase YchF	4.10e-02	1.46e-02	NA	NA
5. P	Q5HNQ7	GTPase Obg	3.56e-02	1.25e-02	NA	NA
5. P	B9IZ16	GTPase Obg	2.60e-02	2.13e-02	NA	NA
5. P	Q67SC6	GTPase Obg	2.83e-02	2.94e-04	NA	NA
5. P	Q2FXT1	GTPase Obg	2.10e-02	1.05e-02	NA	NA
5. P	Q3K046	GTPase Obg	1.81e-02	1.20e-02	NA	NA
5. P	A7TQC5	Genetic interactor of prohibitins 3, mitochondrial	2.17e-01	4.95e-02	NA	NA
5. P	Q0TNI5	GTPase Obg	7.65e-03	7.90e-03	NA	NA
5. P	B1VAF2	GTPase Obg	1.56e-02	8.18e-03	NA	NA
5. P	A5IKX2	GTPase Obg	1.65e-02	2.08e-03	NA	NA
5. P	P0DB52	GTPase Obg	1.56e-02	3.30e-03	NA	NA
5. P	Q88VG4	GTPase Obg	3.35e-02	7.87e-04	NA	NA
5. P	B0S3Z4	GTPase Obg	1.16e-02	2.64e-03	NA	NA
5. P	A4XJS8	GTPase Obg	2.14e-02	3.60e-03	NA	NA
5. P	Q602A7	GTPase Obg	3.98e-02	4.56e-04	NA	NA
5. P	Q8DUU2	GTPase Obg	1.96e-02	3.10e-03	NA	NA
5. P	Q5XBM1	GTPase Obg	1.98e-02	2.13e-03	NA	NA
5. P	B7HE73	GTPase Obg	1.98e-02	4.10e-02	NA	NA
5. P	Q1GAM3	GTPase Obg	1.12e-02	7.06e-03	NA	NA
5. P	B1HVB2	GTPase Obg	3.30e-02	4.63e-02	NA	NA
5. P	Q9KDK0	GTPase Obg	2.86e-02	1.02e-02	NA	NA
5. P	Q0I442	GTPase HflX	1.56e-03	1.19e-06	NA	NA
5. P	A6TQJ6	GTPase Obg	1.81e-02	2.25e-04	NA	NA
5. P	Q8E465	GTPase Obg	1.95e-02	1.20e-02	NA	NA
5. P	C5MHQ6	Genetic interactor of prohibitins 3, mitochondrial	2.11e-01	1.35e-02	NA	NA
5. P	Q99Z94	GTPase Obg	1.76e-02	5.49e-03	NA	NA
5. P	A6QHI6	GTPase Obg	2.55e-02	1.05e-02	NA	NA
5. P	Q38WT4	GTPase Obg	1.83e-02	5.05e-04	NA	NA
5. P	Q7A584	GTPase Obg	2.35e-02	1.05e-02	NA	NA
5. P	Q6HD85	GTPase Obg	2.61e-02	3.39e-02	NA	NA
5. P	A0Q1T4	GTPase Obg	8.67e-03	4.52e-04	NA	NA
5. P	B2GBD0	GTPase Obg	1.33e-01	2.42e-02	NA	NA
5. P	B1KZR3	GTPase Obg	5.87e-03	4.38e-02	NA	NA
5. P	A0RJ47	GTPase Obg	2.08e-02	3.39e-02	NA	NA
5. P	Q03YT6	GTPase Obg	2.75e-02	4.38e-02	NA	NA
5. P	B7JQ26	GTPase Obg	2.27e-02	2.34e-02	NA	NA
5. P	Q04EZ8	GTPase Obg	2.81e-02	2.48e-04	NA	NA
5. P	Q73LW4	GTPase Obg	4.16e-02	3.75e-02	NA	NA
5. P	Q02XY2	GTPase Obg	9.50e-02	4.04e-03	NA	NA
5. P	B9MRB8	GTPase Obg	3.83e-02	5.44e-03	NA	NA
5. P	Q97QW8	GTPase Obg	3.09e-02	4.30e-03	NA	NA
5. P	A4W0M2	GTPase Obg	2.72e-02	2.64e-03	NA	NA
5. P	Q49Y82	GTPase Obg	2.05e-02	1.54e-02	NA	NA
5. P	Q58526	GTPase HflX	1.35e-03	9.02e-07	NA	NA
5. P	B5E4J4	GTPase Obg	2.48e-02	4.30e-03	NA	NA
5. P	Q04B11	GTPase Obg	1.16e-02	7.57e-03	NA	NA
5. P	D9R4W7	GTPase HflX	5.55e-04	9.22e-03	NA	NA
5. P	B2UPE7	GTPase HflX	1.92e-04	1.06e-03	NA	NA
5. P	Q48SX8	GTPase Obg	2.00e-02	3.39e-03	NA	NA
5. P	Q6G8S5	GTPase Obg	4.14e-02	1.05e-02	NA	NA
5. P	Q2YT86	GTPase Obg	1.04e-02	3.94e-03	NA	NA
5. P	P20964	GTPase Obg	2.37e-02	1.21e-02	NA	NA
5. P	B1IBL9	GTPase Obg	3.36e-02	5.03e-03	NA	NA
5. P	P25519	GTPase HflX	2.02e-03	2.65e-05	NA	NA
5. P	A0L4B2	GTPase HflX	4.84e-04	3.85e-07	NA	NA
5. P	Q7A0Q3	GTPase Obg	2.21e-02	1.05e-02	NA	NA
5. P	B4U3Q7	GTPase Obg	1.79e-02	7.18e-03	NA	NA
5. P	B2G6R9	GTPase Obg	1.70e-02	6.76e-03	NA	NA
5. P	A9WK62	GTPase Obg	2.37e-02	1.19e-03	NA	NA
5. P	A2RJQ6	GTPase Obg	1.50e-02	2.55e-03	NA	NA
5. P	A5UZ80	GTPase Obg	2.33e-02	5.49e-04	NA	NA
5. P	Q65GM7	GTPase Obg	1.39e-02	6.82e-03	NA	NA
5. P	A9KMF5	GTPase Obg	4.91e-03	1.51e-04	NA	NA
5. P	B1N057	GTPase Obg	2.53e-02	3.57e-03	NA	NA
5. P	A6H294	GTPase HflX	8.05e-04	1.82e-02	NA	NA
5. P	A5D410	GTPase Obg	2.99e-02	1.09e-03	NA	NA
5. P	Q8CNZ7	GTPase Obg	6.00e-02	6.76e-03	NA	NA
5. P	Q97JL4	GTPase Obg	8.60e-03	1.18e-02	NA	NA
5. P	P0DB53	GTPase Obg	2.15e-02	3.30e-03	NA	NA
5. P	B5YEQ1	GTPase Obg	4.25e-02	6.31e-03	NA	NA
5. P	Q9RY66	GTPase Obg	2.98e-02	4.22e-03	NA	NA
5. P	C1ETN7	GTPase Obg	3.29e-02	3.39e-02	NA	NA
5. P	B8I179	GTPase Obg	2.70e-02	8.46e-03	NA	NA
5. P	Q5M3C8	GTPase Obg	2.19e-02	1.65e-03	NA	NA
5. P	Q634A3	GTPase Obg	1.75e-02	3.39e-02	NA	NA
5. P	A4VUC8	GTPase Obg	2.06e-02	2.86e-03	NA	NA
5. P	Q6YRC6	GTPase Obg	2.45e-02	4.43e-04	NA	NA
5. P	Q1JLA1	GTPase Obg	2.03e-02	1.63e-03	NA	NA
5. P	A6LJZ0	GTPase Obg	1.80e-02	6.86e-04	NA	NA
5. P	B1YJR9	GTPase Obg	1.70e-02	3.10e-02	NA	NA
5. P	Q3AF51	GTPase Obg	1.37e-02	3.87e-03	NA	NA
5. P	Q8RAS5	GTPase HflX	1.04e-03	1.37e-03	NA	NA
5. P	Q039J3	GTPase Obg	7.45e-03	2.44e-03	NA	NA
5. P	A8MHK8	GTPase Obg	4.50e-02	1.28e-03	NA	NA
5. P	A7HJZ8	GTPase Obg	1.89e-02	7.73e-04	NA	NA
5. P	Q1J652	GTPase Obg	1.62e-02	2.23e-03	NA	NA
5. P	A2RE30	GTPase Obg	1.61e-02	1.71e-03	NA	NA
5. P	A1RY30	GTPase HflX	3.91e-04	5.44e-06	NA	NA
5. P	Q83MU8	GTPase Obg	1.56e-02	3.27e-03	NA	NA
5. P	B2IQ29	GTPase Obg	2.70e-02	8.04e-03	NA	NA
5. P	B7IIV2	GTPase Obg	2.03e-02	4.31e-02	NA	NA
5. P	P47624	GTPase Obg	2.64e-02	2.72e-02	NA	NA
5. P	B8GA36	GTPase Obg	2.00e-02	1.54e-03	NA	NA
5. P	A5VJ99	GTPase Obg	1.74e-02	6.76e-03	NA	NA
5. P	B7IGK8	GTPase Obg	2.21e-02	5.91e-04	NA	NA
5. P	C4YPB0	Genetic interactor of prohibitins 3, mitochondrial	2.19e-01	3.69e-02	NA	NA
5. P	Q1JGD5	GTPase Obg	2.03e-02	1.24e-03	NA	NA
5. P	B8CXZ0	GTPase Obg	3.71e-02	2.77e-04	NA	NA
5. P	Q1AVU3	GTPase Obg	1.24e-02	1.32e-03	NA	NA
5. P	B1ILY5	GTPase Obg	4.69e-03	3.39e-02	NA	NA
5. P	B0TBW1	GTPase Obg	3.02e-02	1.63e-02	NA	NA
5. P	B1LA53	GTPase Obg	1.75e-02	1.52e-03	NA	NA
5. P	A7GHK2	GTPase Obg	1.18e-02	2.48e-02	NA	NA
5. P	Q98QK8	GTPase Obg	2.86e-02	2.13e-02	NA	NA
5. P	Q8RHS8	GTPase Obg	8.46e-03	1.93e-02	NA	NA
5. P	A4D1E9	GTP-binding protein 10	4.10e-02	4.95e-02	NA	NA
5. P	Q7NB30	GTPase Obg	2.87e-02	1.75e-03	NA	NA
5. P	Q9CF94	GTPase Obg	1.96e-02	7.63e-03	NA	NA
5. P	Q03JJ8	GTPase Obg	2.05e-02	1.65e-03	NA	NA
5. P	Q5HFB9	GTPase Obg	3.83e-02	8.04e-03	NA	NA
5. P	B9E021	GTPase Obg	1.12e-02	5.26e-03	NA	NA
5. P	Q1IW72	GTPase Obg	3.64e-02	1.90e-03	NA	NA
5. P	Q892N8	GTPase Obg	8.42e-03	6.37e-04	NA	NA
5. P	Q81LF0	GTPase Obg	1.69e-02	1.50e-02	NA	NA
5. P	Q2NIK0	GTPase Obg	3.50e-02	2.88e-04	NA	NA
5. P	P42942	Uncharacterized GTP-binding protein YGR210C	4.37e-02	1.52e-03	NA	NA
5. P	Q8K9V2	Ribosome-binding ATPase YchF	1.25e-02	5.99e-03	NA	NA
5. P	B9DNE7	GTPase Obg	1.67e-02	2.55e-03	NA	NA
5. P	Q03QP2	GTPase Obg	3.02e-02	2.11e-04	NA	NA
5. P	A5I666	GTPase Obg	1.30e-02	3.13e-02	NA	NA
5. P	Q83NP1	GTPase Obg	1.27e-02	9.71e-03	NA	NA
5. P	Q8P0I6	GTPase Obg	1.40e-02	2.60e-03	NA	NA
5. P	Q834V4	GTPase Obg	2.97e-02	2.42e-03	NA	NA
5. P	Q1JBB7	GTPase Obg	1.87e-02	1.63e-03	NA	NA
5. P	B8E0B2	GTPase Obg	2.29e-02	2.50e-02	NA	NA
5. P	A6U2B2	GTPase Obg	4.61e-02	1.05e-02	NA	NA
5. P	B3WE52	GTPase Obg	1.69e-02	2.62e-03	NA	NA
5. P	B7HQJ8	GTPase Obg	1.70e-02	2.74e-02	NA	NA
5. P	A8F478	GTPase Obg	2.46e-02	8.06e-05	NA	NA
5. P	Q5LYR4	GTPase Obg	2.01e-02	1.65e-03	NA	NA
5. P	A7NRU6	GTPase Obg	2.18e-02	9.03e-04	NA	NA
5. P	A8YV14	GTPase Obg	2.38e-02	2.62e-03	NA	NA
5. P	P44681	Ribosome-binding ATPase YchF	3.47e-02	4.20e-02	NA	NA
5. P	Q4L6Y9	GTPase Obg	2.51e-02	4.08e-03	NA	NA
5. P	Q9WXV3	GTPase Obg	1.35e-02	2.04e-03	NA	NA
5. P	E0RQS7	GTPase HflX	8.10e-04	4.94e-05	NA	NA
5. P	Q5FKH5	GTPase Obg	2.41e-02	2.51e-03	NA	NA
5. P	Q6KHM2	GTPase Obg	1.45e-02	3.11e-04	NA	NA
5. P	Q3MHG6	GTP-binding protein 10	1.48e-02	2.28e-02	NA	NA
5. P	Q03F34	GTPase Obg	1.57e-02	2.04e-03	NA	NA
5. P	C0MDB4	GTPase Obg	1.53e-02	2.38e-03	NA	NA
6. F	Q8F9P7	Probable GTP-binding protein EngB	3.86e-05	NA	NA	0.6375
6. F	Q1GJX8	Probable GTP-binding protein EngB	2.59e-05	NA	NA	0.6355
6. F	Q31UD0	Probable GTP-binding protein EngB	4.12e-07	NA	NA	0.6212
6. F	C5A033	Probable GTP-binding protein EngB	4.50e-07	NA	NA	0.6374
6. F	Q04W49	Probable GTP-binding protein EngB	1.41e-07	NA	NA	0.5646
6. F	B4SZ98	Probable GTP-binding protein EngB	5.36e-07	NA	NA	0.6418
6. F	A7ZU66	Probable GTP-binding protein EngB	5.75e-07	NA	NA	0.6236
6. F	Q64UN4	Probable GTP-binding protein EngB	1.21e-07	NA	NA	0.6479
6. F	Q7MX68	Probable GTP-binding protein EngB	8.92e-08	NA	NA	0.634
6. F	B2FTY5	Probable GTP-binding protein EngB	2.15e-06	NA	NA	0.6026
6. F	Q8A8T4	Probable GTP-binding protein EngB	8.87e-08	NA	NA	0.656
6. F	Q0TAJ6	Probable GTP-binding protein EngB	4.41e-07	NA	NA	0.6371
6. F	Q3IYY4	Probable GTP-binding protein EngB	1.62e-05	NA	NA	0.615
6. F	A4YCD0	Probable GTP-binding protein EngB	2.31e-04	NA	NA	0.5689
6. F	B2RL89	Probable GTP-binding protein EngB	8.65e-08	NA	NA	0.6506
6. F	Q5LDL2	Probable GTP-binding protein EngB	7.93e-08	NA	NA	0.6543
6. F	B1LMP7	Probable GTP-binding protein EngB	6.05e-07	NA	NA	0.6366
6. F	Q5LW13	Probable GTP-binding protein EngB	2.72e-05	NA	NA	0.6367
6. F	A6LBY4	Probable GTP-binding protein EngB	1.57e-07	NA	NA	0.6404
6. F	Q28UR1	Probable GTP-binding protein EngB	1.65e-05	NA	NA	0.662
6. F	A0M537	Probable GTP-binding protein EngB	3.01e-07	NA	NA	0.6517
6. F	Q604E1	Probable GTP-binding protein EngB	2.47e-06	NA	NA	0.6104
6. F	B7UNI7	Probable GTP-binding protein EngB	5.68e-07	NA	NA	0.6373
7. B	A7H4G2	Probable GTP-binding protein EngB	1.95e-06	NA	0.018	NA
7. B	Q8Z4K5	GTPase Era	2.60e-07	NA	1.09e-13	NA
7. B	Q5M5A9	Probable GTP-binding protein EngB	2.40e-07	NA	6.79e-05	NA
7. B	Q5FPX9	Probable GTP-binding protein EngB	1.40e-05	NA	0.035	NA
7. B	A9IXE1	Probable GTP-binding protein EngB	4.91e-05	NA	0.002	NA
7. B	Q72SI0	Fe(2+) transporter FeoB	1.09e-02	NA	0.033	NA
7. B	Q7MV19	Fe(2+) transport protein A/Fe(2+) transporter FeoB fusion protein	3.14e-02	NA	0.001	NA
7. B	Q482Z9	Sulfate adenylyltransferase subunit 1	1.84e-04	NA	0.005	NA
7. B	C1D5Q6	Probable GTP-binding protein EngB	4.13e-05	NA	5.22e-04	NA
7. B	B0KV26	GTPase Era	1.53e-07	NA	3.59e-07	NA
7. B	A8GM60	Probable GTP-binding protein EngB	2.21e-05	NA	0.002	NA
7. B	Q8TYT5	Probable GTP-binding protein EngB	9.31e-05	NA	0.024	NA
7. B	Q82C85	GTPase Obg	3.36e-02	NA	0.019	NA
7. B	Q48U21	Probable GTP-binding protein EngB	3.38e-07	NA	0.001	NA
7. B	B7MYJ7	GTPase Era	3.73e-07	NA	1.45e-13	NA
7. B	Q54HP3	Developmentally-regulated GTP-binding protein 1 homolog	2.26e-02	NA	0.001	NA
7. B	A0KP35	Sulfate adenylyltransferase subunit 1	1.36e-03	NA	0.020	NA
7. B	C5D8U8	Ribosome biogenesis GTPase A	5.85e-03	NA	9.84e-05	NA
7. B	Q9PQM5	Probable GTP-binding protein EngB	2.47e-05	NA	2.30e-04	NA
7. B	Q1LI69	Probable GTP-binding protein EngB	2.08e-06	NA	0.003	NA
7. B	O25396	Fe(2+) transporter FeoB	3.86e-03	NA	1.06e-06	NA
7. B	B9KGA1	GTPase Era	9.94e-07	NA	1.09e-07	NA
7. B	Q2KWX8	GTPase Era	4.29e-07	NA	8.64e-09	NA
7. B	Q5WEP2	Probable GTP-binding protein EngB	1.68e-07	NA	0.016	NA
7. B	C6DJE1	Probable GTP-binding protein EngB	4.91e-07	NA	0.010	NA
7. B	A0AJ07	Probable GTP-binding protein EngB	2.24e-07	NA	6.74e-04	NA
7. B	A4TKX7	GTPase Era	4.48e-07	NA	1.64e-14	NA
7. B	B3QS35	Probable GTP-binding protein EngB	6.67e-07	NA	3.10e-04	NA
7. B	Q9BT17	Mitochondrial ribosome-associated GTPase 1	2.15e-02	NA	0.034	NA
7. B	B2G6R5	Probable GTP-binding protein EngB	2.20e-07	NA	4.19e-05	NA
7. B	Q4A5B4	Probable GTP-binding protein EngB	3.82e-07	NA	1.43e-04	NA
7. B	B8F3C8	GTPase Era	1.53e-07	NA	3.44e-14	NA
7. B	Q8FCT7	Fe(2+) transporter FeoB	1.05e-02	NA	2.56e-04	NA
7. B	Q1I5V9	GTPase Era	1.89e-07	NA	3.82e-07	NA
7. B	O31743	Ribosome biogenesis GTPase A	5.60e-03	NA	2.54e-04	NA
7. B	Q0TQK6	Probable GTP-binding protein EngB	2.10e-07	NA	5.20e-08	NA
7. B	B6J4J8	GTPase Era	2.14e-07	NA	9.90e-10	NA
7. B	A5W8F1	GTPase Era	1.72e-07	NA	4.04e-07	NA
7. B	Q47AD0	GTPase Obg	9.24e-03	NA	0.004	NA
7. B	Q04Q90	GTPase Obg	2.78e-02	NA	0.006	NA
7. B	A5N2K5	Probable GTP-binding protein EngB	1.39e-07	NA	6.33e-05	NA
7. B	A3MZR0	GTPase Era	1.48e-07	NA	5.37e-14	NA
7. B	Q8XED4	Fe(2+) transporter FeoB	1.04e-02	NA	2.72e-04	NA
7. B	C1F9K2	GTPase Obg	3.10e-02	NA	0.016	NA
7. B	Q8EW66	GTPase Era	3.51e-05	NA	5.04e-11	NA
7. B	A4WDD7	GTPase Era	3.49e-07	NA	9.56e-13	NA
7. B	B5FRC4	GTPase Era	3.03e-07	NA	1.71e-13	NA
7. B	A4XKV8	GTPase Era	2.37e-07	NA	1.45e-09	NA
7. B	B2KAW2	GTPase Obg	2.69e-02	NA	0.002	NA
7. B	O05132	Probable GTP-binding protein EngB	5.04e-07	NA	3.16e-04	NA
7. B	Q30ZZ9	Probable GTP-binding protein EngB	4.12e-07	NA	5.96e-04	NA
7. B	B7MIQ1	GTPase Era	1.41e-07	NA	1.45e-13	NA
7. B	B2TXX9	GTPase Era	2.46e-07	NA	1.45e-13	NA
7. B	Q9PB97	GTPase Era	2.57e-07	NA	2.98e-12	NA
7. B	P57947	Probable GTP-binding protein EngB	4.04e-07	NA	0.050	NA
7. B	Q1RH06	Probable GTP-binding protein EngB	8.48e-06	NA	1.82e-05	NA
7. B	B0U3D9	GTPase Era	2.85e-07	NA	6.26e-12	NA
7. B	Q9C923	Nuclear/nucleolar GTPase 2	6.04e-02	NA	0.002	NA
7. B	A9IIJ3	GTPase Era	6.12e-07	NA	8.88e-09	NA
7. B	Q1CKE3	GTPase Era	3.12e-07	NA	1.64e-14	NA
7. B	Q7W5J7	GTPase Era	5.45e-07	NA	9.71e-10	NA
7. B	Q1J740	Probable GTP-binding protein EngB	2.83e-07	NA	0.001	NA
7. B	Q5P7M2	Probable GTP-binding protein EngB	4.74e-05	NA	0.011	NA
7. B	Q2GGS7	GTPase Obg	1.45e-02	NA	1.16e-04	NA
7. B	Q5H1R1	GTPase Era	2.77e-07	NA	3.58e-09	NA
7. B	B2JI34	Probable GTP-binding protein EngB	1.39e-06	NA	0.005	NA
7. B	Q75DA4	Nucleolar GTP-binding protein 2	7.83e-02	NA	0.012	NA
7. B	Q976A1	Probable translation initiation factor IF-2	1.10e-03	NA	0.018	NA
7. B	B7V729	Probable GTP-binding protein EngB	6.83e-05	NA	0.003	NA
7. B	Q02HS3	GTPase Era	1.77e-07	NA	2.72e-09	NA
7. B	Q39KD6	Probable GTP-binding protein EngB	1.06e-04	NA	6.24e-04	NA
7. B	A8FL71	Probable GTP-binding protein EngB	1.67e-06	NA	0.009	NA
7. B	Q8Y6X3	Probable GTP-binding protein EngB	2.58e-07	NA	0.002	NA
7. B	A5D451	Probable GTP-binding protein EngB	4.28e-07	NA	0.001	NA
7. B	B2UX10	Probable GTP-binding protein EngB	2.35e-07	NA	1.24e-08	NA
7. B	C1DH55	Probable GTP-binding protein EngB	5.56e-04	NA	0.004	NA
7. B	Q09523	Uncharacterized GTP-binding protein E02H1.2	1.55e-03	NA	1.01e-05	NA
7. B	A4W2D1	Peptide chain release factor 3	9.33e-03	NA	0.035	NA
7. B	Q3K0K1	Probable GTP-binding protein EngB	2.47e-07	NA	4.37e-04	NA
7. B	B0BUA7	GTPase Era	1.46e-07	NA	6.23e-14	NA
7. B	Q55G45	Probable mitochondrial Rho GTPase gemA	2.97e-02	NA	0.005	NA
7. B	Q03F28	Probable GTP-binding protein EngB	2.21e-07	NA	0.001	NA
7. B	Q89AM7	GTPase Era	1.79e-07	NA	9.34e-09	NA
7. B	Q6MEP0	Probable GTP-binding protein EngB	7.22e-08	NA	0.013	NA
7. B	A1AW67	GTPase Obg	1.02e-02	NA	0.007	NA
7. B	Q54WT4	Developmentally-regulated GTP-binding protein 2 homolog	2.82e-02	NA	1.11e-05	NA
7. B	B3CL86	Probable GTP-binding protein EngB	3.49e-07	NA	0.044	NA
7. B	A3P082	Probable GTP-binding protein EngB	6.86e-05	NA	0.001	NA
7. B	C0MA50	Probable GTP-binding protein EngB	3.70e-07	NA	0.013	NA
7. B	A8ETG7	Probable GTP-binding protein EngB	8.61e-06	NA	0.006	NA
7. B	Q8DE73	Sulfate adenylyltransferase subunit 1	1.16e-03	NA	1.38e-04	NA
7. B	B8J030	Probable GTP-binding protein EngB	7.07e-07	NA	0.002	NA
7. B	Q0K651	Probable GTP-binding protein EngB	3.96e-05	NA	0.002	NA
7. B	A9NFM5	Probable GTP-binding protein EngB	8.90e-07	NA	1.58e-04	NA
7. B	A7ZQ10	GTPase Era	1.73e-07	NA	1.45e-13	NA
7. B	P74884	Fe(2+) transporter FeoB	1.12e-02	NA	2.96e-04	NA
7. B	P38860	GTPase MTG2, mitochondrial	1.80e-02	NA	0.015	NA
7. B	Q1JC92	Probable GTP-binding protein EngB	4.51e-07	NA	0.006	NA
7. B	Q4UNC2	Probable GTP-binding protein EngB	3.70e-05	NA	1.15e-04	NA
7. B	C5CEL1	Probable GTP-binding protein EngB	7.39e-07	NA	1.94e-05	NA
7. B	K7UTH7	GTPase ERA1, chloroplastic	6.11e-06	NA	3.06e-10	NA
7. B	B7IDZ1	Probable GTP-binding protein EngB	7.66e-07	NA	0.027	NA
7. B	P0CS94	Nucleolar GTP-binding protein 2	6.77e-02	NA	0.006	NA
7. B	Q9X1H7	Probable GTP-binding protein EngB	3.11e-07	NA	5.06e-09	NA
7. B	B2UTX1	GTPase Era	1.44e-06	NA	7.14e-09	NA
7. B	A9N1T2	GTPase Era	3.51e-07	NA	1.73e-13	NA
7. B	A7HIF8	GTPase Obg	6.16e-02	NA	0.007	NA
7. B	Q0BIH8	GTPase Obg	2.66e-02	NA	0.032	NA
7. B	Q2Y797	Probable GTP-binding protein EngB	8.72e-05	NA	2.25e-04	NA
7. B	B2FPX8	GTPase Era	3.83e-07	NA	8.22e-13	NA
7. B	Q2FY06	GTPase Era	1.12e-07	NA	6.30e-14	NA
7. B	Q819W8	Ribosome biogenesis GTPase A	5.46e-03	NA	8.58e-05	NA
7. B	Q30SS6	Translation initiation factor IF-2	1.70e-02	NA	3.28e-05	NA
7. B	Q4KHT0	GTPase Era	1.62e-07	NA	9.49e-09	NA
7. B	B3R7D7	Probable GTP-binding protein EngB	1.15e-04	NA	0.001	NA
7. B	Q3B6D1	Probable GTP-binding protein EngB	3.23e-07	NA	0.049	NA
7. B	Q5HNN0	Probable GTP-binding protein EngB	2.44e-07	NA	0.037	NA
7. B	Q633X5	Probable GTP-binding protein EngB	3.33e-07	NA	2.00e-04	NA
7. B	B0S6U7	GTPase Era, mitochondrial	5.80e-04	NA	0.004	NA
7. B	Q5FKR5	Probable GTP-binding protein EngB	1.86e-07	NA	1.02e-04	NA
7. B	Q3MHP5	Developmentally-regulated GTP-binding protein 1	2.50e-02	NA	0.023	NA
7. B	Q1GSF4	GTPase Obg	1.60e-02	NA	0.018	NA
7. B	A5UFI7	GTPase Era	1.78e-07	NA	8.24e-15	NA
7. B	B8EDT1	Probable GTP-binding protein EngB	2.05e-04	NA	0.040	NA
7. B	B4UIU2	GTPase Obg	6.95e-02	NA	0.002	NA
7. B	B9LZU0	Probable GTP-binding protein EngB	4.24e-07	NA	0.005	NA
7. B	A5VWQ6	Probable GTP-binding protein EngB	4.80e-04	NA	0.001	NA
7. B	Q9A088	Probable GTP-binding protein EngB	2.83e-07	NA	0.004	NA
7. B	B7HQM9	Probable GTP-binding protein EngB	3.35e-07	NA	2.00e-04	NA
7. B	B7JVH9	GTPase Obg	3.89e-02	NA	0.015	NA
7. B	Q57LD1	GTPase Era	3.11e-07	NA	1.71e-13	NA
7. B	Q3YYV0	GTPase Era	2.52e-07	NA	1.45e-13	NA
7. B	A3QJD3	Probable GTP-binding protein EngB	6.78e-05	NA	0.018	NA
7. B	B1LBK5	Probable GTP-binding protein EngB	3.31e-07	NA	6.05e-09	NA
7. B	Q5RA07	Guanine nucleotide-binding protein-like 1	8.35e-02	NA	0.023	NA
7. B	C3P9F4	Probable GTP-binding protein EngB	2.85e-07	NA	2.00e-04	NA
7. B	Q5GSS9	Probable GTP-binding protein EngB	3.07e-07	NA	0.025	NA
7. B	Q7MHN9	GTPase Era	5.04e-06	NA	3.50e-14	NA
7. B	B1JU53	Probable GTP-binding protein EngB	9.23e-05	NA	5.09e-04	NA
7. B	P47577	Probable GTP-binding protein EngB	3.00e-07	NA	6.34e-04	NA
7. B	A1VHK4	GTPase Era	6.48e-07	NA	2.21e-09	NA
7. B	Q9C6I8	Nucleolar GTP-binding protein 1	7.64e-02	NA	8.77e-04	NA
7. B	A5IAS7	GTPase Obg	1.61e-02	NA	0.002	NA
7. B	Q8XV43	Probable GTP-binding protein EngB	1.94e-06	NA	0.002	NA
7. B	A2RF16	Probable GTP-binding protein EngB	3.56e-07	NA	0.001	NA
7. B	C1CLR7	Probable GTP-binding protein EngB	2.76e-07	NA	6.03e-04	NA
7. B	C1CSI8	Probable GTP-binding protein EngB	2.79e-07	NA	2.71e-04	NA
7. B	B2UEI8	Probable GTP-binding protein EngB	1.41e-04	NA	8.13e-04	NA
7. B	A7GTE8	Probable GTP-binding protein EngB	2.87e-07	NA	0.003	NA
7. B	B2TPB6	Probable GTP-binding protein EngB	2.17e-07	NA	5.85e-08	NA
7. B	Q58859	Uncharacterized GTP-binding protein MJ1464	6.59e-03	NA	0.010	NA
7. B	Q04H41	Probable GTP-binding protein EngB	2.04e-07	NA	1.24e-04	NA
7. B	B8I8N7	Probable GTP-binding protein EngB	1.60e-07	NA	0.017	NA
7. B	Q72G11	GTPase Era	8.39e-07	NA	2.21e-09	NA
7. B	Q5KWK2	Probable GTP-binding protein EngB	3.79e-07	NA	0.004	NA
7. B	A1AE96	GTPase Era	1.53e-07	NA	1.45e-13	NA
7. B	Q2NCX8	GTPase Obg	1.81e-04	NA	0.024	NA
7. B	C5D5L1	Probable GTP-binding protein EngB	3.37e-07	NA	0.015	NA
7. B	Q3IJG3	Probable GTP-binding protein EngB	1.06e-04	NA	0.018	NA
7. B	Q9FNM5	Translation factor GUF1 homolog, chloroplastic	1.11e-02	NA	0.031	NA
7. B	Q6HD57	Probable GTP-binding protein EngB	3.15e-07	NA	2.00e-04	NA
7. B	Q7W2C4	Probable GTP-binding protein EngB	3.50e-07	NA	1.08e-05	NA
7. B	Q8P5E4	Probable GTP-binding protein EngB	2.11e-06	NA	6.68e-04	NA
7. B	Q6MTQ0	Translation initiation factor IF-2	1.62e-03	NA	0.002	NA
7. B	A7MWE9	Sulfate adenylyltransferase subunit 1	2.00e-04	NA	0.017	NA
7. B	Q0T1T9	GTPase Era	1.16e-07	NA	7.07e-14	NA
7. B	B5E6L1	Probable GTP-binding protein EngB	3.15e-07	NA	6.03e-04	NA
7. B	Q8EPM2	Probable GTP-binding protein EngB	3.43e-07	NA	3.45e-04	NA
7. B	Q0TES2	GTPase Era	2.86e-07	NA	1.45e-13	NA
7. B	Q1JHC1	Probable GTP-binding protein EngB	3.24e-07	NA	0.006	NA
7. B	Q7VTA1	Probable GTP-binding protein EngB	2.65e-07	NA	1.08e-05	NA
7. B	A5IMB8	Probable GTP-binding protein EngB	3.28e-07	NA	3.15e-08	NA
7. B	B1J4E1	GTPase Era	1.71e-07	NA	1.67e-06	NA
7. B	P57469	GTPase Obg	2.25e-02	NA	0.035	NA
7. B	Q9UT21	Uncharacterized GTP-binding protein C9.07c	2.73e-02	NA	0.006	NA
7. B	Q17XF9	GTPase Era	1.19e-06	NA	2.18e-09	NA
7. B	B3EP28	Probable GTP-binding protein EngB	4.72e-07	NA	0.006	NA
7. B	A2BLW4	GTPase HflX	1.33e-04	NA	9.90e-05	NA
7. B	Q7WD33	GTPase Era	3.83e-07	NA	9.71e-10	NA
7. B	Q9PHL7	Probable GTP-binding protein EngB	4.14e-06	NA	0.032	NA
7. B	Q1G9W6	GTPase Era	2.97e-07	NA	5.69e-13	NA
7. B	A7FFU0	GTPase Era	2.88e-07	NA	1.64e-14	NA
7. B	B7M8H9	GTPase Era	1.56e-07	NA	1.45e-13	NA
7. B	O82626	GTP-binding protein ERG	3.73e-02	NA	2.31e-04	NA
7. B	C0R5M1	Probable GTP-binding protein EngB	2.52e-07	NA	0.031	NA
7. B	A1U2V4	GTPase Era	2.06e-07	NA	3.74e-08	NA
7. B	A4SCU1	Probable GTP-binding protein EngB	5.21e-07	NA	0.014	NA
7. B	C1CFF1	Probable GTP-binding protein EngB	2.75e-07	NA	4.35e-04	NA
7. B	Q03W10	Probable GTP-binding protein EngB	2.34e-07	NA	0.011	NA
7. B	Q5PQQ1	tRNA modification GTPase GTPBP3, mitochondrial	4.14e-03	NA	1.65e-05	NA
7. B	Q8CS80	Probable GTP-binding protein EngB	2.90e-07	NA	0.037	NA
7. B	Q82S94	Probable GTP-binding protein EngB	9.00e-05	NA	0.001	NA
7. B	A8FPD5	Probable GTP-binding protein EngB	1.91e-04	NA	0.006	NA
7. B	Q2SSN1	Probable GTP-binding protein EngB	1.60e-07	NA	3.53e-11	NA
7. B	B1JFJ3	Probable GTP-binding protein EngB	3.35e-04	NA	0.002	NA
7. B	Q83QI5	GTPase Era	2.41e-07	NA	6.87e-14	NA
7. B	Q4ZYY9	Small ribosomal subunit biogenesis GTPase RsgA	5.32e-02	NA	0.005	NA
7. B	A4XNL3	Probable GTP-binding protein EngB	5.70e-04	NA	0.037	NA
7. B	Q1C554	GTPase Era	3.15e-07	NA	1.64e-14	NA
7. B	Q1IGY1	Probable GTP-binding protein EngB	3.28e-04	NA	5.02e-04	NA
7. B	C3L700	Probable GTP-binding protein EngB	3.26e-07	NA	2.00e-04	NA
7. B	B8D9H2	GTPase Obg	2.86e-02	NA	0.035	NA
7. B	Q89BP9	Probable GTP-binding protein EngB	1.72e-05	NA	0.004	NA
7. B	Q58330	Uncharacterized protein MJ0920	2.18e-08	NA	3.57e-07	NA
7. B	Q8RHK1	Probable GTP-binding protein EngB	3.30e-07	NA	0.002	NA
7. B	B3E2D1	Probable GTP-binding protein EngB	1.20e-07	NA	0.004	NA
7. B	A1VZ10	Probable GTP-binding protein EngB	1.89e-06	NA	0.010	NA
7. B	B1AIQ5	Probable GTP-binding protein EngB	2.41e-05	NA	2.30e-04	NA
7. B	O81004	GTP-binding protein At2g22870	8.27e-04	NA	4.04e-07	NA
7. B	A9N941	GTPase Era	2.74e-07	NA	4.93e-10	NA
7. B	D5DJL5	Ribosome biogenesis GTPase A	5.56e-03	NA	2.52e-04	NA
7. B	B3EGV8	Probable GTP-binding protein EngB	4.11e-07	NA	0.009	NA
7. B	P0DA92	Probable GTP-binding protein EngB	3.08e-07	NA	0.003	NA
7. B	B0RX26	GTPase Era	2.79e-07	NA	5.07e-09	NA
7. B	Q6B8S2	Translation initiation factor IF-2, chloroplastic	2.91e-03	NA	0.002	NA
7. B	Q3SMA6	Probable GTP-binding protein EngB	1.25e-04	NA	0.004	NA
7. B	Q87XG2	GTPase Era	1.74e-07	NA	1.08e-10	NA
7. B	Q9CAI1	Developmentally-regulated G-protein 2	6.36e-02	NA	3.02e-04	NA
7. B	Q9L6G1	Probable GTP-binding protein EngB	3.50e-07	NA	1.22e-04	NA
7. B	Q68XW9	Probable GTP-binding protein EngB	1.18e-05	NA	0.035	NA
7. B	Q833M8	Probable GTP-binding protein EngB	3.05e-07	NA	2.80e-04	NA
7. B	Q9PHL1	GTPase Era	7.90e-07	NA	2.68e-07	NA
7. B	Q8DZ11	Probable GTP-binding protein EngB	2.93e-07	NA	4.37e-04	NA
7. B	Q6DB76	Probable GTP-binding protein EngB	4.11e-07	NA	0.011	NA
7. B	Q9Y295	Developmentally-regulated GTP-binding protein 1	2.52e-02	NA	0.023	NA
7. B	B5Z140	GTPase Era	2.61e-07	NA	6.32e-14	NA
7. B	Q0ST57	Probable GTP-binding protein EngB	2.27e-07	NA	6.11e-08	NA
7. B	O74791	GTPase grn1	3.64e-02	NA	0.043	NA
7. B	Q8GNS3	Fe(2+) transporter FeoB	7.98e-02	NA	0.020	NA
7. B	Q5XCL9	Probable GTP-binding protein EngB	2.82e-07	NA	0.001	NA
7. B	B1JVA1	GTPase Obg	2.80e-02	NA	0.020	NA
7. B	Q8K9C9	Probable GTP-binding protein EngB	4.12e-07	NA	0.023	NA
7. B	Q3SWP9	Translation initiation factor IF-2	1.81e-02	NA	0.009	NA
7. B	Q0C548	Probable GTP-binding protein EngB	1.77e-05	NA	0.034	NA
7. B	B8ZLT0	Probable GTP-binding protein EngB	2.76e-07	NA	2.71e-04	NA
7. B	Q9CGE5	Probable GTP-binding protein EngB	3.65e-07	NA	1.34e-04	NA
7. B	P95722	GTPase Obg	3.15e-02	NA	0.012	NA
7. B	A9ADM4	Probable GTP-binding protein EngB	9.29e-07	NA	0.002	NA
7. B	Q817Q5	Probable GTP-binding protein EngB	3.08e-07	NA	1.61e-04	NA
7. B	Q21086	Guanine nucleotide-binding protein-like 3 homolog	4.26e-02	NA	1.76e-05	NA
7. B	A8GQS1	Probable GTP-binding protein EngB	3.09e-05	NA	5.76e-04	NA
7. B	A8FD69	Ribosome biogenesis GTPase A	6.42e-03	NA	0.001	NA
7. B	P32234	GTP-binding protein 128up	2.53e-02	NA	0.004	NA
7. B	B8DHJ0	Probable GTP-binding protein EngB	2.13e-07	NA	0.001	NA
7. B	Q8ZD71	GTPase Era	4.33e-07	NA	1.64e-14	NA
7. B	Q0BJ15	Probable GTP-binding protein EngB	4.45e-05	NA	5.53e-04	NA
7. B	Q12I30	Probable GTP-binding protein EngB	2.76e-04	NA	0.010	NA
7. B	Q83PW3	Fe(2+) transporter FeoB	4.72e-02	NA	2.54e-04	NA
7. B	Q1JM76	Probable GTP-binding protein EngB	2.97e-07	NA	0.006	NA
7. B	A1VZ20	GTPase Era	6.05e-07	NA	3.46e-08	NA
7. B	Q1WUI3	Probable GTP-binding protein EngB	2.62e-07	NA	0.005	NA
7. B	Q73IC3	Probable GTP-binding protein EngB	2.36e-07	NA	0.035	NA
7. B	Q2NIQ6	Translation initiation factor IF-2	1.58e-03	NA	8.34e-04	NA
7. B	Q57986	Fe(2+) transporter FeoB	1.86e-02	NA	3.18e-05	NA
7. B	Q04A20	GTPase Era	2.89e-07	NA	5.69e-13	NA
7. B	B5F1G0	GTPase Era	1.66e-07	NA	1.71e-13	NA
7. B	Q8XVL0	GTPase Obg	3.18e-02	NA	0.032	NA
7. B	Q5X1N2	Fe(2+) transporter FeoB	8.41e-02	NA	0.019	NA
7. B	Q92JC9	Probable GTP-binding protein EngB	2.55e-05	NA	6.68e-04	NA
7. B	Q2IH84	GTPase Obg	6.12e-02	NA	0.002	NA
7. B	B8D7S4	GTPase Obg	2.33e-02	NA	0.035	NA
7. B	B7LUZ8	GTPase Era	3.48e-07	NA	1.48e-13	NA
7. B	B4SC74	Probable GTP-binding protein EngB	3.15e-07	NA	0.024	NA
7. B	P33650	Fe(2+) transporter FeoB	1.06e-02	NA	2.54e-04	NA
7. B	Q58803	Uncharacterized protein MJ1408	2.27e-03	NA	0.012	NA
7. B	A5F578	Sulfate adenylyltransferase subunit 1	1.85e-04	NA	1.17e-04	NA
7. B	Q7NAR6	Probable GTP-binding protein EngB	5.73e-07	NA	0.036	NA
7. B	B9K8C0	Probable GTP-binding protein EngB	2.22e-07	NA	2.91e-06	NA
7. B	Q8E8J7	Probable GTP-binding protein EngB	2.25e-04	NA	0.013	NA
7. B	P0DA93	Probable GTP-binding protein EngB	2.80e-07	NA	0.003	NA
7. B	B2KB94	GTPase Era	1.07e-06	NA	2.96e-08	NA
7. B	P36916	Guanine nucleotide-binding protein-like 1	7.05e-02	NA	0.005	NA
7. B	O82653	GTP-binding protein ERG	2.97e-04	NA	3.00e-05	NA
7. B	Q46WH5	Probable GTP-binding protein EngB	8.17e-05	NA	2.32e-05	NA
7. B	B0KG04	Probable GTP-binding protein EngB	3.11e-04	NA	0.001	NA
7. B	A4JAS1	Probable GTP-binding protein EngB	8.16e-07	NA	5.48e-04	NA
7. B	B5E488	GTPase Era	NA	NA	8.49e-12	NA
7. B	Q6KID8	Translation initiation factor IF-2	2.15e-03	NA	0.004	NA
7. B	Q7VW40	GTPase Era	3.31e-07	NA	9.71e-10	NA
7. B	A1KSV0	GTPase Era	5.70e-07	NA	1.33e-09	NA
7. B	B3QQY9	Probable GTP-binding protein EngB	2.88e-07	NA	6.02e-05	NA
7. B	B3ES13	Probable GTP-binding protein EngB	1.15e-07	NA	0.049	NA
7. B	Q8F332	Fe(2+) transporter FeoB	1.06e-02	NA	0.030	NA
7. B	B6IZ00	GTPase Era	2.45e-07	NA	3.12e-10	NA
7. B	B7HEA1	Probable GTP-binding protein EngB	3.06e-07	NA	1.61e-04	NA
7. B	B5QTU7	GTPase Era	3.64e-07	NA	1.71e-13	NA
7. B	Q0HD98	Probable GTP-binding protein EngB	1.52e-04	NA	0.031	NA
7. B	Q2SSE6	Translation initiation factor IF-2	1.77e-03	NA	0.008	NA
7. B	P75210	GTPase Era	2.19e-05	NA	1.48e-05	NA
7. B	P36915	Guanine nucleotide-binding protein-like 1	6.35e-02	NA	0.012	NA
7. B	Q5TM59	Guanine nucleotide-binding protein-like 1	8.97e-02	NA	0.023	NA
7. B	Q9JY03	Probable GTP-binding protein EngB	4.91e-07	NA	0.002	NA
7. B	Q5E8S6	Probable GTP-binding protein EngB	3.26e-07	NA	0.013	NA
7. B	B9MS56	GTPase Era	2.03e-07	NA	1.75e-11	NA
7. B	Q58722	Uncharacterized GTP-binding protein MJ1326	4.67e-02	NA	0.002	NA
7. B	A5IXT1	Probable GTP-binding protein EngB	3.99e-07	NA	3.17e-04	NA
7. B	B8J3P9	GTPase Era	7.47e-07	NA	1.66e-11	NA
7. B	B0USS2	GTPase Era	1.30e-07	NA	8.85e-16	NA
7. B	Q8FF17	GTPase Era	1.37e-07	NA	1.45e-13	NA
7. B	B5X2B8	GTPase Era, mitochondrial	1.04e-03	NA	4.58e-04	NA
7. B	Q3KHL8	GTPase Era	1.80e-07	NA	8.04e-08	NA
7. B	Q58735	Uncharacterized protein MJ1339	1.26e-07	NA	1.77e-05	NA
7. B	B7GGD6	Ribosome biogenesis GTPase A	7.01e-03	NA	0.001	NA
7. B	Q9K0C7	GTPase Era	7.97e-07	NA	8.74e-10	NA
7. B	A7ZDF6	GTPase Era	1.23e-06	NA	2.42e-07	NA
7. B	Q10190	Large subunit GTPase 1	2.91e-02	NA	0.016	NA
7. B	Q54KS4	Guanine nucleotide-binding protein-like 3 homolog	7.20e-02	NA	0.007	NA
7. B	Q31XS1	GTPase Era	1.39e-07	NA	1.45e-13	NA
7. B	A7MH00	GTPase Era	3.26e-07	NA	1.67e-13	NA
7. B	B8CY70	Probable GTP-binding protein EngB	2.00e-07	NA	1.33e-04	NA
7. B	Q87TG0	Probable GTP-binding protein EngB	4.55e-05	NA	0.046	NA
7. B	A8A376	GTPase Era	1.37e-07	NA	7.34e-14	NA
7. B	B2IYX1	GTPase Obg	3.99e-02	NA	0.001	NA
7. B	C4Z1T3	Probable GTP-binding protein EngB	2.37e-07	NA	0.002	NA
7. B	Q6AJW0	Probable GTP-binding protein EngB	4.49e-07	NA	0.026	NA
7. B	B2SNS8	Probable GTP-binding protein EngB	1.56e-04	NA	7.33e-04	NA
7. B	Q92BF6	Probable GTP-binding protein EngB	1.86e-07	NA	0.001	NA
7. B	B2I605	GTPase Era	2.58e-07	NA	4.13e-12	NA
7. B	B5XL04	Probable GTP-binding protein EngB	3.53e-07	NA	0.006	NA
7. B	Q8PPG1	Probable GTP-binding protein EngB	1.52e-06	NA	0.001	NA
7. B	B2UCV3	GTPase Obg	3.37e-02	NA	0.004	NA
7. B	P64073	Probable GTP-binding protein EngB	3.34e-07	NA	6.03e-04	NA
7. B	Q5M0S3	Probable GTP-binding protein EngB	2.35e-07	NA	6.79e-05	NA
7. B	A0RJ86	Probable GTP-binding protein EngB	3.12e-07	NA	2.00e-04	NA
7. B	Q2SU58	Probable GTP-binding protein EngB	1.43e-06	NA	8.45e-04	NA
7. B	A9VIU3	Probable GTP-binding protein EngB	2.93e-07	NA	0.005	NA
7. B	Q6YR66	Translation initiation factor IF-2	4.10e-03	NA	0.006	NA
7. B	A1RXH6	Probable translation initiation factor IF-2	1.22e-03	NA	2.71e-04	NA
7. B	A6WUH1	Probable GTP-binding protein EngB	1.91e-04	NA	0.040	NA
7. B	A3CMV2	Probable GTP-binding protein EngB	2.59e-07	NA	5.34e-04	NA
7. B	Q72BH2	Probable GTP-binding protein EngB	1.88e-07	NA	0.035	NA
7. B	B5Z6P0	GTPase Era	1.80e-06	NA	5.78e-11	NA
7. B	Q49768	GTPase Era	1.39e-07	NA	0.007	NA
7. B	Q5WTF1	GTPase Obg	1.64e-02	NA	0.009	NA
7. B	Q9CPH8	GTPase Era	1.31e-07	NA	2.86e-14	NA
7. B	Q47IE9	Probable GTP-binding protein EngB	4.85e-06	NA	0.028	NA
7. B	B8H630	GTPase Era	6.17e-07	NA	2.96e-12	NA
7. B	P55039	Developmentally-regulated GTP-binding protein 2	4.67e-02	NA	1.54e-04	NA
7. B	Q62GN6	Probable GTP-binding protein EngB	1.15e-06	NA	0.001	NA
7. B	A8MIS4	Probable GTP-binding protein EngB	1.79e-07	NA	0.007	NA
7. B	Q9ZE46	Probable GTP-binding protein EngB	3.73e-05	NA	0.024	NA
7. B	P06616	GTPase Era	1.35e-07	NA	7.34e-14	NA
7. B	Q72ZV7	Probable GTP-binding protein EngB	3.24e-07	NA	2.00e-04	NA
7. B	A7GYN7	GTPase Era	1.10e-06	NA	5.23e-07	NA
7. B	Q8E4L9	Probable GTP-binding protein EngB	2.20e-07	NA	2.09e-04	NA
7. B	B2KA46	GTPase Era	4.10e-07	NA	1.64e-14	NA
7. B	Q7YR35	Guanine nucleotide-binding protein-like 1	8.23e-02	NA	0.021	NA
7. B	Q1BRX9	Probable GTP-binding protein EngB	8.98e-05	NA	5.09e-04	NA
7. B	Q039K2	Probable GTP-binding protein EngB	1.90e-07	NA	0.024	NA
7. B	Q4A578	Translation initiation factor IF-2	2.13e-03	NA	0.002	NA
7. B	Q13TK1	Probable GTP-binding protein EngB	1.34e-04	NA	7.30e-04	NA
7. B	B8JBP2	GTPase Obg	5.44e-02	NA	0.004	NA
7. B	Q5ZS62	Fe(2+) transporter FeoB	8.10e-02	NA	0.021	NA
7. B	Q2NB82	GTPase Era	5.03e-07	NA	6.42e-09	NA
7. B	A0RPN6	GTPase Era	8.85e-07	NA	1.84e-09	NA
7. B	B1LP79	GTPase Era	3.79e-07	NA	1.45e-13	NA
7. B	P58071	GTPase Era	6.31e-07	NA	2.96e-12	NA
7. B	Q5FAC6	Probable GTP-binding protein EngB	4.30e-07	NA	2.85e-04	NA
7. B	A0Q2K7	Probable GTP-binding protein EngB	1.15e-05	NA	0.002	NA
7. B	A7H4F3	GTPase Era	8.68e-07	NA	1.89e-08	NA
7. B	Q9XCX8	GTPase Era	1.89e-07	NA	2.72e-09	NA
7. B	B2A1E8	Probable GTP-binding protein EngB	3.06e-07	NA	2.96e-05	NA
7. B	Q8XKK5	Probable GTP-binding protein EngB	1.95e-07	NA	5.20e-08	NA
7. B	B9FI63	GTPase ERA-like, chloroplastic	2.23e-04	NA	2.44e-10	NA
7. B	C0QLA5	Probable GTP-binding protein EngB	3.35e-07	NA	0.003	NA
7. B	Q1GAP7	Probable GTP-binding protein EngB	4.21e-08	NA	0.027	NA
7. B	B0KBA1	Probable GTP-binding protein EngB	7.53e-07	NA	3.04e-06	NA
7. B	B1MXT9	Probable GTP-binding protein EngB	2.95e-07	NA	0.001	NA
7. B	O67679	Probable GTP-binding protein EngB	1.79e-06	NA	6.98e-04	NA
7. B	A0K3Q6	Probable GTP-binding protein EngB	9.83e-05	NA	5.09e-04	NA
7. B	Q748I9	Probable GTP-binding protein EngB	6.08e-08	NA	2.28e-04	NA
7. B	C1DQS3	GTPase Era	1.40e-07	NA	4.58e-08	NA
7. B	C1C8F9	Probable GTP-binding protein EngB	2.74e-07	NA	6.03e-04	NA
7. B	B4SRK9	GTPase Era	3.87e-07	NA	1.67e-13	NA
7. B	Q54XX1	Signal recognition particle receptor subunit beta	2.04e-02	NA	0.003	NA
7. B	Q667V2	GTPase Era	3.66e-07	NA	1.64e-14	NA
7. B	B8D950	GTPase Era	2.51e-07	NA	0.001	NA
7. B	P54453	Uncharacterized protein YqeH	2.89e-02	NA	4.80e-04	NA
7. B	B5FGJ9	Sulfate adenylyltransferase subunit 1	1.53e-03	NA	0.003	NA
7. B	Q2RP11	Probable GTP-binding protein EngB	1.70e-05	NA	0.007	NA
7. B	A5G964	Probable GTP-binding protein EngB	3.08e-07	NA	7.81e-05	NA
7. B	Q9V411	Nucleolar GTP-binding protein 1	7.09e-02	NA	0.003	NA
7. B	Q7WR92	Probable GTP-binding protein EngB	2.33e-07	NA	1.08e-05	NA
7. B	A4XSC5	GTPase Era	1.85e-07	NA	8.75e-08	NA
7. B	Q9RNL6	GTP-binding protein EngB	8.09e-06	NA	0.001	NA
7. B	B2T719	Probable GTP-binding protein EngB	1.18e-04	NA	0.001	NA
7. B	Q02Z21	Probable GTP-binding protein EngB	4.14e-07	NA	1.22e-04	NA
7. B	Q83ST5	Fe(2+) transporter FeoB	1.11e-02	NA	2.96e-04	NA
7. B	Q9KPB3	GTPase Era	5.14e-06	NA	8.66e-13	NA
7. B	Q8KAK5	Probable GTP-binding protein EngB	3.29e-07	NA	3.12e-04	NA
7. B	B8FVH0	Probable GTP-binding protein EngB	3.51e-07	NA	0.034	NA
7. B	Q5GVY6	Probable GTP-binding protein EngB	1.64e-04	NA	7.33e-04	NA
7. B	A5CR32	GTPase Obg	2.61e-02	NA	0.024	NA
7. B	Q87C05	GTPase Era	2.76e-07	NA	4.13e-12	NA
7. B	B2GBC5	Probable GTP-binding protein EngB	2.95e-07	NA	0.005	NA
7. B	Q5X097	Probable GTP-binding protein EngB	1.16e-06	NA	0.011	NA
7. B	C4L4J3	Probable GTP-binding protein EngB	3.35e-07	NA	0.021	NA
7. B	Q2G983	GTPase Obg	3.84e-03	NA	1.93e-05	NA
7. B	Q38WS0	Probable GTP-binding protein EngB	3.30e-07	NA	0.001	NA
7. B	Q2VZU2	GTPase Obg	5.14e-02	NA	0.045	NA
7. B	Q4R8D2	Guanine nucleotide-binding protein-like 1	7.04e-02	NA	0.023	NA
7. B	Q8N3Z3	GTP-binding protein 8	1.90e-03	NA	0.042	NA
7. B	A4J7L5	Probable GTP-binding protein EngB	1.32e-07	NA	7.96e-05	NA
7. B	Q3BVV5	GTPase Era	3.47e-07	NA	2.09e-09	NA
7. B	A8EXG4	Probable GTP-binding protein EngB	1.84e-05	NA	3.02e-05	NA
7. B	Q2NZ59	Probable GTP-binding protein EngB	2.49e-06	NA	7.33e-04	NA
7. B	A8AXB8	Probable GTP-binding protein EngB	2.61e-07	NA	1.46e-05	NA
7. B	A9NF57	GTPase Obg	2.36e-02	NA	0.024	NA
7. B	Q03LM9	Probable GTP-binding protein EngB	2.42e-07	NA	9.68e-05	NA
7. B	Q6KHV1	Probable GTP-binding protein EngB	6.35e-04	NA	9.04e-05	NA
7. B	Q87LP0	GTPase Era	3.89e-06	NA	1.10e-13	NA
7. B	B2IR86	Probable GTP-binding protein EngB	3.27e-07	NA	2.98e-04	NA
7. B	Q8DUH9	Probable GTP-binding protein EngB	2.39e-07	NA	1.37e-05	NA
7. B	Q9JVD2	GTPase Era	9.80e-06	NA	9.40e-10	NA
7. B	Q5ZZ86	Probable GTP-binding protein EngB	9.03e-07	NA	0.004	NA
7. B	Q04JI0	Probable GTP-binding protein EngB	3.51e-07	NA	6.03e-04	NA
7. B	Q9SVA6	Developmentally-regulated G-protein 3	2.31e-02	NA	2.81e-05	NA
7. B	Q0I4Z4	GTPase Era	1.48e-07	NA	8.42e-16	NA
7. B	Q7NPV7	Probable GTP-binding protein EngB	2.40e-07	NA	8.73e-04	NA
7. B	C1F4C3	Probable GTP-binding protein EngB	1.98e-06	NA	0.001	NA
7. B	B0RDG3	GTPase Obg	2.83e-02	NA	0.019	NA
7. B	Q3A0Y0	Probable GTP-binding protein EngB	2.76e-07	NA	0.038	NA
7. B	Q2GAU7	Probable GTP-binding protein EngB	1.41e-05	NA	0.043	NA
7. B	E0TTS5	Ribosome biogenesis GTPase A	6.32e-03	NA	2.61e-04	NA
7. B	Q8VZ74	GTPase ERA-like, chloroplastic	9.94e-06	NA	3.72e-09	NA
7. B	Q56057	GTPase Era	3.68e-07	NA	2.31e-13	NA
7. B	Q2ILB9	Probable GTP-binding protein EngB	1.20e-05	NA	0.023	NA
7. B	Q1IVS5	GTPase Obg	6.17e-02	NA	0.029	NA
7. B	B3E422	GTPase Era	5.93e-07	NA	3.88e-14	NA
7. B	Q4ZPE2	GTPase Era	1.64e-07	NA	4.65e-10	NA
7. B	Q7MPF2	Sulfate adenylyltransferase subunit 1	1.30e-03	NA	1.16e-04	NA
7. B	O23680	Translocase of chloroplast 33, chloroplastic	8.87e-04	NA	0.025	NA
7. B	B1XB40	GTPase Era	1.32e-07	NA	7.34e-14	NA
7. B	B4RTW4	Sulfate adenylyltransferase subunit 1	2.22e-04	NA	0.036	NA
7. B	Q82SJ6	GTPase Era	2.70e-07	NA	3.42e-08	NA
7. B	A9MGX7	GTPase Era	1.23e-07	NA	1.36e-13	NA
7. B	B4UHX9	Probable GTP-binding protein EngB	1.18e-05	NA	0.002	NA
7. B	B4S596	Probable GTP-binding protein EngB	3.35e-07	NA	2.67e-04	NA
7. B	Q39YG6	Probable GTP-binding protein EngB	1.72e-07	NA	0.003	NA
7. B	Q9M8Z5	Guanine nucleotide-binding protein-like NSN1	6.17e-02	NA	0.031	NA
7. B	B4RQ29	Probable GTP-binding protein EngB	4.40e-07	NA	2.85e-04	NA
7. B	Q1CU14	GTPase Era	1.09e-06	NA	2.15e-08	NA
7. B	B4TS13	GTPase Era	3.27e-07	NA	1.71e-13	NA
7. B	Q65R06	Probable GTP-binding protein EngB	3.73e-07	NA	0.009	NA
7. B	Q04B34	Probable GTP-binding protein EngB	4.48e-08	NA	0.027	NA
7. B	A1JKK4	GTPase Era	4.07e-07	NA	9.16e-15	NA
7. B	Q5E830	Sulfate adenylyltransferase subunit 1	1.47e-03	NA	0.004	NA
7. B	B7IIY0	Probable GTP-binding protein EngB	2.93e-07	NA	7.78e-04	NA
7. B	Q81LC2	Probable GTP-binding protein EngB	1.30e-07	NA	2.00e-04	NA
7. B	P75303	Probable GTP-binding protein EngB	3.07e-07	NA	5.47e-06	NA
7. B	Q88RK5	Probable GTP-binding protein EngB	2.44e-04	NA	8.65e-04	NA
7. B	Q5X8V4	Probable GTP-binding protein EngB	1.39e-06	NA	0.011	NA
7. B	A3CYM5	Probable GTP-binding protein EngB	2.13e-04	NA	0.040	NA
7. B	B7UH06	GTPase Era	1.46e-07	NA	1.45e-13	NA
7. B	A8YUS5	Probable GTP-binding protein EngB	3.10e-07	NA	7.00e-05	NA
7. B	A9KHA0	Probable GTP-binding protein EngB	1.66e-07	NA	0.020	NA
7. B	B9DNB9	Probable GTP-binding protein EngB	3.03e-07	NA	0.038	NA
7. B	A1AMM1	Translation initiation factor IF-2	1.20e-02	NA	0.048	NA
7. B	Q1MSA1	Probable GTP-binding protein EngB	1.33e-04	NA	0.004	NA
7. B	A9KFA1	GTPase Era	2.18e-07	NA	9.90e-10	NA
7. B	P75135	Probable ribosome biogenesis GTPase A	5.05e-02	NA	6.42e-04	NA
7. B	A1KS92	Probable GTP-binding protein EngB	5.02e-07	NA	0.001	NA
7. B	B5BAT1	GTPase Era	1.56e-07	NA	1.71e-13	NA
7. B	C3PMD9	Probable GTP-binding protein EngB	2.36e-05	NA	7.81e-04	NA
7. B	Q87DM6	Probable GTP-binding protein EngB	2.13e-06	NA	0.010	NA
7. B	B1YRR0	Probable GTP-binding protein EngB	1.17e-04	NA	5.79e-04	NA
7. B	A5VD74	GTPase Obg	6.15e-02	NA	2.25e-04	NA
7. B	A6VEW7	Probable GTP-binding protein EngB	5.90e-04	NA	0.004	NA
7. B	Q6F1A9	Probable GTP-binding protein EngB	7.30e-08	NA	3.05e-07	NA
7. B	A6TCI0	GTPase Era	2.13e-07	NA	9.35e-14	NA
7. B	O94659	Probable nucleolar GTP-binding protein 1	3.88e-02	NA	0.020	NA
7. B	B7JQ62	Probable GTP-binding protein EngB	2.98e-07	NA	2.00e-04	NA
7. B	Q5HVB3	GTPase Era	7.80e-07	NA	6.67e-08	NA
7. B	Q6MG06	Guanine nucleotide-binding protein-like 1	5.78e-02	NA	0.018	NA
7. B	Q24SK9	Probable GTP-binding protein EngB	3.24e-07	NA	0.034	NA
7. B	Q5WTE1	Fe(2+) transporter FeoB	7.90e-02	NA	0.020	NA
7. B	Q9QXB9	Developmentally-regulated GTP-binding protein 2	4.48e-02	NA	1.00e-04	NA
7. B	B4E5X0	GTPase Obg	1.34e-02	NA	0.020	NA
7. B	Q88VE3	Probable GTP-binding protein EngB	3.57e-07	NA	2.54e-04	NA
7. B	Q026Q1	Probable GTP-binding protein EngB	1.22e-06	NA	0.001	NA
7. B	P32235	GTP-binding protein 1	4.25e-02	NA	4.70e-06	NA
7. B	Q0AF71	GTPase Era	4.44e-07	NA	5.97e-14	NA
7. B	B7N6F4	GTPase Era	2.25e-07	NA	1.45e-13	NA
7. B	Q5HVC1	Probable GTP-binding protein EngB	4.44e-06	NA	0.035	NA
7. B	B5FFA6	Probable GTP-binding protein EngB	4.26e-07	NA	0.012	NA
7. B	B8JEQ8	Probable GTP-binding protein EngB	1.58e-05	NA	0.002	NA
7. B	Q2P4M0	GTPase Era	4.12e-07	NA	3.58e-09	NA
7. B	B7NRL9	GTPase Era	3.60e-07	NA	1.45e-13	NA
7. B	Q87SX9	Sulfate adenylyltransferase subunit 1	1.48e-03	NA	0.005	NA
7. B	P73182	Fe(2+) transporter FeoB	5.28e-03	NA	0.005	NA
7. B	A7I277	GTPase Era	9.38e-07	NA	2.95e-07	NA
7. B	B1IVR1	GTPase Era	1.29e-07	NA	7.34e-14	NA
7. B	B8DQN1	GTPase Era	9.82e-07	NA	1.12e-08	NA
7. B	Q0APC5	GTPase Era	7.54e-07	NA	9.93e-08	NA
7. B	B5RD48	GTPase Era	1.48e-07	NA	1.71e-13	NA
7. B	B6JL99	GTPase Era	1.66e-06	NA	3.45e-08	NA
7. B	Q5PIG4	GTPase Era	1.90e-07	NA	1.71e-13	NA
7. B	Q6MPP2	Probable GTP-binding protein EngB	8.82e-07	NA	2.26e-04	NA
7. B	Q8PB51	GTPase Era	2.56e-07	NA	5.07e-09	NA
7. B	Q8K9R2	GTPase Era	3.38e-07	NA	4.50e-06	NA
7. B	A6LT31	Probable GTP-binding protein EngB	2.71e-07	NA	3.35e-08	NA
7. B	B4TE14	GTPase Era	3.37e-07	NA	2.31e-13	NA
7. B	Q99ME9	GTP-binding protein 4	7.10e-02	NA	0.039	NA
7. B	Q6MTV5	Probable GTP-binding protein EngB	1.46e-07	NA	1.33e-11	NA
7. B	Q8RC22	Probable GTP-binding protein EngB	2.39e-07	NA	7.83e-07	NA
7. B	B5EEM1	Probable GTP-binding protein EngB	1.68e-07	NA	0.005	NA
7. B	A8GUK6	Probable GTP-binding protein EngB	1.14e-05	NA	1.82e-05	NA
7. B	A9M1V2	Probable GTP-binding protein EngB	4.91e-07	NA	0.001	NA
7. B	Q8H1F6	DAR GTPase 3, chloroplastic	2.23e-02	NA	4.41e-04	NA
7. B	C0MEW6	Probable GTP-binding protein EngB	3.09e-07	NA	0.011	NA
7. B	Q057R5	GTPase Era	1.11e-07	NA	3.39e-05	NA
7. B	C3LRM1	Sulfate adenylyltransferase subunit 1	1.80e-04	NA	1.82e-04	NA
7. B	Q1BZE0	GTPase Obg	1.42e-02	NA	0.020	NA
7. B	B3GX86	GTPase Era	1.56e-07	NA	5.37e-14	NA
7. B	A9R403	GTPase Era	4.34e-07	NA	1.64e-14	NA
7. B	A9KWY5	Probable GTP-binding protein EngB	2.45e-04	NA	0.040	NA
7. B	Q15VB8	Sulfate adenylyltransferase subunit 1	2.02e-04	NA	0.019	NA
7. B	B4T1F7	GTPase Era	2.66e-07	NA	2.31e-13	NA
7. B	Q8PMU9	GTPase Era	3.25e-07	NA	1.89e-09	NA
7. B	P95691	Probable translation initiation factor IF-2	1.46e-03	NA	0.034	NA
7. B	B7UYX1	GTPase Era	1.71e-07	NA	2.72e-09	NA
7. B	B5XNH1	GTPase Era	1.69e-07	NA	7.83e-14	NA
7. B	Q32CV5	GTPase Era	1.61e-07	NA	2.63e-13	NA
7. B	P51836	GTPase Era	2.64e-07	NA	4.93e-10	NA
7. B	P43690	Developmentally-regulated GTP-binding protein 1	2.39e-02	NA	0.025	NA
7. B	Q57IW8	Fe(2+) transporter FeoB	1.09e-02	NA	2.96e-04	NA
7. B	B1YSU7	GTPase Obg	2.09e-02	NA	0.030	NA
7. B	B1JRC8	GTPase Era	3.04e-07	NA	1.64e-14	NA
7. B	Q48A63	Probable GTP-binding protein EngB	8.27e-05	NA	0.007	NA
7. B	P32233	Developmentally-regulated GTP-binding protein 1	2.40e-02	NA	0.023	NA
7. B	Q49435	Probable ribosome biogenesis GTPase A	1.23e-02	NA	0.002	NA
7. B	Q97FU0	Probable GTP-binding protein EngB	2.08e-07	NA	8.70e-06	NA
7. B	A6TM67	Probable GTP-binding protein EngB	5.69e-08	NA	8.02e-06	NA
7. B	Q65JP4	Ribosome biogenesis GTPase A	5.77e-03	NA	3.69e-04	NA
7. B	B9IZ44	Probable GTP-binding protein EngB	3.26e-07	NA	2.00e-04	NA
7. B	P57345	GTPase Era	3.39e-07	NA	0.001	NA
7. B	Q9PDE9	Probable GTP-binding protein EngB	1.80e-06	NA	0.002	NA
7. B	B3QUN2	Translation initiation factor IF-2	3.39e-02	NA	0.040	NA
7. B	Q1LSJ9	GTPase Obg	4.41e-02	NA	0.037	NA
7. B	B7LDF9	GTPase Era	1.62e-07	NA	1.45e-13	NA
7. B	Q9HT81	Probable GTP-binding protein EngB	8.03e-04	NA	0.003	NA
7. B	B6I5E0	GTPase Era	3.77e-07	NA	1.45e-13	NA
7. B	Q8EX09	Probable GTP-binding protein EngB	6.72e-04	NA	1.78e-06	NA
7. B	A5VJ95	Probable GTP-binding protein EngB	2.20e-07	NA	4.19e-05	NA
7. B	Q5FJT7	GTPase Era	2.18e-07	NA	7.08e-18	NA
7. B	Q8NW73	Probable GTP-binding protein EngB	3.04e-07	NA	0.044	NA
7. B	B0TFJ0	Probable GTP-binding protein EngB	2.57e-07	NA	0.023	NA
7. B	Q6C036	Nucleolar GTP-binding protein 2	4.63e-02	NA	0.032	NA
7. B	Q5X1P1	GTPase Obg	1.53e-02	NA	0.006	NA
7. B	B6ELP3	Sulfate adenylyltransferase subunit 1	1.56e-03	NA	0.002	NA
7. B	Q8Y0I0	GTPase Era	5.94e-07	NA	1.07e-09	NA
7. B	P58070	GTPase Era	3.37e-07	NA	6.32e-14	NA
7. B	B8F8H7	Probable GTP-binding protein EngB	4.37e-07	NA	0.043	NA
7. B	C1ETR5	Probable GTP-binding protein EngB	3.25e-07	NA	2.00e-04	NA
7. B	A8YVM7	GTPase Era	2.51e-07	NA	2.12e-17	NA
7. B	Q923K4	tRNA modification GTPase GTPBP3, mitochondrial	2.38e-03	NA	1.49e-05	NA
7. B	Q969Y2	tRNA modification GTPase GTPBP3, mitochondrial	7.09e-04	NA	6.09e-07	NA
7. B	P9WNK9	GTPase Era	4.18e-07	NA	2.08e-04	NA
7. B	Q6LLQ5	Probable GTP-binding protein EngB	5.71e-05	NA	0.022	NA
7. B	Q8MT06	Guanine nucleotide-binding protein-like 3 homolog	3.39e-02	NA	0.014	NA
7. B	Q3BXK1	Probable GTP-binding protein EngB	1.51e-04	NA	0.001	NA
7. B	Q9JVW1	Probable GTP-binding protein EngB	4.97e-07	NA	0.001	NA
7. B	B3WE42	Probable GTP-binding protein EngB	2.24e-07	NA	0.024	NA
7. B	Q4USF8	GTPase Era	2.56e-07	NA	5.07e-09	NA
7. B	B5ZB76	Probable GTP-binding protein EngB	1.16e-05	NA	2.72e-04	NA
7. B	Q5ZS70	GTPase Obg	1.72e-02	NA	0.005	NA
7. B	Q1R8G7	GTPase Era	3.52e-07	NA	1.45e-13	NA
7. B	A1VDC5	Probable GTP-binding protein EngB	1.86e-07	NA	0.037	NA
7. B	Q7MVL1	Fe(2+) transporter FeoB homolog	1.47e-02	NA	0.011	NA
7. B	B3CNP2	GTPase Obg	1.89e-02	NA	0.028	NA
7. B	Q1QSU7	Probable GTP-binding protein EngB	1.36e-06	NA	0.006	NA
7. B	Q5PLZ1	Fe(2+) transporter FeoB	1.02e-02	NA	2.96e-04	NA
7. B	Q8R2R6	Mitochondrial ribosome-associated GTPase 1	1.44e-02	NA	0.015	NA
7. B	P53295	Ribosome-interacting GTPase 2	1.96e-02	NA	0.002	NA
7. B	A4IRG9	Probable GTP-binding protein EngB	4.80e-07	NA	0.002	NA
7. B	Q042T8	Probable GTP-binding protein EngB	4.54e-07	NA	2.38e-06	NA
7. B	Q0ASI7	Probable GTP-binding protein EngB	3.07e-07	NA	0.003	NA
7. B	Q48EV4	GTPase Era	1.56e-07	NA	4.65e-10	NA
7. B	B8D7F4	GTPase Era	3.32e-07	NA	0.001	NA
7. B	C6E8C5	Probable GTP-binding protein EngB	4.62e-07	NA	0.004	NA
7. B	Q9KP20	Sulfate adenylyltransferase subunit 1	1.82e-04	NA	1.82e-04	NA
7. B	C4K1B9	Probable GTP-binding protein EngB	3.32e-05	NA	7.81e-04	NA
7. B	P47627	GTPase Era	1.19e-05	NA	0.034	NA
7. B	Q9PMQ9	Fe(2+) transporter FeoB	4.19e-03	NA	9.27e-05	NA
7. B	P34280	Uncharacterized GTP-binding protein C02F5.3	3.87e-02	NA	6.17e-06	NA
7. B	P43728	GTPase Era	1.54e-07	NA	8.24e-15	NA
7. B	A0L2Q8	Probable GTP-binding protein EngB	1.71e-04	NA	0.031	NA
7. B	A5I9U4	Probable GTP-binding protein EngB	9.43e-07	NA	0.004	NA
7. B	Q9ZLF3	Fe(2+) transporter FeoB	6.60e-03	NA	4.61e-07	NA
7. B	Q0HPI0	Probable GTP-binding protein EngB	2.26e-04	NA	0.031	NA
7. B	Q180E5	Probable GTP-binding protein EngB	6.91e-08	NA	0.008	NA
7. B	Q9ZLW0	GTPase Era	1.14e-06	NA	7.89e-09	NA
7. B	O67800	GTPase Era	1.42e-07	NA	1.11e-15	NA
7. B	Q88MY4	GTPase Era	1.96e-07	NA	4.12e-07	NA
7. B	A8AD18	GTPase Era	1.58e-07	NA	2.40e-13	NA
7. B	P56059	GTPase Era	9.86e-07	NA	1.21e-10	NA
7. B	Q8K9G1	GTPase Obg	2.44e-02	NA	0.018	NA
7. B	Q8DC75	GTPase Era	4.23e-06	NA	3.50e-14	NA
7. B	B9DU74	Probable GTP-binding protein EngB	3.21e-07	NA	1.73e-04	NA
7. B	P64072	Probable GTP-binding protein EngB	2.98e-07	NA	6.03e-04	NA
7. B	Q02DL7	Probable GTP-binding protein EngB	6.42e-04	NA	0.003	NA
7. B	Q7NWC3	GTPase Era	3.09e-07	NA	1.40e-14	NA
7. B	B1ICY8	Probable GTP-binding protein EngB	3.99e-07	NA	3.65e-04	NA
7. B	Q03QN8	Probable GTP-binding protein EngB	2.41e-07	NA	0.007	NA
7. B	Q9C3Z4	Nucleolar GTP-binding protein 2	NA	NA	0.004	NA
7. B	C4ZYI9	GTPase Era	1.33e-07	NA	7.34e-14	NA
7. B	Q8JIF5	GTPase Era, mitochondrial	3.17e-03	NA	5.39e-04	NA
7. B	Q7VL76	GTPase Era	1.85e-07	NA	2.77e-14	NA
7. B	Q4FP46	GTPase Obg	7.12e-02	NA	1.08e-04	NA
7. B	Q1QUF9	Sulfate adenylyltransferase subunit 1	1.67e-04	NA	0.008	NA
7. B	J9VQ03	Nucleolar GTP-binding protein 2	8.60e-02	NA	0.008	NA
7. B	Q8P1C8	Probable GTP-binding protein EngB	3.54e-07	NA	0.009	NA
7. B	Q71ZB0	Probable GTP-binding protein EngB	2.30e-07	NA	0.001	NA
7. B	Q58D56	Developmentally-regulated GTP-binding protein 2	4.60e-02	NA	4.00e-04	NA
7. B	C1AB49	Probable GTP-binding protein EngB	3.00e-07	NA	4.10e-05	NA
7. B	Q9LQK0	Developmentally-regulated G-protein 1	5.87e-02	NA	3.76e-04	NA
7. B	C0PYG8	GTPase Era	1.51e-07	NA	1.71e-13	NA
7. B	A1AU48	Probable GTP-binding protein EngB	2.57e-07	NA	0.004	NA
7. B	A9BHV0	Probable GTP-binding protein EngB	1.09e-04	NA	4.01e-04	NA
7. B	B7VKY2	Sulfate adenylyltransferase subunit 1	1.83e-03	NA	0.003	NA
7. B	Q63Q42	Probable GTP-binding protein EngB	5.56e-05	NA	0.001	NA
7. B	Q3JMU4	Probable GTP-binding protein EngB	7.30e-05	NA	0.001	NA
7. B	B4E5Y9	Probable GTP-binding protein EngB	1.11e-06	NA	5.09e-04	NA
7. B	C1KVK5	Probable GTP-binding protein EngB	1.84e-07	NA	0.001	NA
7. B	A8FL79	GTPase Era	7.00e-07	NA	4.80e-08	NA
7. B	B0K530	Probable GTP-binding protein EngB	7.21e-07	NA	3.04e-06	NA
7. B	Q054P6	GTPase Obg	3.06e-02	NA	0.006	NA
7. B	A0K4B0	GTPase Obg	2.97e-02	NA	0.020	NA