Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54733.1
JCVISYN3A_0350
DNA-binding protein.
M. mycoides homolog: Q6MTJ4.
TIGRfam Classification: 2=Generic.
Category: Essential.
Statistics
Total GO Annotation: 17
Unique PROST Go: 1
Unique BLAST Go: 2
Unique Foldseek Go: 0
Total Homologs: 670
Unique PROST Homologs: 7
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P0A1R6
(DNA-binding protein HU-alpha) with a FATCAT P-Value: 0 and RMSD of 0.94 angstrom. The sequence alignment identity is 34.4%.
Structural alignment shown in left. Query protein AVX54733.1 colored as red in alignment, homolog P0A1R6 colored as blue.
Query protein AVX54733.1 is also shown in right top, homolog P0A1R6 showed in right bottom. They are colored based on secondary structures.
AVX54733.1 MTKKELIEEIIINENISKVDAEKVVNRIFQTISKHLIDGKEVSVAGFGKFVISERASREGVNPSTGEKIVIPASRSARFKPAKQLKESLM 90 P0A1R6 MNKTQLIDVIADKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK 90
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0003677 | DNA binding |
| 1. PBF | GO:1905087 | positive regulation of bioluminescence |
| 1. PBF | GO:0006417 | regulation of translation |
| 1. PBF | GO:0043158 | heterocyst differentiation |
| 1. PBF | GO:0006355 | regulation of transcription, DNA-templated |
| 1. PBF | GO:0030261 | chromosome condensation |
| 1. PBF | GO:0005694 | chromosome |
| 1. PBF | GO:0006310 | DNA recombination |
| 1. PBF | GO:0006323 | DNA packaging |
| 1. PBF | GO:0032993 | protein-DNA complex |
| 1. PBF | GO:0001216 | DNA-binding transcription activator activity |
| 3. BF | GO:0005576 | extracellular region |
| 4. PB | GO:0000746 | conjugation |
| 4. PB | GO:1990178 | HU-DNA complex |
| 5. P | GO:0005634 | nucleus |
| 7. B | GO:0005886 | plasma membrane |
| 7. B | GO:0090143 | nucleoid organization |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0003677 | DNA binding |
| GO:0030527 | structural constituent of chromatin |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P17615 | DNA-binding protein HB1 | 0.00e+00 | 7.66e-46 | 2.65e-07 | 0.9323 |
| 1. PBF | Q21YS7 | Integration host factor subunit alpha | 2.22e-16 | 3.81e-32 | 1.97e-12 | 0.9103 |
| 1. PBF | A9IVB2 | Integration host factor subunit alpha | 1.15e-14 | 1.52e-28 | 1.44e-05 | 0.8712 |
| 1. PBF | Q07UH4 | Integration host factor subunit beta | 0.00e+00 | 1.31e-25 | 2.21e-11 | 0.9217 |
| 1. PBF | Q057N8 | Integration host factor subunit beta | 1.12e-13 | 4.52e-34 | 9.91e-11 | 0.8838 |
| 1. PBF | A7HPD7 | Integration host factor subunit beta | 0.00e+00 | 5.33e-13 | 5.07e-12 | 0.9146 |
| 1. PBF | Q57220 | DNA-binding protein HBbu | 3.41e-12 | 1.07e-23 | 7.41e-06 | 0.8485 |
| 1. PBF | Q45722 | DNA-binding protein HBbu | 1.79e-12 | 1.27e-26 | 8.79e-06 | 0.8582 |
| 1. PBF | B0T273 | Integration host factor subunit beta | 0.00e+00 | 4.16e-36 | 5.02e-10 | 0.9009 |
| 1. PBF | B3Q602 | Integration host factor subunit beta | 0.00e+00 | 1.46e-20 | 1.81e-10 | 0.9136 |
| 1. PBF | Q89WE8 | Integration host factor subunit beta | 0.00e+00 | 1.46e-26 | 1.10e-10 | 0.924 |
| 1. PBF | Q9JR30 | DNA-binding protein HU-beta 2 | 0.00e+00 | 2.85e-50 | 1.52e-15 | 0.9347 |
| 1. PBF | Q8UG61 | Integration host factor subunit alpha | 1.04e-14 | 1.78e-21 | 1.23e-06 | 0.8783 |
| 1. PBF | Q06607 | Integration host factor subunit beta | 0.00e+00 | 3.40e-36 | 9.77e-11 | 0.9139 |
| 1. PBF | B3PZE1 | Integration host factor subunit beta | 0.00e+00 | 1.84e-25 | 3.12e-11 | 0.9252 |
| 1. PBF | B9JZH2 | Integration host factor subunit beta | 0.00e+00 | 6.65e-21 | 1.90e-11 | 0.9242 |
| 1. PBF | Q47ZS6 | Integration host factor subunit alpha | 0.00e+00 | 3.58e-43 | 1.20e-12 | 0.9211 |
| 1. PBF | A8IN83 | Integration host factor subunit beta | 0.00e+00 | 8.90e-42 | 6.06e-12 | 0.9051 |
| 1. PBF | A4YW83 | Integration host factor subunit alpha | 3.11e-15 | 6.29e-15 | 3.53e-07 | 0.9027 |
| 1. PBF | Q12ND8 | Integration host factor subunit beta | 0.00e+00 | 8.43e-34 | 2.49e-11 | 0.9102 |
| 1. PBF | Q7WKR3 | Integration host factor subunit alpha | 1.11e-16 | 4.41e-24 | 1.84e-11 | 0.9189 |
| 1. PBF | C6DFZ2 | Integration host factor subunit alpha | 0.00e+00 | 1.13e-43 | 1.32e-14 | 0.917 |
| 1. PBF | A6TAI1 | Integration host factor subunit alpha | 0.00e+00 | 4.69e-41 | 6.16e-15 | 0.9201 |
| 1. PBF | B4UAP1 | Integration host factor subunit alpha | 8.88e-16 | 3.51e-09 | 5.51e-16 | 0.9043 |
| 1. PBF | Q9ZCL7 | Histone-like DNA-binding protein | 0.00e+00 | 2.18e-33 | 2.73e-04 | 0.8953 |
| 1. PBF | P68573 | SPbeta prophage-derived DNA-binding protein HU 2 | 0.00e+00 | 6.99e-40 | 3.77e-22 | 0.9142 |
| 1. PBF | Q1QWK1 | Integration host factor subunit alpha | 0.00e+00 | 2.75e-32 | 2.10e-12 | 0.9244 |
| 1. PBF | Q2SDJ8 | Integration host factor subunit alpha | 2.22e-16 | 6.87e-41 | 1.51e-11 | 0.9064 |
| 1. PBF | Q0TJE1 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9093 |
| 1. PBF | Q0VNG4 | Integration host factor subunit alpha | 0.00e+00 | 5.98e-39 | 2.01e-12 | 0.9202 |
| 1. PBF | P64389 | DNA-binding protein HU-beta | 0.00e+00 | 9.66e-48 | 6.85e-19 | 0.9357 |
| 1. PBF | B5F165 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9079 |
| 1. PBF | O25506 | DNA-binding protein HU | 1.77e-12 | 3.20e-36 | 3.95e-05 | 0.8605 |
| 1. PBF | A9W4E5 | Integration host factor subunit alpha | 5.55e-16 | 1.90e-24 | 1.38e-06 | 0.899 |
| 1. PBF | Q9F297 | Integration host factor subunit alpha (Fragment) | 2.00e-15 | 6.70e-40 | 8.62e-12 | 0.888 |
| 1. PBF | P64391 | Integration host factor subunit alpha | 3.09e-13 | 3.24e-29 | 8.85e-07 | 0.8278 |
| 1. PBF | B5FDX6 | Integration host factor subunit alpha | 1.11e-16 | 6.02e-43 | 3.41e-15 | 0.9149 |
| 1. PBF | Q9HTL0 | DNA-binding protein HU-alpha | 0.00e+00 | 9.57e-37 | 1.80e-12 | 0.9361 |
| 1. PBF | Q3SSS2 | Integration host factor subunit alpha | 1.33e-15 | 9.44e-33 | 2.18e-07 | 0.8961 |
| 1. PBF | Q31YT8 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9105 |
| 1. PBF | P0A1S1 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9178 |
| 1. PBF | B4SSV3 | Integration host factor subunit beta | 0.00e+00 | 2.56e-27 | 4.34e-12 | 0.917 |
| 1. PBF | B0VV83 | Integration host factor subunit alpha | 0.00e+00 | 1.57e-37 | 2.92e-11 | 0.9247 |
| 1. PBF | Q4ZQ99 | Integration host factor subunit beta | 0.00e+00 | 7.90e-30 | 1.77e-13 | 0.9357 |
| 1. PBF | B8EA98 | Integration host factor subunit beta | 0.00e+00 | 2.23e-32 | 2.84e-11 | 0.9133 |
| 1. PBF | P57394 | Integration host factor subunit beta | 1.11e-16 | 1.00e-38 | 6.38e-09 | 0.9172 |
| 1. PBF | A4TN15 | Integration host factor subunit beta | 0.00e+00 | 9.19e-37 | 4.28e-11 | 0.908 |
| 1. PBF | B0CIR1 | Integration host factor subunit beta | 0.00e+00 | 2.50e-39 | 5.49e-11 | 0.9174 |
| 1. PBF | Q2IJA7 | Integration host factor subunit alpha | 1.22e-15 | 1.52e-09 | 5.94e-16 | 0.9046 |
| 1. PBF | A9R0A2 | Integration host factor subunit alpha | 1.11e-16 | 3.01e-43 | 1.09e-14 | 0.9144 |
| 1. PBF | Q21CB6 | Integration host factor subunit beta | 0.00e+00 | 3.35e-28 | 1.81e-10 | 0.9153 |
| 1. PBF | A5UCA8 | Integration host factor subunit alpha | 0.00e+00 | 5.06e-43 | 8.69e-11 | 0.9207 |
| 1. PBF | A9M383 | Integration host factor subunit alpha | 2.00e-15 | 3.92e-36 | 6.08e-13 | 0.8911 |
| 1. PBF | Q5QXL9 | Integration host factor subunit alpha | 1.11e-16 | 2.25e-40 | 3.55e-13 | 0.9108 |
| 1. PBF | A4VM16 | Integration host factor subunit alpha | 4.44e-16 | 9.28e-42 | 2.12e-12 | 0.9005 |
| 1. PBF | Q0AA51 | Integration host factor subunit beta | 0.00e+00 | 1.19e-27 | 5.27e-14 | 0.9463 |
| 1. PBF | A5UF83 | Integration host factor subunit beta | 0.00e+00 | 1.00e-35 | 2.48e-10 | 0.9344 |
| 1. PBF | Q7VLR8 | Integration host factor subunit beta | 0.00e+00 | 7.09e-38 | 4.12e-10 | 0.9146 |
| 1. PBF | Q7W605 | Integration host factor subunit beta | 0.00e+00 | 1.09e-04 | 1.06e-12 | 0.9188 |
| 1. PBF | Q6GGT8 | DNA-binding protein HU | 0.00e+00 | 6.89e-50 | 5.14e-17 | 0.9494 |
| 1. PBF | Q6D404 | Integration host factor subunit beta | 0.00e+00 | 1.30e-35 | 3.23e-11 | 0.9073 |
| 1. PBF | Q0AAM1 | Integration host factor subunit alpha | 0.00e+00 | 6.72e-36 | 3.94e-13 | 0.9179 |
| 1. PBF | B0V5Q4 | Integration host factor subunit alpha | 1.11e-16 | 1.57e-37 | 2.92e-11 | 0.9068 |
| 1. PBF | Q28LB0 | Integration host factor subunit beta | 0.00e+00 | 4.70e-38 | 6.98e-11 | 0.9217 |
| 1. PBF | Q07MS0 | Integration host factor subunit alpha | 1.11e-16 | 2.37e-21 | 1.24e-07 | 0.9122 |
| 1. PBF | B6IUP4 | Integration host factor subunit beta | 0.00e+00 | 2.81e-38 | 8.10e-13 | 0.9352 |
| 1. PBF | A6VPK8 | Integration host factor subunit beta | 0.00e+00 | 2.76e-35 | 1.29e-09 | 0.9162 |
| 1. PBF | A1JMM4 | Integration host factor subunit alpha | 1.11e-16 | 3.01e-43 | 1.09e-14 | 0.9151 |
| 1. PBF | C3M9J7 | Integration host factor subunit alpha | 2.13e-12 | 3.28e-22 | 1.33e-06 | 0.8033 |
| 1. PBF | B8D7K1 | Integration host factor subunit beta | 0.00e+00 | 1.00e-38 | 6.38e-09 | 0.9259 |
| 1. PBF | Q4UVD5 | Integration host factor subunit beta | 0.00e+00 | 2.10e-24 | 1.11e-13 | 0.9416 |
| 1. PBF | A5F1W7 | Integration host factor subunit alpha | 1.11e-16 | 9.68e-44 | 9.49e-15 | 0.9161 |
| 1. PBF | Q6LPE4 | Integration host factor subunit beta | 0.00e+00 | 1.73e-34 | 1.25e-12 | 0.9119 |
| 1. PBF | E0J6W8 | DNA-binding protein HU-alpha | 0.00e+00 | 1.52e-47 | 6.14e-11 | 0.9606 |
| 1. PBF | B6JGR8 | Integration host factor subunit alpha | 1.11e-16 | 4.70e-21 | 3.78e-07 | 0.9194 |
| 1. PBF | Q2RTS7 | Integration host factor subunit alpha | 1.22e-15 | 1.31e-31 | 4.88e-09 | 0.8911 |
| 1. PBF | B7NAR1 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9089 |
| 1. PBF | Q3IIL3 | Integration host factor subunit alpha | 0.00e+00 | 1.42e-41 | 3.88e-13 | 0.9438 |
| 1. PBF | Q63TM8 | Integration host factor subunit alpha | 3.33e-16 | 1.84e-19 | 1.91e-11 | 0.9179 |
| 1. PBF | Q2KD65 | Integration host factor subunit beta | 0.00e+00 | 1.84e-25 | 3.12e-11 | 0.9242 |
| 1. PBF | Q9XB20 | DNA-binding protein HU | 0.00e+00 | 1.31e-39 | 6.71e-11 | 0.9373 |
| 1. PBF | Q28RG2 | Integration host factor subunit alpha | 9.99e-16 | 1.34e-42 | 2.90e-13 | 0.8955 |
| 1. PBF | B6EN06 | Integration host factor subunit alpha | 1.11e-16 | 1.10e-42 | 3.27e-15 | 0.9143 |
| 1. PBF | P0C0H2 | DNA-binding protein HU | 0.00e+00 | 2.83e-39 | 2.99e-15 | 0.9437 |
| 1. PBF | B4RS41 | Integration host factor subunit alpha | 1.11e-16 | 2.11e-40 | 6.82e-14 | 0.9157 |
| 1. PBF | B0BNN9 | Integration host factor subunit alpha | 2.22e-16 | 8.02e-38 | 2.12e-10 | 0.9065 |
| 1. PBF | B3H139 | Integration host factor subunit alpha | 1.11e-16 | 8.02e-38 | 2.12e-10 | 0.9099 |
| 1. PBF | A8A0Q4 | Integration host factor subunit alpha | 1.11e-16 | 7.67e-39 | 6.43e-15 | 0.9152 |
| 1. PBF | A9MHX0 | Integration host factor subunit beta | 0.00e+00 | 1.18e-37 | 6.68e-12 | 0.906 |
| 1. PBF | P96045 | DNA-binding protein HU | 0.00e+00 | 6.29e-43 | 1.57e-15 | 0.9412 |
| 1. PBF | B5YT46 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9098 |
| 1. PBF | Q46121 | DNA-binding protein HU | 1.11e-16 | 1.87e-30 | 1.61e-16 | 0.9048 |
| 1. PBF | A9N7V2 | Integration host factor subunit beta | 1.11e-16 | 4.53e-37 | 3.30e-12 | 0.9044 |
| 1. PBF | B1KF50 | Integration host factor subunit beta | 0.00e+00 | 7.50e-34 | 1.29e-11 | 0.9146 |
| 1. PBF | P57144 | DNA-binding protein HU | 0.00e+00 | 3.18e-49 | 9.36e-14 | 0.9335 |
| 1. PBF | P64388 | DNA-binding protein HU-beta | 0.00e+00 | 9.66e-48 | 6.85e-19 | 0.9347 |
| 1. PBF | B7MHM1 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9084 |
| 1. PBF | Q2SCF7 | Integration host factor subunit beta | 0.00e+00 | 1.61e-32 | 2.10e-14 | 0.9415 |
| 1. PBF | P0ACF2 | DNA-binding protein HU-alpha | 0.00e+00 | 1.52e-47 | 6.14e-11 | 0.9613 |
| 1. PBF | P0A1R7 | DNA-binding protein HU-alpha | 0.00e+00 | 8.49e-47 | 4.16e-11 | 0.9604 |
| 1. PBF | B1JJ23 | Integration host factor subunit alpha | 1.11e-16 | 3.01e-43 | 1.09e-14 | 0.9131 |
| 1. PBF | Q9X9F6 | Integration host factor subunit alpha | 1.11e-16 | 3.01e-43 | 1.09e-14 | 0.9152 |
| 1. PBF | P64393 | Integration host factor subunit alpha | 1.78e-15 | 3.92e-36 | 6.08e-13 | 0.8918 |
| 1. PBF | Q98GS0 | Integration host factor subunit beta | 0.00e+00 | 3.08e-37 | 2.93e-11 | 0.9245 |
| 1. PBF | Q32FI7 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9194 |
| 1. PBF | Q2NUA6 | Integration host factor subunit beta | 0.00e+00 | 2.55e-35 | 2.00e-10 | 0.9078 |
| 1. PBF | P30787 | Integration host factor subunit alpha | 9.55e-15 | 4.38e-46 | 4.27e-11 | 0.8701 |
| 1. PBF | Q1CA70 | Integration host factor subunit beta | 0.00e+00 | 9.19e-37 | 4.28e-11 | 0.9097 |
| 1. PBF | A8AIH1 | Integration host factor subunit beta | 1.11e-16 | 4.53e-37 | 3.30e-12 | 0.9051 |
| 1. PBF | B2FNP6 | Integration host factor subunit beta | 0.00e+00 | 2.56e-27 | 4.34e-12 | 0.9162 |
| 1. PBF | Q9KQS9 | DNA-binding protein HU-beta | 0.00e+00 | 4.62e-47 | 9.90e-17 | 0.9396 |
| 1. PBF | Q83C16 | Integration host factor subunit alpha | 0.00e+00 | 2.25e-28 | 1.34e-10 | 0.9369 |
| 1. PBF | O83278 | DNA-binding protein HU | 0.00e+00 | 7.13e-26 | 0.010 | 0.9254 |
| 1. PBF | B0UR46 | Integration host factor subunit alpha | 1.11e-16 | 2.23e-32 | 6.82e-09 | 0.9133 |
| 1. PBF | Q9LA96 | DNA-binding protein HU-alpha | 0.00e+00 | 4.79e-46 | 1.15e-12 | 0.9681 |
| 1. PBF | P02345 | DNA-binding protein HTa | 1.11e-16 | 7.66e-46 | 0.012 | 0.9174 |
| 1. PBF | Q92SJ7 | Integration host factor subunit beta | 0.00e+00 | 2.04e-22 | 3.42e-11 | 0.9287 |
| 1. PBF | A0KWP0 | Integration host factor subunit beta | 0.00e+00 | 7.21e-33 | 2.75e-11 | 0.9112 |
| 1. PBF | P0ACF6 | DNA-binding protein HU-beta | 0.00e+00 | 4.94e-47 | 1.63e-17 | 0.9513 |
| 1. PBF | A4XTS7 | Integration host factor subunit alpha | 3.33e-16 | 2.49e-40 | 5.87e-12 | 0.9038 |
| 1. PBF | Q9AKK7 | Histone-like DNA-binding protein | 0.00e+00 | 1.42e-34 | 0.005 | 0.8956 |
| 1. PBF | P64394 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9071 |
| 1. PBF | B2S8E6 | Integration host factor subunit beta | 0.00e+00 | 8.33e-39 | 7.13e-11 | 0.9224 |
| 1. PBF | Q081U7 | Integration host factor subunit beta | 0.00e+00 | 2.11e-32 | 2.90e-11 | 0.9094 |
| 1. PBF | Q883H6 | Integration host factor subunit alpha | 3.33e-16 | 2.38e-41 | 2.81e-13 | 0.9041 |
| 1. PBF | Q7MLX5 | Integration host factor subunit beta | 0.00e+00 | 8.89e-36 | 7.12e-12 | 0.919 |
| 1. PBF | P37983 | Integration host factor subunit beta | 0.00e+00 | 6.39e-37 | 2.41e-11 | 0.9104 |
| 1. PBF | B3QJM1 | Integration host factor subunit alpha | 2.11e-15 | 1.34e-15 | 1.57e-07 | 0.8987 |
| 1. PBF | Q45352 | DNA-binding protein HBbu | 2.27e-12 | 1.20e-24 | 1.56e-05 | 0.8542 |
| 1. PBF | Q57R19 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9084 |
| 1. PBF | P36206 | DNA-binding protein HU | 0.00e+00 | 5.95e-51 | 3.67e-17 | 0.9315 |
| 1. PBF | B7I698 | Integration host factor subunit alpha | 1.11e-16 | 1.57e-37 | 2.92e-11 | 0.9082 |
| 1. PBF | P0A6Y4 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9091 |
| 1. PBF | P0A126 | Integration host factor subunit alpha | 4.44e-16 | 9.49e-42 | 1.88e-12 | 0.9014 |
| 1. PBF | P0A129 | Integration host factor subunit beta | 0.00e+00 | 6.24e-29 | 2.05e-13 | 0.9371 |
| 1. PBF | Q82TD7 | Integration host factor subunit beta | 0.00e+00 | 2.22e-22 | 1.44e-11 | 0.9271 |
| 1. PBF | A6WV92 | Integration host factor subunit beta | 0.00e+00 | 2.50e-39 | 5.49e-11 | 0.9184 |
| 1. PBF | Q3SK28 | Integration host factor subunit alpha | 0.00e+00 | 2.71e-35 | 1.66e-09 | 0.931 |
| 1. PBF | B0KTY3 | Integration host factor subunit beta | 0.00e+00 | 6.10e-30 | 2.15e-13 | 0.9391 |
| 1. PBF | P05384 | DNA-binding protein HU-beta | 0.00e+00 | 7.88e-51 | 1.28e-14 | 0.9579 |
| 1. PBF | B5XQD2 | Integration host factor subunit alpha | 0.00e+00 | 4.69e-41 | 6.16e-15 | 0.9207 |
| 1. PBF | Q3SWL5 | Integration host factor subunit beta | 0.00e+00 | 8.97e-28 | 2.69e-11 | 0.9161 |
| 1. PBF | P0A1R9 | DNA-binding protein HU-beta | 0.00e+00 | 4.38e-46 | 6.53e-18 | 0.9396 |
| 1. PBF | Q5HUP6 | DNA-binding protein HU | 1.11e-16 | 1.87e-30 | 1.61e-16 | 0.9043 |
| 1. PBF | B0RSA5 | Integration host factor subunit beta | 0.00e+00 | 2.10e-24 | 1.11e-13 | 0.9408 |
| 1. PBF | Q9PFD5 | Integration host factor subunit alpha | 0.00e+00 | 3.25e-38 | 2.92e-11 | 0.9409 |
| 1. PBF | A7IHH0 | Integration host factor subunit beta | 0.00e+00 | 1.78e-40 | 4.37e-11 | 0.9131 |
| 1. PBF | B7UMZ8 | Integration host factor subunit beta | 0.00e+00 | 1.97e-37 | 3.09e-12 | 0.9056 |
| 1. PBF | Q5P7Y1 | Integration host factor subunit alpha | 2.22e-16 | 7.88e-35 | 2.37e-10 | 0.9092 |
| 1. PBF | B4TRU3 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9067 |
| 1. PBF | Q57DX3 | Integration host factor subunit alpha | 4.77e-15 | 3.24e-29 | 8.85e-07 | 0.8808 |
| 1. PBF | Q2RXP8 | Integration host factor subunit beta | 0.00e+00 | 1.06e-28 | 1.20e-14 | 0.9296 |
| 1. PBF | Q5GXY6 | Integration host factor subunit alpha | 0.00e+00 | 3.56e-39 | 9.78e-13 | 0.9218 |
| 1. PBF | A3QEC3 | Integration host factor subunit beta | 0.00e+00 | 7.79e-33 | 2.60e-11 | 0.9138 |
| 1. PBF | Q2KA00 | Integration host factor subunit alpha | 2.02e-13 | 1.61e-24 | 2.92e-06 | 0.8383 |
| 1. PBF | Q57FM3 | Integration host factor subunit beta | 0.00e+00 | 8.33e-39 | 7.13e-11 | 0.922 |
| 1. PBF | B0TT46 | Integration host factor subunit beta | 0.00e+00 | 1.17e-33 | 4.10e-11 | 0.9139 |
| 1. PBF | Q39IF8 | Integration host factor subunit beta | 0.00e+00 | 6.30e-18 | 2.40e-11 | 0.9295 |
| 1. PBF | A5F6Y4 | Integration host factor subunit beta | 0.00e+00 | 9.63e-36 | 7.03e-12 | 0.9114 |
| 1. PBF | Q8PK78 | Integration host factor subunit beta | 0.00e+00 | 1.78e-24 | 1.25e-13 | 0.9246 |
| 1. PBF | B7KYG6 | Integration host factor subunit alpha | 5.55e-16 | 1.90e-24 | 1.38e-06 | 0.899 |
| 1. PBF | Q2IWQ7 | Integration host factor subunit alpha | 5.11e-15 | 9.04e-14 | 1.38e-07 | 0.9017 |
| 1. PBF | Q9ZDZ2 | DNA-binding protein HU | 1.11e-16 | 8.35e-27 | 4.50e-11 | 0.9219 |
| 1. PBF | Q44625 | DNA-binding protein HBbu | 3.68e-12 | 3.08e-25 | 7.74e-06 | 0.8543 |
| 1. PBF | A1B366 | Integration host factor subunit alpha | 2.09e-14 | 6.88e-42 | 1.04e-09 | 0.8661 |
| 1. PBF | Q8DA35 | Integration host factor subunit alpha | 1.11e-16 | 3.74e-43 | 1.25e-14 | 0.9123 |
| 1. PBF | Q11C35 | Integration host factor subunit beta | 0.00e+00 | 1.78e-37 | 3.12e-12 | 0.9301 |
| 1. PBF | Q1BY25 | Integration host factor subunit beta | 0.00e+00 | 1.48e-18 | 2.35e-11 | 0.9284 |
| 1. PBF | Q8ZDX2 | Integration host factor subunit alpha | 1.11e-16 | 3.01e-43 | 1.09e-14 | 0.9147 |
| 1. PBF | P0A3I2 | Integration host factor subunit beta | 5.55e-16 | 1.57e-26 | 3.91e-08 | 0.8966 |
| 1. PBF | Q4QKM2 | Integration host factor subunit alpha | 0.00e+00 | 2.91e-42 | 8.52e-13 | 0.9312 |
| 1. PBF | A3D3R8 | Integration host factor subunit alpha | 0.00e+00 | 1.15e-44 | 2.62e-12 | 0.9186 |
| 1. PBF | B0T0T0 | Integration host factor subunit alpha | 0.00e+00 | 5.66e-38 | 3.64e-07 | 0.927 |
| 1. PBF | A5VC87 | Integration host factor subunit alpha | 6.88e-15 | 6.53e-38 | 1.28e-10 | 0.8633 |
| 1. PBF | B5R8J9 | Integration host factor subunit beta | 1.11e-16 | 4.53e-37 | 3.30e-12 | 0.9052 |
| 1. PBF | Q0HUQ0 | Integration host factor subunit alpha | 0.00e+00 | 8.44e-45 | 1.25e-12 | 0.9187 |
| 1. PBF | Q6NDN9 | Integration host factor subunit beta | 0.00e+00 | 1.46e-20 | 1.81e-10 | 0.9118 |
| 1. PBF | A9KYZ2 | Integration host factor subunit alpha | 0.00e+00 | 1.15e-44 | 2.62e-12 | 0.9172 |
| 1. PBF | A9ADV3 | Integration host factor subunit beta | 0.00e+00 | 3.47e-18 | 3.99e-11 | 0.9376 |
| 1. PBF | Q9AKA7 | Histone-like DNA-binding protein | 1.11e-16 | 2.32e-37 | 2.23e-04 | 0.8957 |
| 1. PBF | A5W5D5 | Integration host factor subunit alpha | 0.00e+00 | 9.49e-42 | 1.88e-12 | 0.9213 |
| 1. PBF | Q7MK44 | Integration host factor subunit alpha | 0.00e+00 | 3.74e-43 | 1.25e-14 | 0.9151 |
| 1. PBF | A8H4A7 | Integration host factor subunit beta | 0.00e+00 | 1.73e-33 | 2.78e-11 | 0.9135 |
| 1. PBF | Q1GK81 | Integration host factor subunit beta | 0.00e+00 | 1.51e-37 | 2.16e-11 | 0.9269 |
| 1. PBF | B5XY84 | Integration host factor subunit beta | 0.00e+00 | 1.17e-36 | 7.80e-12 | 0.9076 |
| 1. PBF | B8F4T7 | Integration host factor subunit alpha | 2.22e-16 | 6.05e-41 | 5.55e-10 | 0.9088 |
| 1. PBF | Q9PE38 | DNA-binding protein HU | 0.00e+00 | 2.64e-43 | 1.63e-17 | 0.9411 |
| 1. PBF | Q02PW7 | Integration host factor subunit beta | 0.00e+00 | 1.32e-35 | 9.52e-14 | 0.9487 |
| 1. PBF | B4RB18 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-39 | 2.49e-08 | 0.9237 |
| 1. PBF | C5BBR9 | Integration host factor subunit beta | 1.11e-16 | 5.62e-39 | 1.35e-12 | 0.9041 |
| 1. PBF | Q608S8 | Integration host factor subunit beta | 0.00e+00 | 9.73e-31 | 2.06e-14 | 0.9315 |
| 1. PBF | A9IJJ1 | Integration host factor subunit beta | 1.11e-16 | 7.26e-06 | 5.28e-13 | 0.9126 |
| 1. PBF | Q4QJU8 | Integration host factor subunit beta | 0.00e+00 | 8.02e-38 | 4.62e-11 | 0.9281 |
| 1. PBF | P05514 | DNA-binding protein HU | 0.00e+00 | 6.45e-42 | 1.07e-12 | 0.9227 |
| 1. PBF | Q9CI64 | DNA-binding protein HU | 0.00e+00 | 6.02e-43 | 2.65e-16 | 0.9158 |
| 1. PBF | A1U2B7 | Integration host factor subunit alpha | 4.44e-16 | 1.35e-40 | 9.78e-12 | 0.9013 |
| 1. PBF | Q9KHS6 | DNA-binding protein HU-beta | 0.00e+00 | 6.78e-47 | 2.08e-13 | 0.9508 |
| 1. PBF | C0RGK7 | Integration host factor subunit beta | 0.00e+00 | 5.66e-40 | 1.00e-09 | 0.9225 |
| 1. PBF | A5IAL5 | Integration host factor subunit alpha | 0.00e+00 | 3.88e-41 | 3.31e-11 | 0.9138 |
| 1. PBF | B8CR59 | Integration host factor subunit alpha | 0.00e+00 | 2.28e-45 | 5.14e-13 | 0.9172 |
| 1. PBF | Q7VLG4 | Integration host factor subunit alpha | 1.11e-16 | 2.62e-36 | 2.69e-10 | 0.9148 |
| 1. PBF | Q0HJ83 | Integration host factor subunit alpha | 0.00e+00 | 8.44e-45 | 1.25e-12 | 0.9183 |
| 1. PBF | P0A0U0 | Integration host factor subunit alpha | 0.00e+00 | 3.56e-39 | 9.78e-13 | 0.933 |
| 1. PBF | Q65SH8 | Integration host factor subunit beta | 0.00e+00 | 1.18e-38 | 5.20e-11 | 0.9138 |
| 1. PBF | B9KU92 | Integration host factor subunit beta | 0.00e+00 | 1.75e-38 | 1.20e-10 | 0.9252 |
| 1. PBF | Q5XB35 | DNA-binding protein HU | 0.00e+00 | 2.83e-39 | 2.99e-15 | 0.9443 |
| 1. PBF | B8EMZ0 | Integration host factor subunit beta | 0.00e+00 | 2.77e-34 | 2.71e-10 | 0.9205 |
| 1. PBF | Q6F874 | Integration host factor subunit alpha | 0.00e+00 | 6.93e-37 | 4.90e-11 | 0.9336 |
| 1. PBF | C0Q640 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9178 |
| 1. PBF | A7ZMI0 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9194 |
| 1. PBF | Q9AKF3 | Histone-like DNA-binding protein | 0.00e+00 | 1.17e-31 | 0.003 | 0.9067 |
| 1. PBF | Q12NT8 | Integration host factor subunit alpha | 0.00e+00 | 1.28e-42 | 1.26e-12 | 0.9184 |
| 1. PBF | B7M841 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9122 |
| 1. PBF | B7L6I5 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9196 |
| 1. PBF | A4WTU0 | Integration host factor subunit alpha | 4.01e-13 | 3.35e-46 | 1.38e-10 | 0.8327 |
| 1. PBF | B1JRD6 | Integration host factor subunit beta | 0.00e+00 | 9.19e-37 | 4.28e-11 | 0.9069 |
| 1. PBF | B7MAS3 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9188 |
| 1. PBF | B5YQ00 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9183 |
| 1. PBF | A4Y6H0 | Integration host factor subunit alpha | 0.00e+00 | 1.15e-44 | 2.62e-12 | 0.9188 |
| 1. PBF | Q4KEV8 | Integration host factor subunit alpha | 2.22e-16 | 2.38e-41 | 2.81e-13 | 0.9059 |
| 1. PBF | Q982Z7 | Integration host factor subunit alpha | 1.59e-13 | 2.02e-28 | 5.17e-06 | 0.8367 |
| 1. PBF | B5BBP5 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9083 |
| 1. PBF | Q13EQ5 | Integration host factor subunit beta | 0.00e+00 | 7.76e-29 | 1.54e-10 | 0.9094 |
| 1. PBF | B2IKV6 | Integration host factor subunit beta | 0.00e+00 | 6.07e-33 | 1.06e-10 | 0.9118 |
| 1. PBF | C1DRR5 | Integration host factor subunit beta | 0.00e+00 | 2.83e-39 | 3.38e-13 | 0.9072 |
| 1. PBF | Q3JBZ6 | Integration host factor subunit alpha | 0.00e+00 | 4.13e-41 | 7.78e-13 | 0.9141 |
| 1. PBF | A0K5M4 | Integration host factor subunit beta | 0.00e+00 | 1.48e-18 | 2.35e-11 | 0.9318 |
| 1. PBF | Q1QVK5 | Integration host factor subunit beta | 0.00e+00 | 7.54e-32 | 8.02e-13 | 0.9423 |
| 1. PBF | B2U390 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9201 |
| 1. PBF | P64395 | Integration host factor subunit beta | 1.11e-16 | 4.53e-37 | 3.30e-12 | 0.9052 |
| 1. PBF | Q1RDU6 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9092 |
| 1. PBF | Q3BRU3 | Integration host factor subunit alpha | 0.00e+00 | 3.56e-39 | 9.78e-13 | 0.9197 |
| 1. PBF | A7MUP0 | Integration host factor subunit beta | 1.11e-16 | 3.30e-35 | 4.57e-12 | 0.9092 |
| 1. PBF | B0CLA3 | Integration host factor subunit alpha | 8.84e-14 | 1.42e-29 | 2.10e-07 | 0.8468 |
| 1. PBF | Q7W7C5 | Integration host factor subunit alpha | 5.55e-16 | 4.41e-24 | 1.84e-11 | 0.909 |
| 1. PBF | Q482G2 | Integration host factor subunit beta | 0.00e+00 | 2.13e-37 | 9.48e-13 | 0.9102 |
| 1. PBF | A4SLS6 | Integration host factor subunit beta | 1.11e-16 | 2.78e-37 | 9.56e-13 | 0.913 |
| 1. PBF | A4Y729 | Integration host factor subunit beta | 0.00e+00 | 2.45e-33 | 2.01e-11 | 0.9132 |
| 1. PBF | P0A3H2 | DNA-binding protein HU | 0.00e+00 | 3.18e-42 | 1.08e-20 | 0.9511 |
| 1. PBF | P52680 | DNA-binding protein HU-alpha | 0.00e+00 | 1.27e-47 | 1.06e-10 | 0.96 |
| 1. PBF | P0A3H5 | DNA-binding protein HU 1 | 0.00e+00 | 4.45e-35 | 7.42e-08 | 0.9045 |
| 1. PBF | Q8G304 | Integration host factor subunit beta | 0.00e+00 | 2.50e-39 | 5.49e-11 | 0.9221 |
| 1. PBF | B1KRE5 | Integration host factor subunit alpha | 0.00e+00 | 9.79e-46 | 5.47e-13 | 0.9415 |
| 1. PBF | P0A3H6 | DNA-binding protein HU 1 | 0.00e+00 | 4.45e-35 | 7.42e-08 | 0.9077 |
| 1. PBF | Q1CGG8 | Integration host factor subunit beta | 1.11e-16 | 9.19e-37 | 4.28e-11 | 0.9048 |
| 1. PBF | P0A128 | Integration host factor subunit beta | 0.00e+00 | 6.24e-29 | 2.05e-13 | 0.9365 |
| 1. PBF | B3GXH5 | Integration host factor subunit beta | 0.00e+00 | 2.86e-30 | 8.74e-11 | 0.924 |
| 1. PBF | B7VAL8 | Integration host factor subunit beta | 0.00e+00 | 1.32e-35 | 9.52e-14 | 0.9466 |
| 1. PBF | B0RRH5 | Integration host factor subunit alpha | 0.00e+00 | 3.56e-39 | 9.78e-13 | 0.9355 |
| 1. PBF | A1S700 | Integration host factor subunit alpha | 0.00e+00 | 8.87e-44 | 1.05e-12 | 0.9189 |
| 1. PBF | A1RK12 | Integration host factor subunit alpha | 0.00e+00 | 1.15e-44 | 2.62e-12 | 0.9165 |
| 1. PBF | Q92GN5 | Histone-like DNA-binding protein | 3.33e-16 | 7.43e-35 | 0.006 | 0.8988 |
| 1. PBF | Q8ZGB1 | Integration host factor subunit beta | 0.00e+00 | 9.19e-37 | 4.28e-11 | 0.9074 |
| 1. PBF | Q5WT88 | Integration host factor subunit alpha | 1.11e-16 | 3.88e-41 | 3.31e-11 | 0.9099 |
| 1. PBF | B4T4N4 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9177 |
| 1. PBF | A6W0A0 | Integration host factor subunit beta | 0.00e+00 | 2.30e-25 | 5.41e-14 | 0.9406 |
| 1. PBF | Q1CIH0 | Integration host factor subunit alpha | 0.00e+00 | 3.01e-43 | 1.09e-14 | 0.9168 |
| 1. PBF | B7LDA4 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9085 |
| 1. PBF | Q21KD4 | Integration host factor subunit alpha | 0.00e+00 | 2.00e-41 | 1.67e-13 | 0.9244 |
| 1. PBF | Q2Y7A9 | Integration host factor subunit beta | 0.00e+00 | 2.50e-39 | 1.01e-11 | 0.9089 |
| 1. PBF | Q2YNB8 | Integration host factor subunit alpha | 5.33e-15 | 3.24e-29 | 8.85e-07 | 0.8791 |
| 1. PBF | Q4UKH2 | DNA-binding protein HU | 4.67e-14 | 1.19e-27 | 3.75e-11 | 0.8837 |
| 1. PBF | Q885T0 | Integration host factor subunit beta | 0.00e+00 | 7.90e-30 | 1.77e-13 | 0.9373 |
| 1. PBF | B7VH32 | Integration host factor subunit beta | 0.00e+00 | 7.88e-35 | 7.13e-12 | 0.9152 |
| 1. PBF | A1JMJ0 | Integration host factor subunit beta | 0.00e+00 | 7.43e-36 | 1.56e-10 | 0.9094 |
| 1. PBF | Q87N46 | Integration host factor subunit beta | 0.00e+00 | 2.88e-35 | 4.27e-12 | 0.9159 |
| 1. PBF | B8H546 | Integration host factor subunit alpha | 0.00e+00 | 8.83e-37 | 7.72e-07 | 0.9203 |
| 1. PBF | A1KSZ1 | Integration host factor subunit alpha | 9.99e-16 | 3.92e-36 | 6.08e-13 | 0.8955 |
| 1. PBF | B0U5D7 | Integration host factor subunit alpha | 1.11e-16 | 5.32e-40 | 5.74e-12 | 0.912 |
| 1. PBF | Q6N676 | Integration host factor subunit alpha | 7.77e-16 | 1.34e-15 | 1.57e-07 | 0.9112 |
| 1. PBF | P19436 | DNA-binding protein HU | 0.00e+00 | 1.21e-31 | 4.91e-15 | 0.9482 |
| 1. PBF | Q89B22 | DNA-binding protein HU | 0.00e+00 | 2.55e-45 | 1.02e-11 | 0.94 |
| 1. PBF | B2JF07 | Integration host factor subunit beta | 0.00e+00 | 1.89e-16 | 1.16e-13 | 0.9235 |
| 1. PBF | Q31F20 | Integration host factor subunit alpha | 1.11e-16 | 4.79e-41 | 3.18e-12 | 0.912 |
| 1. PBF | B5FG57 | Integration host factor subunit beta | 0.00e+00 | 5.32e-38 | 2.11e-11 | 0.9158 |
| 1. PBF | A9IL25 | Integration host factor subunit beta | 0.00e+00 | 6.73e-41 | 2.78e-13 | 0.936 |
| 1. PBF | B6J7X5 | Integration host factor subunit alpha | 1.11e-16 | 2.25e-28 | 1.34e-10 | 0.9159 |
| 1. PBF | Q6FZZ9 | Integration host factor subunit alpha | 2.63e-14 | 7.08e-34 | 2.99e-04 | 0.8652 |
| 1. PBF | P43722 | DNA-binding protein HU | 0.00e+00 | 8.44e-45 | 7.55e-12 | 0.9621 |
| 1. PBF | P95519 | Integration host factor subunit beta | 0.00e+00 | 3.99e-38 | 8.46e-11 | 0.9065 |
| 1. PBF | Q45231 | DNA-binding protein HBbu | 4.22e-12 | 3.85e-25 | 8.98e-06 | 0.8533 |
| 1. PBF | Q0ATJ4 | Integration host factor subunit beta | 1.11e-16 | 1.87e-26 | 1.13e-12 | 0.9016 |
| 1. PBF | Q87Q56 | Integration host factor subunit alpha | 0.00e+00 | 6.45e-42 | 5.51e-15 | 0.9172 |
| 1. PBF | Q6G990 | DNA-binding protein HU | 0.00e+00 | 6.89e-50 | 5.14e-17 | 0.9493 |
| 1. PBF | Q13VC5 | Integration host factor subunit beta | 0.00e+00 | 1.73e-15 | 1.57e-13 | 0.9267 |
| 1. PBF | A6T1G0 | Integration host factor subunit beta | 0.00e+00 | 9.63e-28 | 9.90e-15 | 0.9313 |
| 1. PBF | Q9K7K5 | DNA-binding protein HU-1 | 0.00e+00 | 3.27e-52 | 1.39e-20 | 0.9577 |
| 1. PBF | Q65TL4 | Integration host factor subunit alpha | 1.11e-16 | 2.77e-39 | 4.08e-14 | 0.9137 |
| 1. PBF | Q15T07 | Integration host factor subunit beta | 0.00e+00 | 7.22e-34 | 6.22e-12 | 0.9211 |
| 1. PBF | B7N550 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9193 |
| 1. PBF | B2FN73 | Integration host factor subunit alpha | 0.00e+00 | 6.99e-40 | 6.68e-13 | 0.9328 |
| 1. PBF | P43723 | Integration host factor subunit alpha | 0.00e+00 | 2.91e-42 | 8.52e-13 | 0.9309 |
| 1. PBF | Q66CI5 | Integration host factor subunit beta | 0.00e+00 | 9.19e-37 | 4.28e-11 | 0.9075 |
| 1. PBF | A9MAF7 | Integration host factor subunit alpha | 7.55e-15 | 3.24e-29 | 8.85e-07 | 0.875 |
| 1. PBF | B4ET28 | Integration host factor subunit beta | 0.00e+00 | 1.15e-36 | 4.81e-14 | 0.8987 |
| 1. PBF | Q9X4E2 | Integration host factor subunit beta | 0.00e+00 | 4.57e-39 | 1.15e-10 | 0.9179 |
| 1. PBF | P29214 | DNA-binding protein HU homolog | 0.00e+00 | 5.80e-41 | 6.52e-15 | 0.9361 |
| 1. PBF | A7FJW6 | Integration host factor subunit beta | 1.11e-16 | 9.19e-37 | 4.28e-11 | 0.9059 |
| 1. PBF | B6I8Y4 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9102 |
| 1. PBF | P73418 | DNA-binding protein HU | 0.00e+00 | 2.49e-40 | 6.62e-12 | 0.9263 |
| 1. PBF | Q9PQK9 | DNA-binding protein HU | 1.26e-12 | 4.08e-05 | 7.55e-08 | 0.863 |
| 1. PBF | B7LQ77 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9182 |
| 1. PBF | A3MHP1 | Integration host factor subunit beta | 0.00e+00 | 5.78e-19 | 1.14e-11 | 0.9412 |
| 1. PBF | C3LNL8 | Integration host factor subunit beta | 0.00e+00 | 9.63e-36 | 7.03e-12 | 0.9154 |
| 1. PBF | C3JZN1 | Integration host factor subunit alpha | 0.00e+00 | 2.38e-41 | 2.81e-13 | 0.9218 |
| 1. PBF | A1V6M0 | Integration host factor subunit beta | 0.00e+00 | 5.78e-19 | 1.14e-11 | 0.9387 |
| 1. PBF | B1XG19 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9193 |
| 1. PBF | Q9K4Q3 | Integration host factor subunit alpha | 7.77e-15 | 2.52e-03 | 1.51e-12 | 0.9029 |
| 1. PBF | B5FQ55 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9066 |
| 1. PBF | Q8EEI1 | Integration host factor subunit beta | 0.00e+00 | 7.21e-33 | 2.75e-11 | 0.9092 |
| 1. PBF | Q32E32 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9074 |
| 1. PBF | Q0BH90 | Integration host factor subunit beta | 0.00e+00 | 8.07e-19 | 7.22e-12 | 0.9341 |
| 1. PBF | Q9KSN4 | Integration host factor subunit alpha | 1.11e-16 | 9.68e-44 | 9.49e-15 | 0.9147 |
| 1. PBF | B1IPL5 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9194 |
| 1. PBF | B8E7F3 | Integration host factor subunit alpha | 0.00e+00 | 1.15e-44 | 2.62e-12 | 0.9212 |
| 1. PBF | B2VEL2 | Integration host factor subunit alpha | 1.11e-16 | 3.42e-40 | 1.35e-14 | 0.9152 |
| 1. PBF | Q6D4H4 | Integration host factor subunit alpha | 0.00e+00 | 1.13e-43 | 1.32e-14 | 0.917 |
| 1. PBF | B2K662 | Integration host factor subunit alpha | 0.00e+00 | 3.01e-43 | 1.09e-14 | 0.9164 |
| 1. PBF | A5W7F5 | Integration host factor subunit beta | 0.00e+00 | 6.10e-30 | 2.15e-13 | 0.9435 |
| 1. PBF | A1SUQ7 | Integration host factor subunit alpha | 0.00e+00 | 5.01e-35 | 2.49e-12 | 0.9466 |
| 1. PBF | P0A3H0 | DNA-binding protein HU | 0.00e+00 | 3.18e-42 | 1.08e-20 | 0.9516 |
| 1. PBF | Q60AY8 | Integration host factor subunit alpha | 0.00e+00 | 1.80e-17 | 3.66e-14 | 0.9388 |
| 1. PBF | Q9CK94 | DNA-binding protein HU | 0.00e+00 | 4.80e-44 | 3.30e-10 | 0.948 |
| 1. PBF | Q1ID97 | Integration host factor subunit beta | 0.00e+00 | 1.27e-29 | 2.13e-13 | 0.9343 |
| 1. PBF | Q9XB22 | DNA-binding protein HU | 0.00e+00 | 1.92e-41 | 5.30e-14 | 0.9396 |
| 1. PBF | B6EIY1 | Integration host factor subunit beta | 0.00e+00 | 3.06e-38 | 3.96e-11 | 0.9152 |
| 1. PBF | P0A6X8 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9204 |
| 1. PBF | C4ZYH4 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9183 |
| 1. PBF | Q7N6D2 | Integration host factor subunit beta | 0.00e+00 | 3.53e-38 | 3.55e-13 | 0.907 |
| 1. PBF | A8AHA5 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9184 |
| 1. PBF | Q8YET3 | Integration host factor subunit beta | 0.00e+00 | 5.66e-40 | 1.00e-09 | 0.9268 |
| 1. PBF | A6VYH5 | Integration host factor subunit alpha | 7.77e-16 | 1.53e-42 | 1.69e-14 | 0.8974 |
| 1. PBF | B4T146 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9054 |
| 1. PBF | C0RIB4 | Integration host factor subunit alpha | 1.42e-13 | 3.24e-29 | 8.85e-07 | 0.8441 |
| 1. PBF | A9MFB7 | Integration host factor subunit alpha | 1.11e-16 | 3.80e-40 | 6.23e-15 | 0.9151 |
| 1. PBF | A8GDR1 | Integration host factor subunit alpha | 1.11e-16 | 5.64e-43 | 1.07e-14 | 0.9146 |
| 1. PBF | A3D4A9 | Integration host factor subunit beta | 0.00e+00 | 2.23e-32 | 2.84e-11 | 0.9094 |
| 1. PBF | A1S6D6 | Integration host factor subunit beta | 0.00e+00 | 1.40e-33 | 9.80e-12 | 0.9098 |
| 1. PBF | Q5E3Z3 | Integration host factor subunit beta | 0.00e+00 | 5.32e-38 | 2.11e-11 | 0.9162 |
| 1. PBF | Q4UW51 | Integration host factor subunit alpha | 0.00e+00 | 3.56e-39 | 9.78e-13 | 0.9201 |
| 1. PBF | C4LFG7 | Integration host factor subunit alpha | 1.11e-16 | 4.79e-26 | 5.41e-14 | 0.9196 |
| 1. PBF | A5EXT4 | Integration host factor subunit alpha | 0.00e+00 | 4.80e-44 | 1.52e-13 | 0.9184 |
| 1. PBF | A3PPV4 | Integration host factor subunit beta | 0.00e+00 | 1.75e-38 | 1.20e-10 | 0.9139 |
| 1. PBF | B6I8Q5 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9158 |
| 1. PBF | B7MS27 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9088 |
| 1. PBF | Q2YP18 | Integration host factor subunit beta | 0.00e+00 | 8.33e-39 | 7.13e-11 | 0.922 |
| 1. PBF | B1LZ99 | Integration host factor subunit alpha | 7.77e-16 | 1.82e-28 | 1.34e-07 | 0.8933 |
| 1. PBF | A9C3C8 | Integration host factor subunit alpha | 0.00e+00 | 1.13e-27 | 3.03e-13 | 0.9583 |
| 1. PBF | A4G858 | Integration host factor subunit beta | 0.00e+00 | 9.63e-28 | 9.90e-15 | 0.9316 |
| 1. PBF | Q8UIF9 | Integration host factor subunit beta | 0.00e+00 | 1.84e-24 | 1.20e-11 | 0.9286 |
| 1. PBF | B1X852 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9079 |
| 1. PBF | O67461 | DNA-binding protein HU | 1.67e-15 | 2.35e-26 | 1.79e-10 | 0.8396 |
| 1. PBF | B1YV36 | Integration host factor subunit beta | 0.00e+00 | 8.07e-19 | 7.22e-12 | 0.9249 |
| 1. PBF | B0UUH4 | Integration host factor subunit beta | 1.11e-16 | 1.38e-40 | 1.67e-14 | 0.9006 |
| 1. PBF | P28080 | DNA-binding protein HU-alpha | 0.00e+00 | 5.54e-45 | 2.39e-11 | 0.9565 |
| 1. PBF | A7MVH4 | Integration host factor subunit alpha | 0.00e+00 | 1.03e-41 | 5.69e-15 | 0.9177 |
| 1. PBF | B2HTI2 | Integration host factor subunit alpha | 2.22e-16 | 1.57e-37 | 2.92e-11 | 0.9052 |
| 1. PBF | B0BP19 | Integration host factor subunit beta | 0.00e+00 | 2.86e-30 | 8.74e-11 | 0.9242 |
| 1. PBF | Q8XZ23 | Integration host factor subunit alpha | 0.00e+00 | 4.19e-32 | 5.34e-10 | 0.9282 |
| 1. PBF | B0KKR2 | Integration host factor subunit alpha | 2.22e-16 | 9.49e-42 | 1.88e-12 | 0.9065 |
| 1. PBF | Q12BQ7 | Integration host factor subunit alpha | 0.00e+00 | 1.47e-25 | 1.28e-13 | 0.9603 |
| 1. PBF | P0C0H3 | DNA-binding protein HU | 0.00e+00 | 2.83e-39 | 2.99e-15 | 0.9438 |
| 1. PBF | A6VP80 | Integration host factor subunit alpha | 0.00e+00 | 4.78e-42 | 2.94e-14 | 0.917 |
| 1. PBF | Q9Z8C7 | Probable DNA-binding protein HU | 2.29e-14 | 7.43e-35 | 1.07e-06 | 0.861 |
| 1. PBF | Q161H6 | Integration host factor subunit beta | 0.00e+00 | 2.77e-39 | 1.59e-11 | 0.9257 |
| 1. PBF | P0DB65 | DNA-binding protein HU | 0.00e+00 | 2.83e-39 | 2.99e-15 | 0.9431 |
| 1. PBF | B2VC76 | Integration host factor subunit beta | 0.00e+00 | 2.36e-37 | 1.98e-11 | 0.9114 |
| 1. PBF | A7INL3 | Integration host factor subunit alpha | 0.00e+00 | 4.37e-33 | 1.11e-10 | 0.9225 |
| 1. PBF | A3PJ63 | Integration host factor subunit alpha | 8.87e-14 | 3.35e-46 | 1.38e-10 | 0.8531 |
| 1. PBF | P0A3I1 | Integration host factor subunit beta | 0.00e+00 | 1.57e-26 | 3.91e-08 | 0.9177 |
| 1. PBF | P0A3H3 | DNA-binding protein HRL18 | 0.00e+00 | 3.33e-49 | 1.48e-12 | 0.9445 |
| 1. PBF | Q9RNZ5 | Integration host factor subunit alpha | 4.77e-15 | 3.28e-40 | 4.51e-08 | 0.8773 |
| 1. PBF | Q82VV7 | Integration host factor subunit alpha | 0.00e+00 | 1.54e-28 | 1.05e-10 | 0.9185 |
| 1. PBF | A5EWQ2 | Integration host factor subunit beta | 0.00e+00 | 7.24e-38 | 2.69e-13 | 0.9523 |
| 1. PBF | A3QF32 | Integration host factor subunit alpha | 0.00e+00 | 1.03e-44 | 2.80e-13 | 0.9186 |
| 1. PBF | B9JCZ0 | Integration host factor subunit alpha | 2.22e-12 | 2.01e-23 | 3.54e-06 | 0.8076 |
| 1. PBF | B9JV88 | Integration host factor subunit alpha | 2.24e-13 | 3.02e-22 | 2.19e-05 | 0.8402 |
| 1. PBF | P95516 | Integration host factor subunit alpha | 0.00e+00 | 3.92e-36 | 1.13e-09 | 0.927 |
| 1. PBF | Q48FN3 | Integration host factor subunit beta | 0.00e+00 | 2.10e-28 | 3.63e-13 | 0.9417 |
| 1. PBF | A4TIL7 | Integration host factor subunit alpha | 0.00e+00 | 3.01e-43 | 1.09e-14 | 0.9162 |
| 1. PBF | B9J885 | Integration host factor subunit beta | 0.00e+00 | 4.76e-23 | 3.93e-11 | 0.926 |
| 1. PBF | A1K4D5 | Integration host factor subunit beta | 0.00e+00 | 4.90e-38 | 1.14e-11 | 0.9137 |
| 1. PBF | Q0THB6 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9198 |
| 1. PBF | A1SYZ9 | Integration host factor subunit beta | 0.00e+00 | 1.02e-33 | 2.33e-10 | 0.9256 |
| 1. PBF | Q87E48 | DNA-binding protein HU | 0.00e+00 | 2.55e-45 | 3.56e-19 | 0.9283 |
| 1. PBF | Q1QMY9 | Integration host factor subunit alpha | 2.22e-16 | 2.26e-25 | 2.77e-07 | 0.9067 |
| 1. PBF | A5UF06 | Integration host factor subunit alpha | 0.00e+00 | 3.61e-42 | 2.47e-12 | 0.924 |
| 1. PBF | B4ETL2 | Integration host factor subunit alpha | 0.00e+00 | 5.24e-44 | 4.89e-15 | 0.9163 |
| 1. PBF | Q8EF98 | Integration host factor subunit alpha | 0.00e+00 | 1.15e-44 | 1.20e-12 | 0.9161 |
| 1. PBF | Q9PAQ8 | Integration host factor subunit beta | 0.00e+00 | 1.55e-24 | 2.11e-12 | 0.9293 |
| 1. PBF | Q321K4 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9198 |
| 1. PBF | A0KKP3 | Integration host factor subunit alpha | 1.11e-16 | 1.34e-43 | 4.85e-14 | 0.9149 |
| 1. PBF | P57231 | Integration host factor subunit alpha | 0.00e+00 | 1.34e-26 | 7.95e-07 | 0.9475 |
| 1. PBF | C0PXU8 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9099 |
| 1. PBF | A4W9M9 | Integration host factor subunit alpha | 0.00e+00 | 6.87e-41 | 6.16e-15 | 0.9163 |
| 1. PBF | C3K6K2 | Integration host factor subunit beta | 0.00e+00 | 2.25e-30 | 1.71e-13 | 0.9373 |
| 1. PBF | B6IZG2 | Integration host factor subunit alpha | 0.00e+00 | 2.25e-28 | 1.34e-10 | 0.9387 |
| 1. PBF | A3NXW8 | Integration host factor subunit beta | 0.00e+00 | 5.78e-19 | 1.14e-11 | 0.9399 |
| 1. PBF | Q2P101 | Integration host factor subunit alpha | 0.00e+00 | 3.56e-39 | 9.78e-13 | 0.9202 |
| 1. PBF | Q7N3Q2 | Integration host factor subunit alpha | 0.00e+00 | 4.64e-43 | 6.01e-15 | 0.9159 |
| 1. PBF | A1WU59 | Integration host factor subunit alpha | 0.00e+00 | 1.20e-36 | 2.57e-11 | 0.9184 |
| 1. PBF | Q7A5J1 | DNA-binding protein HU | 0.00e+00 | 6.89e-50 | 5.14e-17 | 0.9488 |
| 1. PBF | C4ZQ38 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9108 |
| 1. PBF | Q4UN06 | Histone-like DNA-binding protein | 0.00e+00 | 5.84e-33 | 5.75e-04 | 0.9333 |
| 1. PBF | Q1C735 | Integration host factor subunit alpha | 1.11e-16 | 3.01e-43 | 1.09e-14 | 0.9151 |
| 1. PBF | C3LLR8 | Integration host factor subunit alpha | 1.11e-16 | 9.68e-44 | 9.49e-15 | 0.913 |
| 1. PBF | A1B8K9 | Integration host factor subunit beta | 0.00e+00 | 4.61e-38 | 7.55e-12 | 0.9077 |
| 1. PBF | A9N8J9 | Integration host factor subunit alpha | 1.11e-16 | 2.25e-28 | 1.34e-10 | 0.9152 |
| 1. PBF | I1WEI8 | DNA-binding protein HU-alpha | 0.00e+00 | 1.15e-41 | 2.99e-14 | 0.9527 |
| 1. PBF | A8FVN3 | Integration host factor subunit beta | 0.00e+00 | 1.82e-35 | 3.16e-11 | 0.9288 |
| 1. PBF | Q8P8P6 | Integration host factor subunit beta | 0.00e+00 | 2.10e-24 | 1.11e-13 | 0.9229 |
| 1. PBF | Q87BJ8 | Integration host factor subunit beta | 0.00e+00 | 1.14e-23 | 3.75e-12 | 0.9421 |
| 1. PBF | Q1Q8C9 | Integration host factor subunit alpha | 0.00e+00 | 1.95e-32 | 6.56e-17 | 0.9394 |
| 1. PBF | Q44654 | Integration host factor subunit beta | 0.00e+00 | 4.13e-40 | 1.59e-11 | 0.9186 |
| 1. PBF | Q9A2H5 | Integration host factor subunit beta | 1.11e-16 | 1.45e-34 | 4.18e-10 | 0.8973 |
| 1. PBF | P64386 | Probable DNA-binding protein HU | 2.99e-14 | 1.30e-35 | 8.23e-07 | 0.8578 |
| 1. PBF | Q3Z3K9 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.909 |
| 1. PBF | Q92J57 | DNA-binding protein HU | 2.55e-15 | 3.41e-28 | 2.90e-10 | 0.9021 |
| 1. PBF | C5B852 | Integration host factor subunit alpha | 1.11e-16 | 1.63e-42 | 5.33e-15 | 0.9147 |
| 1. PBF | C4LF00 | Integration host factor subunit beta | 0.00e+00 | 4.62e-37 | 1.78e-13 | 0.9214 |
| 1. PBF | A8LLT5 | Integration host factor subunit alpha | 2.18e-13 | 2.17e-43 | 1.15e-09 | 0.8417 |
| 1. PBF | Q48JR7 | Integration host factor subunit alpha | 2.22e-16 | 2.38e-41 | 2.81e-13 | 0.9061 |
| 1. PBF | Q1RK52 | Histone-like DNA-binding protein | 1.11e-16 | 3.11e-35 | 0.002 | 0.8926 |
| 1. PBF | Q11J82 | Integration host factor subunit alpha | 5.68e-13 | 2.41e-24 | 6.49e-08 | 0.8215 |
| 1. PBF | A4XTF3 | Integration host factor subunit beta | 0.00e+00 | 1.40e-33 | 2.26e-13 | 0.938 |
| 1. PBF | Q3K8V7 | Integration host factor subunit beta | 0.00e+00 | 1.08e-29 | 1.75e-13 | 0.9309 |
| 1. PBF | Q1IC09 | Integration host factor subunit alpha | 2.22e-16 | 9.69e-42 | 2.72e-13 | 0.9051 |
| 1. PBF | Q8D8J3 | Integration host factor subunit beta | 0.00e+00 | 2.60e-35 | 8.38e-12 | 0.9143 |
| 1. PBF | B7M1C1 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9196 |
| 1. PBF | Q2SY23 | Integration host factor subunit beta | 0.00e+00 | 5.04e-18 | 1.20e-11 | 0.9263 |
| 1. PBF | Q5LQJ4 | Integration host factor subunit alpha | 9.63e-14 | 2.13e-45 | 1.97e-10 | 0.8538 |
| 1. PBF | Q1RB83 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9183 |
| 1. PBF | A1TZF1 | Integration host factor subunit beta | 0.00e+00 | 1.29e-30 | 1.53e-16 | 0.9367 |
| 1. PBF | Q6G3K3 | Integration host factor subunit alpha | 1.02e-14 | 3.08e-25 | 3.00e-04 | 0.8743 |
| 1. PBF | B5QZB6 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9076 |
| 1. PBF | Q9CN18 | Integration host factor subunit alpha | 0.00e+00 | 1.62e-35 | 2.37e-14 | 0.9179 |
| 1. PBF | Q2W4R6 | Integration host factor subunit alpha | 2.11e-15 | 7.54e-32 | 1.53e-07 | 0.8935 |
| 1. PBF | P64390 | Integration host factor subunit alpha | 8.74e-14 | 3.24e-29 | 8.85e-07 | 0.8432 |
| 1. PBF | B5F7F6 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9176 |
| 1. PBF | A9KGB5 | Integration host factor subunit alpha | 0.00e+00 | 2.25e-28 | 1.34e-10 | 0.9166 |
| 1. PBF | B1LE18 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9207 |
| 1. PBF | Q0I3K4 | Integration host factor subunit alpha | 6.66e-16 | 3.87e-39 | 1.01e-13 | 0.8951 |
| 1. PBF | B4SQG8 | Integration host factor subunit alpha | 0.00e+00 | 6.99e-40 | 6.68e-13 | 0.9183 |
| 1. PBF | P05385 | DNA-binding protein HU | 0.00e+00 | 3.77e-47 | 5.44e-13 | 0.9319 |
| 1. PBF | A1USJ0 | Integration host factor subunit alpha | 1.33e-15 | 2.40e-33 | 1.06e-06 | 0.8929 |
| 1. PBF | Q9KDA5 | DNA-binding protein HU-1 | 0.00e+00 | 1.28e-41 | 1.58e-21 | 0.9404 |
| 1. PBF | Q57PU7 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9185 |
| 1. PBF | B5ZN05 | Integration host factor subunit beta | 0.00e+00 | 1.84e-25 | 3.12e-11 | 0.9256 |
| 1. PBF | A7MNY7 | Integration host factor subunit alpha | 0.00e+00 | 1.10e-40 | 5.71e-15 | 0.9171 |
| 1. PBF | A9L2X4 | Integration host factor subunit beta | 0.00e+00 | 2.23e-32 | 2.84e-11 | 0.912 |
| 1. PBF | Q2J2G1 | Integration host factor subunit beta | 0.00e+00 | 9.13e-28 | 1.55e-10 | 0.9209 |
| 1. PBF | B1JXS2 | Integration host factor subunit beta | 0.00e+00 | 1.48e-18 | 2.35e-11 | 0.9291 |
| 1. PBF | B7LN74 | Integration host factor subunit beta | 0.00e+00 | 2.27e-37 | 6.76e-12 | 0.91 |
| 1. PBF | B2I9P2 | Integration host factor subunit alpha | 0.00e+00 | 5.32e-40 | 5.74e-12 | 0.9353 |
| 1. PBF | B1J6V0 | Integration host factor subunit alpha | 2.22e-16 | 9.49e-42 | 1.88e-12 | 0.9057 |
| 1. PBF | Q3Z260 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.92 |
| 1. PBF | A3M2B0 | Integration host factor subunit alpha | 2.22e-16 | 1.57e-37 | 2.92e-11 | 0.9075 |
| 1. PBF | P0DB64 | DNA-binding protein HU | 0.00e+00 | 2.83e-39 | 2.99e-15 | 0.9458 |
| 1. PBF | A9N236 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9175 |
| 1. PBF | A7FHG7 | Integration host factor subunit alpha | 1.11e-16 | 3.01e-43 | 1.09e-14 | 0.9153 |
| 1. PBF | Q9XB21 | DNA-binding protein HU | 0.00e+00 | 5.66e-40 | 4.53e-16 | 0.9411 |
| 1. PBF | B5RAW7 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9176 |
| 1. PBF | B8D736 | Integration host factor subunit alpha | 0.00e+00 | 1.34e-26 | 7.95e-07 | 0.9449 |
| 1. PBF | Q1D6D8 | Integration host factor subunit alpha | 6.99e-15 | 2.52e-03 | 1.51e-12 | 0.904 |
| 1. PBF | A6U5F1 | Integration host factor subunit beta | 0.00e+00 | 3.92e-22 | 3.13e-11 | 0.9243 |
| 1. PBF | A3MZX6 | Integration host factor subunit alpha | 1.11e-16 | 8.02e-38 | 2.12e-10 | 0.9091 |
| 1. PBF | Q1GI70 | Integration host factor subunit alpha | 4.11e-15 | 4.50e-44 | 1.29e-10 | 0.8797 |
| 1. PBF | Q47CN0 | Integration host factor subunit alpha 2 | 0.00e+00 | 1.18e-35 | 2.32e-09 | 0.9218 |
| 1. PBF | A5EKG4 | Integration host factor subunit alpha | 2.89e-15 | 5.83e-16 | 3.53e-07 | 0.9019 |
| 1. PBF | P37982 | Integration host factor subunit alpha | 1.11e-16 | 5.22e-41 | 1.39e-14 | 0.9157 |
| 1. PBF | Q02NN5 | Integration host factor subunit alpha | 3.33e-16 | 2.38e-41 | 3.53e-12 | 0.9047 |
| 1. PBF | A9H0B5 | Integration host factor subunit beta | 0.00e+00 | 2.37e-34 | 1.83e-12 | 0.9169 |
| 1. PBF | A2S4R7 | Integration host factor subunit beta | 0.00e+00 | 5.78e-19 | 1.14e-11 | 0.9396 |
| 1. PBF | A8FWI0 | Integration host factor subunit alpha | 0.00e+00 | 2.28e-45 | 5.14e-13 | 0.9148 |
| 1. PBF | B5BA36 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9183 |
| 1. PBF | A4W8T1 | Integration host factor subunit beta | 0.00e+00 | 8.48e-37 | 6.55e-12 | 0.9096 |
| 1. PBF | A6T704 | Integration host factor subunit beta | 0.00e+00 | 1.13e-37 | 7.23e-12 | 0.9079 |
| 1. PBF | Q083K5 | Integration host factor subunit alpha | 0.00e+00 | 5.29e-43 | 7.37e-13 | 0.9183 |
| 1. PBF | A6U7Q6 | Integration host factor subunit alpha | 5.96e-12 | 9.83e-25 | 1.30e-06 | 0.7861 |
| 1. PBF | C5BSK5 | Integration host factor subunit beta | 1.11e-16 | 4.27e-32 | 3.96e-13 | 0.9049 |
| 1. PBF | A1KUD0 | Integration host factor subunit beta | 0.00e+00 | 8.36e-35 | 2.62e-12 | 0.9059 |
| 1. PBF | Q7VVR6 | Integration host factor subunit alpha | 6.66e-16 | 1.22e-25 | 1.88e-11 | 0.9061 |
| 1. PBF | P23302 | Integration host factor subunit alpha | 0.00e+00 | 4.13e-41 | 1.05e-14 | 0.9159 |
| 1. PBF | Q21IT4 | Integration host factor subunit beta | 0.00e+00 | 2.32e-34 | 2.08e-14 | 0.9176 |
| 1. PBF | B2KA26 | Integration host factor subunit beta | 0.00e+00 | 9.19e-37 | 4.28e-11 | 0.9082 |
| 1. PBF | B3PVE1 | Integration host factor subunit alpha | 2.73e-13 | 6.31e-25 | 3.15e-06 | 0.8378 |
| 1. PBF | P0A6Y0 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.921 |
| 1. PBF | B8GRI6 | Integration host factor subunit alpha | 0.00e+00 | 2.34e-40 | 1.38e-12 | 0.9167 |
| 1. PBF | P0ACF5 | DNA-binding protein HU-beta | 0.00e+00 | 4.94e-47 | 1.63e-17 | 0.9418 |
| 1. PBF | A7HBJ3 | Integration host factor subunit alpha | 0.00e+00 | 1.52e-32 | 1.47e-16 | 0.9209 |
| 1. PBF | Q0SX03 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9093 |
| 1. PBF | P0A6Y2 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9099 |
| 1. PBF | P0A0U3 | Integration host factor subunit beta | 0.00e+00 | 8.36e-35 | 2.62e-12 | 0.9032 |
| 1. PBF | P0A3H1 | DNA-binding protein HU | 0.00e+00 | 3.18e-42 | 1.08e-20 | 0.9522 |
| 1. PBF | P0ACF1 | DNA-binding protein HU-alpha | 0.00e+00 | 1.52e-47 | 6.14e-11 | 0.9546 |
| 1. PBF | P23303 | Integration host factor subunit beta | 0.00e+00 | 5.66e-37 | 1.10e-11 | 0.9079 |
| 1. PBF | B0UU60 | Integration host factor subunit alpha | 7.77e-16 | 3.87e-39 | 1.01e-13 | 0.8937 |
| 1. PBF | Q0AIZ2 | Integration host factor subunit beta | 1.11e-16 | 5.00e-23 | 8.56e-12 | 0.9054 |
| 1. PBF | Q0HV14 | Integration host factor subunit beta | 0.00e+00 | 7.21e-33 | 2.75e-11 | 0.9117 |
| 1. PBF | B4TUF6 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9175 |
| 1. PBF | Q99U17 | DNA-binding protein HU | 0.00e+00 | 6.89e-50 | 5.14e-17 | 0.9464 |
| 1. PBF | Q4FQ67 | Integration host factor subunit alpha | 0.00e+00 | 4.43e-32 | 5.51e-17 | 0.9348 |
| 1. PBF | P0A0T9 | Integration host factor subunit alpha | 0.00e+00 | 3.56e-39 | 9.78e-13 | 0.9191 |
| 1. PBF | Q0T4S2 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9187 |
| 1. PBF | B1LJV1 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9098 |
| 1. PBF | A1VR71 | Integration host factor subunit alpha | 0.00e+00 | 2.88e-14 | 1.61e-13 | 0.9631 |
| 1. PBF | Q3KEX6 | Integration host factor subunit alpha | 0.00e+00 | 2.38e-41 | 2.81e-13 | 0.9183 |
| 1. PBF | A8H5F1 | Integration host factor subunit alpha | 0.00e+00 | 2.28e-45 | 5.14e-13 | 0.916 |
| 1. PBF | B2S525 | Integration host factor subunit alpha | 1.22e-15 | 3.24e-29 | 8.85e-07 | 0.8876 |
| 1. PBF | A4VMF7 | Integration host factor subunit beta | 0.00e+00 | 8.37e-36 | 4.40e-13 | 0.946 |
| 1. PBF | A3N0A3 | Integration host factor subunit beta | 0.00e+00 | 2.86e-30 | 8.74e-11 | 0.9235 |
| 1. PBF | Q2P3S1 | Integration host factor subunit beta | 0.00e+00 | 1.50e-24 | 1.06e-13 | 0.9244 |
| 1. PBF | Q57267 | DNA-binding protein HU | 4.31e-12 | 4.89e-25 | 7.65e-06 | 0.853 |
| 1. PBF | Q057Y8 | Integration host factor subunit alpha | 2.22e-16 | 6.21e-26 | 3.85e-11 | 0.9083 |
| 1. PBF | P08821 | DNA-binding protein HU 1 | 0.00e+00 | 5.17e-43 | 3.48e-20 | 0.9462 |
| 1. PBF | A8LSF5 | Integration host factor subunit beta | 0.00e+00 | 1.85e-37 | 1.04e-12 | 0.9256 |
| 1. PBF | A7ZK01 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9077 |
| 1. PBF | B7V312 | Integration host factor subunit alpha | 3.33e-16 | 5.22e-41 | 2.84e-12 | 0.9052 |
| 1. PBF | Q2YBS0 | Integration host factor subunit alpha | 0.00e+00 | 1.99e-28 | 2.06e-09 | 0.9229 |
| 1. PBF | B7MVJ1 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9184 |
| 1. PBF | C6DF68 | Integration host factor subunit beta | 0.00e+00 | 1.30e-35 | 3.23e-11 | 0.9078 |
| 1. PBF | Q8KA69 | DNA-binding protein HU | 0.00e+00 | 1.99e-52 | 1.03e-14 | 0.9639 |
| 1. PBF | B4TD42 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9095 |
| 1. PBF | Q0BQI4 | Integration host factor subunit beta | 0.00e+00 | 6.43e-19 | 5.51e-12 | 0.912 |
| 1. PBF | Q9KQT4 | Integration host factor subunit beta | 0.00e+00 | 9.63e-36 | 7.03e-12 | 0.9125 |
| 1. PBF | Q87AB7 | Integration host factor subunit alpha | 0.00e+00 | 5.32e-40 | 5.74e-12 | 0.9395 |
| 1. PBF | B1J5H2 | Integration host factor subunit beta | 0.00e+00 | 8.19e-29 | 3.15e-13 | 0.9323 |
| 1. PBF | B5ZXV9 | Integration host factor subunit alpha | 1.55e-12 | 5.40e-24 | 4.48e-06 | 0.8161 |
| 1. PBF | B5QVW2 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9185 |
| 1. PBF | A9R7I5 | Integration host factor subunit beta | 0.00e+00 | 9.19e-37 | 4.28e-11 | 0.907 |
| 1. PBF | B1ZKI7 | Integration host factor subunit alpha | 9.99e-16 | 3.15e-24 | 1.75e-06 | 0.8923 |
| 1. PBF | Q9CML8 | Integration host factor subunit beta | 0.00e+00 | 4.09e-37 | 3.52e-12 | 0.9179 |
| 1. PBF | Q57153 | DNA-binding protein HBbu | 4.09e-12 | 3.76e-21 | 2.22e-05 | 0.8474 |
| 1. PBF | A0KJ94 | Integration host factor subunit beta | 0.00e+00 | 4.38e-39 | 9.05e-13 | 0.9292 |
| 1. PBF | Q214G0 | Integration host factor subunit alpha | 2.55e-15 | 1.14e-28 | 1.68e-07 | 0.8917 |
| 1. PBF | P0A3H4 | DNA-binding protein HRL18 | 0.00e+00 | 3.33e-49 | 1.48e-12 | 0.9403 |
| 1. PBF | Q5PH86 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.917 |
| 1. PBF | Q2KZM3 | Integration host factor subunit alpha | 3.33e-15 | 1.21e-20 | 1.06e-11 | 0.9024 |
| 1. PBF | B7NT64 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9202 |
| 1. PBF | P0A1R8 | DNA-binding protein HU-beta | 0.00e+00 | 4.38e-46 | 6.53e-18 | 0.94 |
| 1. PBF | Q51472 | Integration host factor subunit alpha | 2.22e-16 | 2.38e-41 | 3.53e-12 | 0.9076 |
| 1. PBF | Q68XJ6 | DNA-binding protein HU | 8.77e-15 | 3.85e-27 | 9.87e-12 | 0.8925 |
| 1. PBF | Q6MMJ0 | Integration host factor subunit alpha | 0.00e+00 | 2.98e-15 | 5.12e-15 | 0.9204 |
| 1. PBF | B2I6X0 | Integration host factor subunit beta | 0.00e+00 | 1.14e-23 | 3.75e-12 | 0.939 |
| 1. PBF | Q1QS30 | Integration host factor subunit beta | 0.00e+00 | 5.77e-27 | 2.77e-11 | 0.9068 |
| 1. PBF | P0A0U1 | Integration host factor subunit beta | 0.00e+00 | 8.36e-35 | 2.62e-12 | 0.9085 |
| 1. PBF | B7VPF6 | Integration host factor subunit alpha | 0.00e+00 | 8.32e-41 | 7.55e-15 | 0.9177 |
| 1. PBF | Q1MM94 | Integration host factor subunit beta | 0.00e+00 | 1.84e-25 | 3.12e-11 | 0.9252 |
| 1. PBF | A0KWC7 | Integration host factor subunit alpha | 0.00e+00 | 2.49e-44 | 1.24e-12 | 0.9168 |
| 1. PBF | B8D999 | Integration host factor subunit beta | 0.00e+00 | 1.00e-38 | 6.38e-09 | 0.9194 |
| 1. PBF | Q5E5G4 | Integration host factor subunit alpha | 1.11e-16 | 6.02e-43 | 3.41e-15 | 0.9136 |
| 1. PBF | P0A1S0 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9177 |
| 1. PBF | P0A6Y3 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9068 |
| 1. PBF | A6X1X7 | Integration host factor subunit alpha | 6.77e-15 | 1.62e-29 | 8.85e-07 | 0.877 |
| 1. PBF | A6WMK6 | Integration host factor subunit alpha | 0.00e+00 | 1.15e-44 | 2.62e-12 | 0.9179 |
| 1. PBF | Q8KA11 | Integration host factor subunit alpha | 0.00e+00 | 6.83e-29 | 5.19e-07 | 0.9375 |
| 1. PBF | A4YJI9 | Integration host factor subunit beta | 0.00e+00 | 7.64e-18 | 2.00e-10 | 0.9234 |
| 1. PBF | Q9KV83 | DNA-binding protein HU-alpha | 0.00e+00 | 1.57e-44 | 3.16e-12 | 0.9577 |
| 1. PBF | P64392 | Integration host factor subunit alpha | 1.33e-15 | 3.92e-36 | 6.08e-13 | 0.894 |
| 1. PBF | B6JCN9 | Integration host factor subunit beta | 0.00e+00 | 3.69e-18 | 2.15e-11 | 0.9157 |
| 1. PBF | Q15SX9 | Integration host factor subunit alpha | 0.00e+00 | 1.26e-43 | 4.55e-14 | 0.9168 |
| 1. PBF | B2SLH4 | Integration host factor subunit beta | 0.00e+00 | 1.50e-24 | 1.06e-13 | 0.9225 |
| 1. PBF | A1K4E7 | Integration host factor subunit alpha | 1.11e-16 | 6.30e-34 | 3.62e-10 | 0.9117 |
| 1. PBF | P0ACF3 | DNA-binding protein HU-alpha | 0.00e+00 | 1.52e-47 | 6.14e-11 | 0.9539 |
| 1. PBF | Q2NT26 | Integration host factor subunit alpha | 0.00e+00 | 2.17e-43 | 1.06e-14 | 0.916 |
| 1. PBF | P43724 | Integration host factor subunit beta | 0.00e+00 | 2.76e-35 | 3.29e-10 | 0.9399 |
| 1. PBF | B8GRS4 | Integration host factor subunit beta | 0.00e+00 | 2.34e-31 | 1.13e-12 | 0.939 |
| 1. PBF | Q51473 | Integration host factor subunit beta | 0.00e+00 | 1.32e-35 | 9.52e-14 | 0.9369 |
| 1. PBF | Q1GZS3 | Integration host factor subunit alpha | 0.00e+00 | 1.27e-35 | 6.61e-10 | 0.9182 |
| 1. PBF | B4EB39 | Integration host factor subunit beta | 0.00e+00 | 6.30e-18 | 2.40e-11 | 0.9285 |
| 1. PBF | Q62M28 | Integration host factor subunit beta | 0.00e+00 | 5.78e-19 | 1.14e-11 | 0.9405 |
| 1. PBF | A9M798 | Integration host factor subunit beta | 0.00e+00 | 2.50e-39 | 5.49e-11 | 0.9193 |
| 1. PBF | Q5X1H9 | Integration host factor subunit alpha | 0.00e+00 | 3.88e-41 | 3.31e-11 | 0.9128 |
| 1. PBF | Q1GT91 | Integration host factor subunit alpha | 2.22e-16 | 2.70e-43 | 1.81e-07 | 0.9004 |
| 1. PBF | B7GZZ4 | Integration host factor subunit alpha | 0.00e+00 | 1.57e-37 | 2.92e-11 | 0.9227 |
| 1. PBF | Q92QT3 | Integration host factor subunit alpha | 1.55e-12 | 9.83e-25 | 1.30e-06 | 0.8106 |
| 1. PBF | Q0I390 | Integration host factor subunit beta | 0.00e+00 | 1.38e-40 | 1.67e-14 | 0.9029 |
| 1. PBF | A8GCH4 | Integration host factor subunit beta | 0.00e+00 | 1.31e-37 | 1.96e-12 | 0.906 |
| 1. PBF | Q7NYC0 | Integration host factor subunit alpha | 0.00e+00 | 3.03e-32 | 1.30e-10 | 0.9155 |
| 1. PBF | A3NC29 | Integration host factor subunit beta | 0.00e+00 | 5.78e-19 | 1.14e-11 | 0.9397 |
| 1. PBF | P0A0U2 | Integration host factor subunit beta | 0.00e+00 | 8.36e-35 | 2.62e-12 | 0.908 |
| 1. PBF | Q7A0U9 | DNA-binding protein HU | 0.00e+00 | 6.89e-50 | 5.14e-17 | 0.9496 |
| 1. PBF | B8H6A5 | Integration host factor subunit beta | 0.00e+00 | 1.45e-34 | 4.18e-10 | 0.9035 |
| 1. PBF | Q2N927 | Integration host factor subunit alpha | 2.84e-14 | 3.75e-38 | 9.79e-08 | 0.8464 |
| 1. PBF | A7ZYL5 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9116 |
| 1. PBF | Q1RHD4 | DNA-binding protein HU | 7.33e-15 | 6.49e-24 | 1.42e-13 | 0.8882 |
| 1. PBF | Q9ZL08 | DNA-binding protein HU | 9.16e-13 | 3.51e-35 | 9.41e-06 | 0.8481 |
| 1. PBF | B8F475 | Integration host factor subunit beta | 0.00e+00 | 4.44e-37 | 1.43e-09 | 0.9272 |
| 1. PBF | P0CAV2 | DNA-binding protein HU | 1.11e-16 | 2.58e-43 | 1.54e-11 | 0.9002 |
| 1. PBF | P0A127 | Integration host factor subunit alpha | 0.00e+00 | 9.49e-42 | 1.88e-12 | 0.9265 |
| 1. PBF | Q0ADP0 | Integration host factor subunit alpha | 0.00e+00 | 2.38e-28 | 1.02e-10 | 0.9199 |
| 1. PBF | A5E8A7 | Integration host factor subunit beta | 0.00e+00 | 2.57e-22 | 1.93e-10 | 0.9249 |
| 1. PBF | A1RJG1 | Integration host factor subunit beta | 0.00e+00 | 2.45e-33 | 2.01e-11 | 0.9096 |
| 1. PBF | Q9A8I3 | Integration host factor subunit alpha | 0.00e+00 | 8.83e-37 | 7.72e-07 | 0.9248 |
| 1. PBF | B8J836 | Integration host factor subunit alpha | 3.22e-15 | 3.51e-09 | 5.51e-16 | 0.8973 |
| 1. PBF | A5VN89 | Integration host factor subunit beta | 0.00e+00 | 2.50e-39 | 5.49e-11 | 0.9203 |
| 1. PBF | B8D8T2 | Integration host factor subunit alpha | 0.00e+00 | 1.34e-26 | 7.95e-07 | 0.9484 |
| 1. PBF | Q0HIW8 | Integration host factor subunit beta | 0.00e+00 | 7.21e-33 | 2.75e-11 | 0.908 |
| 1. PBF | Q0APH3 | Integration host factor subunit alpha | 5.55e-16 | 1.62e-35 | 1.57e-10 | 0.8981 |
| 1. PBF | Q5HFV0 | DNA-binding protein HU | 0.00e+00 | 6.89e-50 | 5.14e-17 | 0.9486 |
| 1. PBF | Q136S3 | Integration host factor subunit alpha | 2.44e-15 | 3.57e-15 | 1.30e-07 | 0.9085 |
| 1. PBF | Q5QZ46 | Integration host factor subunit beta | 0.00e+00 | 7.24e-38 | 2.38e-12 | 0.9402 |
| 1. PBF | Q3J366 | Integration host factor subunit alpha | 9.07e-13 | 3.35e-46 | 1.38e-10 | 0.8252 |
| 1. PBF | B7NM62 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9108 |
| 1. PBF | Q1MIS5 | Integration host factor subunit alpha | 1.42e-14 | 9.50e-25 | 2.99e-06 | 0.8742 |
| 1. PBF | Q3JPY2 | Integration host factor subunit beta | 0.00e+00 | 5.78e-19 | 1.14e-11 | 0.9373 |
| 1. PBF | B2TUG9 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.91 |
| 1. PBF | B8GX11 | DNA-binding protein HU | 0.00e+00 | 2.58e-43 | 1.54e-11 | 0.9041 |
| 1. PBF | Q5ZS10 | Integration host factor subunit alpha | 0.00e+00 | 2.93e-38 | 4.36e-11 | 0.9305 |
| 1. PBF | P02344 | DNA-binding protein HRm | 0.00e+00 | 2.78e-50 | 1.13e-16 | 0.9448 |
| 1. PBF | B4TGH7 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.9176 |
| 1. PBF | B2T634 | Integration host factor subunit beta | 0.00e+00 | 8.52e-15 | 2.30e-13 | 0.9295 |
| 1. PBF | P0DMK4 | DNA-binding protein HU-alpha | 0.00e+00 | 1.15e-41 | 2.99e-14 | 0.9591 |
| 1. PBF | B0TQY4 | Integration host factor subunit alpha | 0.00e+00 | 2.28e-45 | 5.14e-13 | 0.915 |
| 1. PBF | B1IW19 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | 0.9074 |
| 1. PBF | Q3IL99 | Integration host factor subunit beta | 0.00e+00 | 3.72e-35 | 4.15e-11 | 0.9203 |
| 1. PBF | P64387 | Probable DNA-binding protein HU | 3.59e-14 | 1.30e-35 | 8.23e-07 | 0.8558 |
| 1. PBF | P0A6X9 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9202 |
| 1. PBF | B4RJZ4 | Integration host factor subunit alpha | 1.44e-15 | 1.20e-35 | 6.08e-13 | 0.8933 |
| 1. PBF | A4JCH7 | Integration host factor subunit beta | 0.00e+00 | 8.07e-19 | 7.22e-12 | 0.9364 |
| 1. PBF | A6WNM7 | Integration host factor subunit beta | 0.00e+00 | 2.23e-32 | 2.84e-11 | 0.9108 |
| 1. PBF | Q5PGG9 | Integration host factor subunit beta | 0.00e+00 | 4.53e-37 | 3.30e-12 | 0.9057 |
| 1. PBF | P0ACF7 | DNA-binding protein HU-beta | 0.00e+00 | 4.94e-47 | 1.63e-17 | 0.9428 |
| 1. PBF | Q47GF4 | Integration host factor subunit alpha 1 | 0.00e+00 | 1.81e-29 | 1.46e-09 | 0.938 |
| 1. PBF | P0A1R6 | DNA-binding protein HU-alpha | 0.00e+00 | 8.49e-47 | 4.16e-11 | 0.9548 |
| 1. PBF | B7US95 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | 0.9181 |
| 1. PBF | C1D546 | Integration host factor subunit beta | 0.00e+00 | 8.05e-30 | 1.78e-08 | 0.9286 |
| 1. PBF | A6V491 | Integration host factor subunit alpha | 3.33e-16 | 2.38e-41 | 3.53e-12 | 0.9041 |
| 1. PBF | Q47GJ8 | Integration host factor subunit beta | 0.00e+00 | 1.79e-35 | 7.28e-13 | 0.9096 |
| 1. PBF | A1WUI6 | Integration host factor subunit beta | 0.00e+00 | 7.51e-26 | 1.14e-17 | 0.93 |
| 1. PBF | Q63S07 | Integration host factor subunit beta | 0.00e+00 | 5.78e-19 | 1.14e-11 | 0.9379 |
| 1. PBF | A5UBN4 | Integration host factor subunit beta | 0.00e+00 | 8.02e-38 | 4.62e-11 | 0.9385 |
| 1. PBF | A6V2R4 | Integration host factor subunit beta | 0.00e+00 | 1.32e-35 | 9.52e-14 | 0.933 |
| 1. PBF | Q4ZUG1 | Integration host factor subunit alpha | 1.11e-16 | 2.38e-41 | 2.81e-13 | 0.913 |
| 1. PBF | P52681 | DNA-binding protein HU-beta | 0.00e+00 | 1.33e-47 | 2.55e-15 | 0.9516 |
| 1. PBF | Q5LV98 | Integration host factor subunit beta | 0.00e+00 | 2.07e-39 | 4.14e-11 | 0.9136 |
| 1. PBF | B5FJA2 | Integration host factor subunit alpha | 0.00e+00 | 1.90e-40 | 5.96e-15 | 0.92 |
| 1. PBF | A8I5K8 | Integration host factor subunit alpha | 1.11e-16 | 1.49e-35 | 5.01e-10 | 0.9062 |
| 1. PBF | Q5F9T5 | Integration host factor subunit alpha | 1.33e-15 | 1.20e-35 | 6.08e-13 | 0.8943 |
| 1. PBF | P02348 | DNA-binding protein HRL53 | 0.00e+00 | 9.30e-47 | 1.25e-16 | 0.9365 |
| 1. PBF | P0C097 | DNA-binding protein HU | 0.00e+00 | 2.83e-39 | 2.99e-15 | 0.9439 |
| 1. PBF | Q7NTK9 | Integration host factor subunit beta | 0.00e+00 | 2.32e-32 | 1.16e-09 | 0.8877 |
| 2. PF | O68451 | DNA-binding protein HU-like | 4.77e-11 | 3.96e-12 | NA | 0.7803 |
| 2. PF | P75249 | Uncharacterized protein MG353 homolog | 1.95e-12 | 1.50e-24 | NA | 0.8489 |
| 2. PF | P47595 | Uncharacterized protein MG353 | 1.43e-12 | 2.14e-27 | NA | 0.8538 |
| 2. PF | Q9ZD26 | DNA-binding protein HU-like | 1.48e-11 | 4.81e-11 | NA | 0.7725 |
| 3. BF | Q1LQG7 | Integration host factor subunit beta | 0.00e+00 | NA | 2.67e-13 | 0.9414 |
| 3. BF | O33125 | DNA-binding protein HU homolog | 4.95e-14 | NA | 7.30e-04 | 0.9355 |
| 3. BF | Q9XB18 | DNA-binding protein HU homolog | 2.10e-13 | NA | 6.79e-04 | 0.9335 |
| 3. BF | P9WMK6 | DNA-binding protein HU homolog | 2.08e-13 | NA | 6.79e-04 | 0.9336 |
| 3. BF | Q9RZ89 | DNA-binding protein HU | 1.11e-15 | NA | 7.15e-12 | 0.9104 |
| 3. BF | Q46Y54 | Integration host factor subunit beta | 9.99e-16 | NA | 4.78e-13 | 0.911 |
| 3. BF | P0A3H8 | DNA-binding protein HU 2 | 4.79e-12 | NA | 2.85e-06 | 0.9168 |
| 3. BF | Q9ZHC5 | DNA-binding protein HU homolog | 3.00e-13 | NA | 8.69e-05 | 0.9298 |
| 3. BF | Q8Y0Y3 | Integration host factor subunit beta | 0.00e+00 | NA | 9.81e-14 | 0.9365 |
| 3. BF | P0A3H7 | DNA-binding protein HU 2 | 3.56e-12 | NA | 2.85e-06 | 0.9185 |
| 4. PB | P0ACF0 | DNA-binding protein HU-alpha | 0.00e+00 | 1.52e-47 | 6.14e-11 | NA |
| 4. PB | P0A6Y1 | Integration host factor subunit beta | 0.00e+00 | 4.17e-37 | 2.41e-12 | NA |
| 4. PB | P04445 | Transcription factor 1 | NA | 8.23e-31 | 1.63e-04 | NA |
| 4. PB | P68574 | DNA-binding protein HU 2 | NA | 6.99e-40 | 3.77e-22 | NA |
| 4. PB | P0ACF4 | DNA-binding protein HU-beta | 0.00e+00 | 4.94e-47 | 1.63e-17 | NA |
| 4. PB | P0A6X7 | Integration host factor subunit alpha | 0.00e+00 | 3.08e-40 | 5.90e-15 | NA |
| 5. P | P0C9E3 | Viral histone-like protein | NA | 5.38e-27 | NA | NA |
| 5. P | Q92HL4 | DNA-binding protein HU-like | 3.28e-11 | 4.44e-12 | NA | NA |
| 5. P | P68743 | Viral histone-like protein | NA | 5.38e-27 | NA | NA |
| 5. P | P68742 | Viral histone-like protein | NA | 5.38e-27 | NA | NA |
| 5. P | P0C9E4 | Viral histone-like protein | NA | 7.64e-26 | NA | NA |
| 5. P | P0C9E5 | Viral histone-like protein | NA | 5.38e-27 | NA | NA |
| 5. P | Q01239 | Major basic nuclear protein 1 | 7.62e-08 | 2.17e-05 | NA | NA |
| 7. B | P9WMK7 | DNA-binding protein HU homolog | 1.93e-13 | NA | 6.79e-04 | NA |