Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54735.1

JCVISYN3A_0353

Uncharacterized protein.
M. mycoides homolog: Q6MTJ1.
TIGRfam Classification: 1=Unknown.
Category: Quasiessential.

Statistics

Total GO Annotation: 10
Unique PROST Go: 6
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 108
Unique PROST Homologs: 19
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: nucleotide exchange factor of informational NTPase|a large diversity of Hsp70 nucleotide exchange factors has been discovered in the eukaryotic cell
Yang and Tsui [2]: Cell cycle protein GpsB
Antczak et al. [3]: Cell division DivIVA/GpsB protein
Zhang et al. [4]: GO:0050789|regulation of biological process
Bianchi et al. [5]: Cell Division protein GpsB

Structures and Sequence Alignment

The best structural homolog that predicted by 7. B was P71021 (Septum site-determining protein DivIVA) with a FATCAT P-Value: 8.73e-14 and RMSD of 1.25 angstrom. The sequence alignment identity is 25.6%.
Structural alignment shown in left. Query protein AVX54735.1 colored as red in alignment, homolog P71021 colored as blue. Query protein AVX54735.1 is also shown in right top, homolog P71021 showed in right bottom. They are colored based on secondary structures.

  AVX54735.1 MKKLSVNQIQNKKFNIVYKGYKIEEVNDFLDEIIKDY--VC-----LENQISNLNDQL-EQAN--QKISK--LIT-----D-KQKTETELDQYVK---KN 79
      P71021 M-PLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKN 99

  AVX54735.1 W-KLVKDNLN-------DVDVIK---RI--TR----IE------KN-----LVEYEEKLNKIDEIY--KLLISKSR 125
      P71021 ADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYE-----VDAVFEEKE------ 164

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
4. PB	GO:0051301	cell division
4. PB	GO:0007049	cell cycle
4. PB	GO:0008360	regulation of cell shape
4. PB	GO:0005737	cytoplasm
5. P	GO:0005758	mitochondrial intermembrane space
5. P	GO:0000818	nuclear MIS12/MIND complex
5. P	GO:0000445	THO complex part of transcription export complex
5. P	GO:0051455	monopolar spindle attachment to meiosis I kinetochore
5. P	GO:0031617	NMS complex
5. P	GO:0051315	attachment of mitotic spindle microtubules to kinetochore

Uniprot GO Annotations

GO	Description
GO:0016021	integral component of membrane
GO:0016020	membrane
GO:0005737	cytoplasm
GO:0051301	cell division
GO:0007049	cell cycle

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
4. PB	A4VTE5	Cell cycle protein GpsB	2.82e-05	1.06e-15	4.26e-06	NA
4. PB	Q7A0V6	Cell cycle protein GpsB	1.34e-06	3.54e-08	0.011	NA
4. PB	Q5M1K5	Cell cycle protein GpsB	1.08e-04	1.09e-06	5.83e-04	NA
4. PB	Q038W7	Cell cycle protein GpsB	5.54e-06	4.58e-12	3.42e-04	NA
4. PB	Q8EQF0	Cell cycle protein GpsB	2.55e-05	2.29e-07	1.31e-04	NA
4. PB	Q81SR3	Cell cycle protein GpsB	3.72e-05	7.78e-07	1.42e-06	NA
4. PB	A8FEF4	Cell cycle protein GpsB	7.42e-06	1.48e-08	1.52e-07	NA
4. PB	Q2FGZ4	Cell cycle protein GpsB	1.37e-10	3.54e-08	0.011	NA
4. PB	Q1JKN4	Cell cycle protein GpsB	9.06e-07	4.30e-10	0.002	NA
4. PB	Q3K378	Cell cycle protein GpsB	4.18e-07	1.30e-13	5.82e-05	NA
4. PB	C1ENJ5	Cell cycle protein GpsB	5.05e-05	7.78e-07	1.42e-06	NA
4. PB	B7HL74	Cell cycle protein GpsB	6.47e-06	7.78e-07	1.42e-06	NA
4. PB	Q81FL9	Cell cycle protein GpsB	4.48e-06	1.14e-06	2.15e-06	NA
4. PB	A2RD56	Cell cycle protein GpsB	1.42e-07	4.30e-10	0.002	NA
4. PB	Q8CSJ3	Cell cycle protein GpsB	5.01e-10	2.34e-09	0.013	NA
4. PB	Q1J5H5	Cell cycle protein GpsB	2.22e-06	4.30e-10	0.002	NA
4. PB	A7X2D9	Cell cycle protein GpsB	1.63e-10	3.54e-08	0.011	NA
4. PB	A4VZM2	Cell cycle protein GpsB	3.16e-05	1.06e-15	4.26e-06	NA
4. PB	A9VMG8	Cell cycle protein GpsB	4.34e-06	2.37e-06	2.49e-07	NA
4. PB	B1I9H2	Cell cycle protein GpsB	1.49e-04	1.54e-12	0.003	NA
4. PB	A8Z425	Cell cycle protein GpsB	1.13e-09	3.54e-08	0.011	NA
4. PB	Q97SI9	Cell cycle protein GpsB	3.40e-05	2.21e-12	0.017	NA
4. PB	Q2YY60	Cell cycle protein GpsB	3.39e-10	3.54e-08	0.011	NA
4. PB	Q7CMY7	Cell cycle protein GpsB	7.68e-07	4.30e-10	0.002	NA
4. PB	Q6HKZ8	Cell cycle protein GpsB	3.70e-06	7.78e-07	1.42e-06	NA
4. PB	Q5HP97	Cell cycle protein GpsB	2.11e-09	2.34e-09	0.013	NA
4. PB	Q8E1Q1	Cell cycle protein GpsB	1.76e-06	1.30e-13	5.82e-05	NA
4. PB	C1CBF2	Cell cycle protein GpsB	3.18e-05	2.21e-12	0.017	NA
4. PB	Q65I80	Cell cycle protein GpsB	1.73e-06	1.82e-07	5.28e-07	NA
4. PB	E0U0L7	Cell cycle protein GpsB	2.04e-06	8.09e-08	1.35e-07	NA
4. PB	Q6G9B7	Cell cycle protein GpsB	2.69e-09	3.54e-08	0.011	NA
4. PB	Q8DR57	Cell cycle protein GpsB	3.19e-05	2.21e-12	0.017	NA
4. PB	B3WEI0	Cell cycle protein GpsB	6.44e-06	4.58e-12	3.42e-04	NA
4. PB	B9DV61	Cell cycle protein GpsB	1.46e-05	3.12e-13	0.003	NA
4. PB	Q5HFX8	Cell cycle protein GpsB	2.36e-09	3.54e-08	0.011	NA
4. PB	A8AVU5	Cell cycle protein GpsB	3.51e-07	2.38e-17	2.13e-05	NA
4. PB	A0RC09	Cell cycle protein GpsB	9.14e-07	7.78e-07	1.42e-06	NA
4. PB	C3P5S9	Cell cycle protein GpsB	5.16e-06	7.78e-07	1.42e-06	NA
4. PB	Q03MI1	Cell cycle protein GpsB	1.08e-05	2.96e-10	4.22e-04	NA
4. PB	B9IVT1	Cell cycle protein GpsB	4.25e-06	7.78e-07	1.42e-06	NA
4. PB	Q48S07	Cell cycle protein GpsB	1.02e-06	4.30e-10	0.002	NA
4. PB	Q2FYI5	Cell cycle protein GpsB	6.01e-10	3.54e-08	0.011	NA
4. PB	Q1JAI2	Cell cycle protein GpsB	1.08e-06	4.30e-10	0.002	NA
4. PB	Q5XAN0	Cell cycle protein GpsB	5.28e-07	4.30e-10	0.002	NA
4. PB	B8ZL84	Cell cycle protein GpsB	1.34e-05	1.23e-11	0.005	NA
4. PB	A0AJZ3	Cell cycle protein GpsB	1.01e-06	1.80e-07	0.003	NA
4. PB	Q04M95	Cell cycle protein GpsB	2.55e-05	2.21e-12	0.017	NA
4. PB	Q5WGF5	Cell cycle protein GpsB	8.03e-06	1.04e-05	8.57e-04	NA
4. PB	B8DDL5	Cell cycle protein GpsB	1.11e-04	2.38e-08	0.001	NA
4. PB	A4IN56	Cell cycle protein GpsB	6.69e-05	4.76e-09	1.02e-05	NA
4. PB	Q4L6F0	Cell cycle protein GpsB	1.17e-09	4.58e-07	0.045	NA
4. PB	A6U1R5	Cell cycle protein GpsB	1.22e-11	3.54e-08	0.011	NA
4. PB	Q03S32	Cell cycle protein GpsB	2.67e-05	1.09e-10	6.25e-04	NA
4. PB	A5ISX6	Cell cycle protein GpsB	1.58e-09	3.54e-08	0.011	NA
4. PB	Q1JFM5	Cell cycle protein GpsB	1.21e-07	4.30e-10	0.002	NA
4. PB	B7IPD8	Cell cycle protein GpsB	7.54e-07	1.14e-06	2.15e-06	NA
4. PB	Q71YC7	Cell cycle protein GpsB	7.00e-05	2.38e-08	0.001	NA
4. PB	A3CPY3	Cell cycle protein GpsB	6.52e-06	9.02e-10	0.005	NA
4. PB	A7Z5W9	Cell cycle protein GpsB	4.21e-06	6.82e-09	7.33e-07	NA
4. PB	P0CI74	Cell cycle protein GpsB	1.38e-06	8.09e-08	1.35e-07	NA
4. PB	Q5KZR0	Cell cycle protein GpsB	3.27e-10	1.67e-09	1.26e-05	NA
4. PB	Q7A5L1	Cell cycle protein GpsB	6.02e-08	3.54e-08	0.011	NA
4. PB	Q99YL4	Cell cycle protein GpsB	7.95e-08	4.30e-10	0.002	NA
4. PB	Q8E766	Cell cycle protein GpsB	1.73e-07	1.30e-13	5.82e-05	NA
4. PB	B7HHW3	Cell cycle protein GpsB	1.01e-05	1.14e-06	2.15e-06	NA
4. PB	B5E7B2	Cell cycle protein GpsB	3.24e-05	2.21e-12	0.017	NA
4. PB	Q6GGW4	Cell cycle protein GpsB	1.63e-10	3.54e-08	0.011	NA
4. PB	Q73AT3	Cell cycle protein GpsB	8.49e-06	6.75e-07	7.39e-07	NA
4. PB	C1CIN3	Cell cycle protein GpsB	3.11e-05	2.21e-12	0.017	NA
4. PB	A7GN95	Cell cycle protein GpsB	4.68e-05	7.24e-08	9.83e-07	NA
4. PB	Q8Y614	Cell cycle protein GpsB	8.11e-05	2.38e-08	0.001	NA
4. PB	Q8DVL1	Cell cycle protein GpsB	8.06e-08	2.76e-11	4.23e-04	NA
4. PB	A5VK11	Cell cycle protein GpsB	9.04e-08	2.05e-14	0.007	NA
4. PB	B5XMJ7	Cell cycle protein GpsB	3.60e-08	2.25e-09	0.001	NA
4. PB	C1CCD7	Cell cycle protein GpsB	1.05e-07	2.21e-12	0.017	NA
4. PB	Q99U42	Cell cycle protein GpsB	2.19e-10	3.54e-08	0.011	NA
4. PB	B7JHS6	Cell cycle protein GpsB	1.54e-05	7.78e-07	1.42e-06	NA
4. PB	Q92AC0	Cell cycle protein GpsB	8.61e-06	1.29e-08	0.003	NA
4. PB	P0DB44	Cell cycle protein GpsB	2.80e-06	4.30e-10	0.002	NA
4. PB	P0DB45	Cell cycle protein GpsB	5.52e-08	4.30e-10	0.002	NA
4. PB	Q5M646	Cell cycle protein GpsB	7.04e-06	1.09e-06	5.83e-04	NA
4. PB	C3L8N0	Cell cycle protein GpsB	4.47e-06	7.78e-07	1.42e-06	NA
4. PB	Q9KC05	Cell cycle protein GpsB	1.00e-08	9.86e-09	1.52e-04	NA
4. PB	C1KWI8	Cell cycle protein GpsB	6.96e-05	2.38e-08	0.001	NA
4. PB	C1CPN9	Cell cycle protein GpsB	4.52e-05	5.35e-12	0.005	NA
4. PB	A6QGZ6	Cell cycle protein GpsB	3.02e-10	3.54e-08	0.011	NA
4. PB	Q63DH5	Cell cycle protein GpsB	2.75e-06	6.88e-06	2.26e-06	NA
5. P	Q7VI02	Uncharacterized protein HH_0809	3.21e-09	2.16e-04	NA	NA
5. P	B4YNF6	Uncharacterized protein V16	NA	5.36e-03	NA	NA
5. P	Q6GPT7	Protein MIX23	1.67e-06	1.17e-02	NA	NA
5. P	P52475	Protein U68	NA	3.19e-03	NA	NA
5. P	B3DL65	Protein MIX23	3.15e-06	1.14e-02	NA	NA
5. P	Q88W95	Cell cycle protein GpsB	4.52e-07	2.90e-12	NA	NA
5. P	Q38X59	Cell cycle protein GpsB	1.20e-05	1.71e-19	NA	NA
5. P	P51736	Uncharacterized 23.3 kDa protein in lys 3'region	NA	7.83e-03	NA	NA
5. P	O66410	Uncharacterized protein aq_aa19	3.27e-04	2.08e-02	NA	NA
5. P	Q7SZ78	THO complex subunit 7 homolog	1.49e-07	4.89e-02	NA	NA
5. P	Q3ZC61	MORF4 family-associated protein 1	5.51e-10	1.63e-03	NA	NA
5. P	A8FBJ5	UPF0342 protein BPUM_0928	1.54e-04	4.39e-02	NA	NA
5. P	Q03FN0	Cell cycle protein GpsB	2.01e-07	3.82e-22	NA	NA
5. P	Q09858	Kinetochore protein nnf1	6.96e-06	1.77e-04	NA	NA
5. P	P47453	Uncharacterized protein MG211	4.00e-08	1.58e-21	NA	NA
5. P	B4YNF1	Uncharacterized protein V11	NA	1.04e-04	NA	NA
5. P	Q573E3	Uncharacterized protein ORF100a	NA	1.79e-02	NA	NA
5. P	P75481	Uncharacterized protein MG211 homolog	1.53e-08	2.43e-13	NA	NA
5. P	Q1WTW4	Cell cycle protein GpsB	9.32e-10	2.12e-14	NA	NA
7. B	Q8CWP9	Cell division protein DivIVA	2.32e-10	NA	0.039	NA
7. B	P71021	Septum site-determining protein DivIVA	8.73e-14	NA	0.007	NA