Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54736.1
JCVISYN3A_0359
Ribonuclease Y.
M. mycoides homolog: Q6MTI6.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 12
Unique PROST Go: 1
Unique BLAST Go: 0
Unique Foldseek Go: 1
Total Homologs: 259
Unique PROST Homologs: 1
Unique BLAST Homologs: 33
Unique Foldseek Homologs: 3
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P67284
(Ribonuclease Y) with a FATCAT P-Value: 0 and RMSD of 2.90 angstrom. The sequence alignment identity is 40.9%.
Structural alignment shown in left. Query protein AVX54736.1 colored as red in alignment, homolog P67284 colored as blue.
Query protein AVX54736.1 is also shown in right top, homolog P67284 showed in right bottom. They are colored based on secondary structures.
AVX54736.1 MEENII-IILSVFLGIFFICFVISSVILLYFWKSKSRKH-----LI--EQYT-----K---EA----KQAKKQVLANGYKE-ISEAKMLFLK-RSELE-- 76 P67284 M-VNIILLIVSALIGL-ILGYALISIRL------KSAKEAAELTLLNAEQEAVDIRGKAEVDAEHIKKTAKRESKAN-RKELLLEAKEEARKYREEIEQE 91 AVX54736.1 -KNELDRVKEQLDLRAND----LKRSQEIVESKSQRLDA---GILDLEKRKFLVDQKEEYLIKL-------LEDVSGLTKYQAKELLIKQIKNKSEKELI 161 P67284 FKSERQELK-QLETRLAERSLTLDRKDENLSSKEKVLDSKEQSLTD--KSKH-IDERQLQVEKLEEEKKAELEKVAAMTIAEAREVILMETENKLTHEIA 187 AVX54736.1 SILKNAE--LQAHS-K-AKIISNNILISAMERIKVE-LTSQRTTNIVKLPSDDLKGRIIGKDGRNMKTFEQIGGVDIVVDETPNVVVVSSFNPIRREIAT 256 P67284 TRIRDAERDIKDRTVKTAK----DLLAQAMQRLAGEYVTEQTITS-VHLPDDNMKGRIIGREGRNIRTLESLTGIDVIIDDTPEVVILSGFDPIRREIAR 282 AVX54736.1 RTLEQLIIDGRIQPVKIENEL-KKQEQELEYIIQETGLNTIKELNINDIDIELVKLIGKLKFRTSYGQNVLAHSIEVAKLSGAIASELGLDVEKAIRAGL 355 P67284 MTLESLIADGRIHPARIE-ELVEKNRLEMDNRIREYGEAAAYEIGAPNLHPDLIKIMGRLQFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGF 381 AVX54736.1 LHDIGKAIDFEKQGSHVVLGAEIARKYNEDPIIINSIESHHEDKEKSSEIAAIVAIADSISASRPGARYNAIDEFILRMHEIEKIGNSIPGVAKTYALQS 455 P67284 LHDMGKAIDREVEGSHVEIGMEFARKYKEHPVVVNTIASHHGDVEPDSVIAVLVAAADALSSARPGARNESMENYIKRLRDLEEIATSFDGVQNSFALQA 481 AVX54736.1 GRQIRLIVDPLVASDLDLALIL-EKMKEQIKDKVIIPGEITITVIREKKETDILK 509 P67284 GREIRIMVQPEKISD-DQVVILSHKVREKIENNLDYPGNIKVTVIREMRAVDYAK 535
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0004521 | endoribonuclease activity |
1. PBF | GO:0003723 | RNA binding |
1. PBF | GO:0016021 | integral component of membrane |
1. PBF | GO:0005886 | plasma membrane |
1. PBF | GO:0006402 | mRNA catabolic process |
3. BF | GO:0006426 | glycyl-tRNA aminoacylation |
3. BF | GO:0006420 | arginyl-tRNA aminoacylation |
3. BF | GO:0005737 | cytoplasm |
3. BF | GO:0004820 | glycine-tRNA ligase activity |
3. BF | GO:0004814 | arginine-tRNA ligase activity |
5. P | GO:0046872 | metal ion binding |
6. F | GO:0005524 | ATP binding |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0004521 | endoribonuclease activity |
GO:0003723 | RNA binding |
GO:0090305 | nucleic acid phosphodiester bond hydrolysis |
GO:0016021 | integral component of membrane |
GO:0005886 | plasma membrane |
GO:0016020 | membrane |
GO:0004518 | nuclease activity |
GO:0004519 | endonuclease activity |
GO:0003676 | nucleic acid binding |
GO:0016787 | hydrolase activity |
GO:0090502 | RNA phosphodiester bond hydrolysis, endonucleolytic |
GO:0006402 | mRNA catabolic process |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | Q7NB09 | Ribonuclease Y | 1.39e-12 | 3.03e-34 | 3.90e-40 | 0.5123 |
1. PBF | Q65JF1 | Ribonuclease Y | 0.00e+00 | 2.00e-61 | 2.39e-113 | 0.6103 |
1. PBF | Q9KAB2 | Ribonuclease Y | 0.00e+00 | 3.79e-66 | 4.44e-107 | 0.6784 |
1. PBF | Q1MQ71 | Ribonuclease Y | 0.00e+00 | 6.21e-70 | 3.79e-109 | 0.5889 |
1. PBF | Q02WP0 | Ribonuclease Y | 0.00e+00 | 3.73e-61 | 6.63e-109 | 0.7193 |
1. PBF | Q3B4Y9 | Ribonuclease Y | 0.00e+00 | 2.09e-71 | 3.49e-90 | 0.5604 |
1. PBF | B1MXJ0 | Ribonuclease Y | 0.00e+00 | 5.48e-68 | 8.19e-108 | 0.619 |
1. PBF | Q1J219 | Ribonuclease Y | 0.00e+00 | 1.48e-51 | 6.23e-100 | 0.7117 |
1. PBF | Q82Z99 | Ribonuclease Y | 0.00e+00 | 1.39e-63 | 7.10e-114 | 0.6019 |
1. PBF | A8F8V8 | Ribonuclease Y | 0.00e+00 | 1.43e-71 | 4.07e-110 | 0.6678 |
1. PBF | Q74E27 | Ribonuclease Y | 0.00e+00 | 9.55e-69 | 4.16e-104 | 0.7476 |
1. PBF | A0RHF0 | Ribonuclease Y | 0.00e+00 | 9.69e-65 | 1.29e-111 | 0.6796 |
1. PBF | Q03EQ6 | Ribonuclease Y 1 | 0.00e+00 | 3.41e-61 | 1.08e-115 | 0.5663 |
1. PBF | A1W0J3 | Ribonuclease Y | 0.00e+00 | 1.17e-69 | 3.86e-109 | 0.5448 |
1. PBF | A7FVX8 | Ribonuclease Y | 0.00e+00 | 3.89e-68 | 8.17e-114 | 0.6876 |
1. PBF | Q6HF37 | Ribonuclease Y | 0.00e+00 | 9.69e-65 | 1.29e-111 | 0.6025 |
1. PBF | B1YMC0 | Ribonuclease Y | 0.00e+00 | 2.14e-74 | 6.76e-105 | 0.6832 |
1. PBF | Q3K374 | Ribonuclease Y | 0.00e+00 | 4.79e-62 | 6.75e-112 | 0.6713 |
1. PBF | Q97I38 | Ribonuclease Y | 0.00e+00 | 2.56e-70 | 8.22e-112 | 0.704 |
1. PBF | Q2J766 | Ribonuclease Y | 0.00e+00 | 7.55e-12 | 2.18e-94 | 0.7403 |
1. PBF | A9VS22 | Ribonuclease Y | 0.00e+00 | 1.27e-63 | 1.64e-112 | 0.7119 |
1. PBF | Q9PN86 | Ribonuclease Y | 0.00e+00 | 1.24e-69 | 4.45e-109 | 0.5344 |
1. PBF | Q88UZ5 | Ribonuclease Y | 0.00e+00 | 1.48e-68 | 3.20e-117 | 0.5636 |
1. PBF | Q042C3 | Ribonuclease Y | 0.00e+00 | 2.81e-64 | 4.01e-116 | 0.6073 |
1. PBF | A6U1A5 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6775 |
1. PBF | P67278 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6907 |
1. PBF | A5IL85 | Ribonuclease Y | 0.00e+00 | 9.55e-69 | 8.01e-105 | 0.6418 |
1. PBF | A6LD62 | Ribonuclease Y | 0.00e+00 | 4.94e-75 | 1.46e-102 | 0.7065 |
1. PBF | P0DJP2 | Ribonuclease Y | 0.00e+00 | 2.25e-66 | 1.42e-109 | 0.6352 |
1. PBF | Q73R54 | Ribonuclease Y | 0.00e+00 | 1.53e-75 | 2.48e-103 | 0.6529 |
1. PBF | Q8KEF5 | Ribonuclease Y | 0.00e+00 | 2.94e-68 | 7.27e-99 | 0.5707 |
1. PBF | Q01444 | Ribonuclease Y (Fragment) | 0.00e+00 | 1.41e-19 | 0.0 | 0.9126 |
1. PBF | Q5FL81 | Ribonuclease Y | 0.00e+00 | 1.56e-59 | 3.04e-116 | 0.6618 |
1. PBF | B1GZX3 | Ribonuclease Y | 0.00e+00 | 1.01e-73 | 6.59e-102 | 0.7093 |
1. PBF | A6Q3V4 | Ribonuclease Y | 0.00e+00 | 1.93e-66 | 3.73e-107 | 0.5446 |
1. PBF | A8YUB8 | Ribonuclease Y | 0.00e+00 | 5.40e-63 | 9.32e-116 | 0.5912 |
1. PBF | A7ZDR5 | Ribonuclease Y | 0.00e+00 | 2.35e-73 | 1.22e-118 | 0.5332 |
1. PBF | A3CPX8 | Ribonuclease Y | 0.00e+00 | 1.31e-59 | 3.90e-114 | 0.7105 |
1. PBF | B1KWJ2 | Ribonuclease Y | 0.00e+00 | 4.02e-68 | 6.88e-114 | 0.6851 |
1. PBF | Q4L5Y9 | Ribonuclease Y | 0.00e+00 | 7.73e-73 | 4.18e-105 | 0.6987 |
1. PBF | Q0TPT1 | Ribonuclease Y | 0.00e+00 | 1.60e-74 | 8.66e-114 | 0.7016 |
1. PBF | P67277 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6834 |
1. PBF | Q9X2H2 | Ribonuclease Y | 0.00e+00 | 1.04e-66 | 1.13e-104 | 0.6711 |
1. PBF | Q3ZW82 | Ribonuclease Y | 0.00e+00 | 2.07e-64 | 3.01e-102 | 0.6356 |
1. PBF | A8ET78 | Ribonuclease Y | 0.00e+00 | 9.68e-73 | 6.07e-108 | 0.5405 |
1. PBF | P0DF20 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.6863 |
1. PBF | Q38YD8 | Ribonuclease Y | 0.00e+00 | 3.32e-67 | 3.65e-111 | 0.5579 |
1. PBF | Q895I4 | Ribonuclease Y | 0.00e+00 | 5.49e-49 | 9.75e-115 | 0.7065 |
1. PBF | Q732U7 | Ribonuclease Y | 0.00e+00 | 5.63e-64 | 2.40e-112 | 0.6236 |
1. PBF | Q5M171 | Ribonuclease Y | 0.00e+00 | 1.20e-63 | 4.72e-113 | 0.69 |
1. PBF | A8FMR4 | Ribonuclease Y | 0.00e+00 | 1.06e-69 | 4.17e-109 | 0.5389 |
1. PBF | A5FPE4 | Ribonuclease Y | 0.00e+00 | 2.07e-64 | 3.01e-102 | 0.6408 |
1. PBF | A8Z1V7 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6461 |
1. PBF | Q9CEE2 | Ribonuclease Y | 0.00e+00 | 3.25e-62 | 1.71e-111 | 0.6814 |
1. PBF | P67282 | Ribonuclease Y | 0.00e+00 | 1.47e-56 | 2.20e-116 | 0.7324 |
1. PBF | Q72HM1 | Ribonuclease Y | 0.00e+00 | 1.01e-34 | 1.57e-93 | 0.6787 |
1. PBF | Q0SN03 | Ribonuclease Y | 0.00e+00 | 7.45e-71 | 7.00e-106 | 0.6608 |
1. PBF | Q1J5I5 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.629 |
1. PBF | A7I2Y9 | Ribonuclease Y | 0.00e+00 | 1.05e-74 | 4.85e-117 | 0.5325 |
1. PBF | A5N857 | Ribonuclease Y | 0.00e+00 | 1.53e-68 | 5.71e-119 | 0.6746 |
1. PBF | A0M2K0 | Ribonuclease Y | 0.00e+00 | 6.61e-68 | 6.17e-98 | 0.6746 |
1. PBF | A5I4H8 | Ribonuclease Y | 0.00e+00 | 3.89e-68 | 8.17e-114 | 0.7086 |
1. PBF | Q8P000 | Ribonuclease Y | 0.00e+00 | 3.46e-66 | 3.25e-108 | 0.645 |
1. PBF | A9WJM3 | Ribonuclease Y | 0.00e+00 | 3.16e-66 | 6.87e-96 | 0.6051 |
1. PBF | A7GFZ1 | Ribonuclease Y | 0.00e+00 | 4.69e-68 | 5.79e-114 | 0.6916 |
1. PBF | A9KMU8 | Ribonuclease Y | 0.00e+00 | 2.76e-73 | 2.12e-123 | 0.7036 |
1. PBF | Q2RJJ4 | Ribonuclease Y | 0.00e+00 | 7.52e-60 | 6.50e-112 | 0.747 |
1. PBF | A7H2G9 | Ribonuclease Y | 0.00e+00 | 1.02e-68 | 1.08e-106 | 0.5347 |
1. PBF | Q1JKP5 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.6594 |
1. PBF | P47376 | Ribonuclease Y | 1.18e-12 | 2.60e-11 | 2.62e-21 | 0.4772 |
1. PBF | A0RNB3 | Ribonuclease Y | 0.00e+00 | 1.09e-70 | 1.45e-110 | 0.5297 |
1. PBF | Q47RS4 | Ribonuclease Y | 0.00e+00 | 1.41e-69 | 2.34e-104 | 0.6742 |
1. PBF | Q03R31 | Ribonuclease Y 1 | 0.00e+00 | 1.04e-61 | 2.97e-102 | 0.5253 |
1. PBF | A1BEZ9 | Ribonuclease Y | 0.00e+00 | 2.02e-71 | 2.11e-94 | 0.5635 |
1. PBF | O83981 | Ribonuclease Y | 0.00e+00 | 3.38e-72 | 7.39e-109 | 0.6676 |
1. PBF | Q5HPQ5 | Ribonuclease Y | 0.00e+00 | 4.66e-72 | 6.29e-100 | 0.6822 |
1. PBF | Q7VIL7 | Ribonuclease Y | 0.00e+00 | 7.49e-73 | 8.76e-99 | 0.5338 |
1. PBF | A5UQ59 | Ribonuclease Y | 0.00e+00 | 1.12e-57 | 6.97e-104 | 0.6576 |
1. PBF | Q9ZL83 | Ribonuclease Y | 0.00e+00 | 1.11e-56 | 2.45e-76 | 0.6691 |
1. PBF | A6GYR0 | Ribonuclease Y | 0.00e+00 | 1.90e-68 | 3.81e-97 | 0.6663 |
1. PBF | Q6GHE9 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6713 |
1. PBF | Q5WFX6 | Ribonuclease Y | 0.00e+00 | 4.96e-67 | 6.26e-109 | 0.6803 |
1. PBF | A1AU84 | Ribonuclease Y | 0.00e+00 | 3.10e-70 | 8.53e-102 | 0.6995 |
1. PBF | A9NGL9 | Ribonuclease Y | 0.00e+00 | 1.55e-70 | 3.42e-107 | 0.689 |
1. PBF | B1AI70 | Ribonuclease Y | 1.11e-16 | 4.44e-47 | 2.40e-72 | 0.7075 |
1. PBF | Q636P8 | Ribonuclease Y | 0.00e+00 | 9.69e-65 | 1.29e-111 | 0.6048 |
1. PBF | Q7MAR9 | Ribonuclease Y | 0.00e+00 | 9.12e-72 | 1.56e-113 | 0.5609 |
1. PBF | A6Q7V0 | Ribonuclease Y | 0.00e+00 | 9.82e-66 | 7.87e-105 | 0.5358 |
1. PBF | A0LLF4 | Ribonuclease Y | 0.00e+00 | 2.87e-71 | 1.24e-113 | 0.7128 |
1. PBF | A3DEE4 | Ribonuclease Y | 0.00e+00 | 2.03e-72 | 3.33e-126 | 0.6828 |
1. PBF | B1LAG5 | Ribonuclease Y | 0.00e+00 | 1.46e-66 | 1.27e-104 | 0.5686 |
1. PBF | A4VTE9 | Ribonuclease Y | 0.00e+00 | 4.84e-64 | 5.13e-116 | 0.6975 |
1. PBF | Q74KB1 | Ribonuclease Y | 0.00e+00 | 3.24e-63 | 4.87e-116 | 0.6349 |
1. PBF | Q04J36 | Ribonuclease Y | 0.00e+00 | 6.62e-57 | 3.44e-116 | 0.6948 |
1. PBF | P75506 | Ribonuclease Y | 8.94e-14 | 3.10e-15 | 1.04e-19 | 0.4316 |
1. PBF | Q30SA7 | Ribonuclease Y | 0.00e+00 | 8.08e-74 | 2.56e-109 | 0.5233 |
1. PBF | Q7MX21 | Ribonuclease Y | 0.00e+00 | 2.27e-73 | 1.40e-102 | 0.6666 |
1. PBF | B1ZQ93 | Ribonuclease Y | 0.00e+00 | 3.32e-67 | 1.89e-103 | 0.6309 |
1. PBF | Q728D2 | Ribonuclease Y | 0.00e+00 | 3.38e-72 | 5.00e-112 | 0.6471 |
1. PBF | Q81A17 | Ribonuclease Y | 0.00e+00 | 1.11e-65 | 1.21e-111 | 0.6671 |
1. PBF | Q03M43 | Ribonuclease Y | 0.00e+00 | 7.07e-63 | 6.87e-113 | 0.6774 |
1. PBF | Q89ZG0 | Ribonuclease Y | 0.00e+00 | 4.10e-72 | 4.93e-106 | 0.6777 |
1. PBF | A7X1S5 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.7026 |
1. PBF | Q18BJ3 | Ribonuclease Y | 0.00e+00 | 1.29e-72 | 8.96e-107 | 0.7035 |
1. PBF | Q17Y14 | Ribonuclease Y | 0.00e+00 | 3.72e-60 | 3.94e-76 | 0.6748 |
1. PBF | P67283 | Ribonuclease Y | 0.00e+00 | 1.47e-56 | 2.20e-116 | 0.7332 |
1. PBF | O67622 | Ribonuclease Y | 0.00e+00 | 3.03e-42 | 7.91e-106 | 0.7038 |
1. PBF | Q6A900 | Ribonuclease Y | 0.00e+00 | 6.64e-58 | 1.89e-94 | 0.6082 |
1. PBF | B1HR37 | Ribonuclease Y | 0.00e+00 | 5.08e-63 | 5.01e-111 | 0.6849 |
1. PBF | A4X4U3 | Ribonuclease Y | 0.00e+00 | 2.07e-40 | 1.95e-97 | 0.7179 |
1. PBF | Q8CSS7 | Ribonuclease Y | 0.00e+00 | 4.66e-72 | 6.29e-100 | 0.6839 |
1. PBF | A5FNQ7 | Ribonuclease Y | 0.00e+00 | 5.62e-67 | 8.36e-98 | 0.6641 |
1. PBF | B1II34 | Ribonuclease Y | 0.00e+00 | 8.22e-68 | 5.60e-114 | 0.7091 |
1. PBF | B0K9M9 | Ribonuclease Y | 0.00e+00 | 1.12e-68 | 8.53e-120 | 0.6596 |
1. PBF | P0DF21 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.6543 |
1. PBF | Q5M5Q8 | Ribonuclease Y | 0.00e+00 | 1.20e-63 | 4.72e-113 | 0.6629 |
1. PBF | P67281 | Ribonuclease Y | 0.00e+00 | 4.79e-62 | 6.75e-112 | 0.65 |
1. PBF | A7NHM5 | Ribonuclease Y | 0.00e+00 | 1.36e-57 | 8.92e-104 | 0.6406 |
1. PBF | A5D2N5 | Ribonuclease Y | 0.00e+00 | 8.08e-52 | 7.32e-110 | 0.7313 |
1. PBF | Q3ACX1 | Ribonuclease Y | 0.00e+00 | 7.03e-68 | 1.17e-119 | 0.6778 |
1. PBF | A6LSR9 | Ribonuclease Y | 0.00e+00 | 1.88e-74 | 9.47e-118 | 0.6962 |
1. PBF | Q6ML54 | Ribonuclease Y 2 | 3.11e-15 | 5.34e-35 | 2.38e-59 | 0.5672 |
1. PBF | Q5SHB3 | Ribonuclease Y | 0.00e+00 | 2.58e-34 | 9.51e-94 | 0.6912 |
1. PBF | Q3A218 | Ribonuclease Y | 0.00e+00 | 2.41e-64 | 9.04e-111 | 0.7035 |
1. PBF | A4XLD4 | Ribonuclease Y | 0.00e+00 | 1.14e-75 | 1.50e-118 | 0.7128 |
1. PBF | O51457 | Ribonuclease Y | 0.00e+00 | 2.77e-74 | 1.28e-105 | 0.6686 |
1. PBF | Q5L0F4 | Ribonuclease Y | 0.00e+00 | 9.51e-60 | 2.88e-113 | 0.7079 |
1. PBF | Q6MTI6 | Ribonuclease Y | 0.00e+00 | 3.21e-123 | 0.0 | 0.721 |
1. PBF | Q0SSE8 | Ribonuclease Y | 0.00e+00 | 2.41e-75 | 3.84e-113 | 0.7015 |
1. PBF | A6L227 | Ribonuclease Y | 0.00e+00 | 1.53e-68 | 2.48e-107 | 0.6945 |
1. PBF | B0S1D0 | Ribonuclease Y | 0.00e+00 | 2.30e-71 | 6.73e-116 | 0.6322 |
1. PBF | A7GRA8 | Ribonuclease Y | 0.00e+00 | 1.59e-62 | 1.41e-113 | 0.653 |
1. PBF | A8L6J3 | Ribonuclease Y | 0.00e+00 | 6.41e-47 | 6.32e-90 | 0.6072 |
1. PBF | Q2SRU2 | Ribonuclease Y | 0.00e+00 | 9.31e-120 | 0.0 | 0.6167 |
1. PBF | Q313W7 | Ribonuclease Y | 0.00e+00 | 1.84e-72 | 1.60e-114 | 0.6169 |
1. PBF | A7HMK7 | Ribonuclease Y | 0.00e+00 | 8.22e-68 | 2.89e-100 | 0.6641 |
1. PBF | Q24W62 | Ribonuclease Y | 0.00e+00 | 5.00e-66 | 1.53e-105 | 0.7083 |
1. PBF | A0LV02 | Ribonuclease Y | 0.00e+00 | 1.57e-63 | 4.40e-100 | 0.8232 |
1. PBF | Q49X74 | Ribonuclease Y | 0.00e+00 | 1.73e-71 | 8.50e-111 | 0.6587 |
1. PBF | P67284 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.6661 |
1. PBF | B1I3H5 | Ribonuclease Y | 0.00e+00 | 2.70e-71 | 3.98e-110 | 0.706 |
1. PBF | Q6F1Q9 | Ribonuclease Y | 0.00e+00 | 1.45e-83 | 0.0 | 0.7043 |
1. PBF | A7GY23 | Ribonuclease Y | 0.00e+00 | 4.34e-71 | 9.52e-116 | 0.5585 |
1. PBF | O31774 | Ribonuclease Y | 0.00e+00 | 6.76e-67 | 5.70e-110 | 0.6816 |
1. PBF | B0K1B6 | Ribonuclease Y | 0.00e+00 | 5.66e-68 | 2.01e-120 | 0.7048 |
1. PBF | A6LM64 | Ribonuclease Y | 0.00e+00 | 2.36e-68 | 3.58e-106 | 0.5777 |
1. PBF | Q2FHF2 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6579 |
1. PBF | Q6G9S7 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6735 |
1. PBF | Q1JAJ3 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.6594 |
1. PBF | A7Z4W7 | Ribonuclease Y | 0.00e+00 | 2.44e-67 | 1.46e-109 | 0.6936 |
1. PBF | Q1CTB0 | Ribonuclease Y | 0.00e+00 | 1.81e-58 | 1.46e-76 | 0.6557 |
1. PBF | A1VAZ2 | Ribonuclease Y | 0.00e+00 | 3.38e-72 | 5.00e-112 | 0.6205 |
1. PBF | Q3Z646 | Ribonuclease Y | 0.00e+00 | 2.27e-64 | 4.85e-103 | 0.67 |
1. PBF | Q5HTQ5 | Ribonuclease Y | 0.00e+00 | 1.17e-69 | 3.86e-109 | 0.5374 |
1. PBF | A0Q0P3 | Ribonuclease Y | 0.00e+00 | 2.56e-64 | 1.34e-115 | 0.6875 |
1. PBF | Q8RA57 | Ribonuclease Y | 0.00e+00 | 1.55e-69 | 1.92e-116 | 0.6492 |
1. PBF | B1I7K2 | Ribonuclease Y | 0.00e+00 | 6.62e-57 | 3.44e-116 | 0.7212 |
1. PBF | Q9RRM6 | Ribonuclease Y | 0.00e+00 | 3.73e-48 | 5.93e-95 | 0.6324 |
1. PBF | Q03AP9 | Ribonuclease Y | 0.00e+00 | 2.61e-65 | 1.19e-103 | 0.5627 |
1. PBF | Q1GB50 | Ribonuclease Y | 0.00e+00 | 2.70e-65 | 1.22e-121 | 0.6148 |
1. PBF | Q7UNE3 | Ribonuclease Y | 0.00e+00 | 1.65e-69 | 1.96e-103 | 0.6167 |
1. PBF | Q04BJ7 | Ribonuclease Y | 0.00e+00 | 2.70e-65 | 1.22e-121 | 0.583 |
1. PBF | Q1JFN6 | Ribonuclease Y | 0.00e+00 | 1.11e-66 | 4.21e-108 | 0.6729 |
1. PBF | Q64Q86 | Ribonuclease Y | 0.00e+00 | 1.00e-72 | 3.17e-106 | 0.6936 |
1. PBF | Q8DVK7 | Ribonuclease Y | 0.00e+00 | 2.31e-65 | 5.99e-116 | 0.7133 |
1. PBF | Q48S17 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.6548 |
1. PBF | A9BEV4 | Ribonuclease Y | 0.00e+00 | 2.12e-70 | 7.62e-113 | 0.6462 |
1. PBF | Q03VG1 | Ribonuclease Y | 0.00e+00 | 1.60e-66 | 3.49e-104 | 0.6097 |
1. PBF | Q8EVM0 | Ribonuclease Y | 0.00e+00 | 2.33e-27 | 2.45e-76 | 0.8451 |
1. PBF | A4SF67 | Ribonuclease Y | 0.00e+00 | 9.12e-72 | 3.40e-91 | 0.5727 |
1. PBF | Q39WF6 | Ribonuclease Y | 0.00e+00 | 2.44e-68 | 2.18e-104 | 0.687 |
1. PBF | Q2NJ28 | Ribonuclease Y | 0.00e+00 | 4.69e-68 | 1.01e-112 | 0.7165 |
1. PBF | Q0AXJ1 | Ribonuclease Y | 0.00e+00 | 6.82e-68 | 2.72e-105 | 0.705 |
1. PBF | Q81WQ4 | Ribonuclease Y | 0.00e+00 | 9.69e-65 | 1.29e-111 | 0.5833 |
1. PBF | A4VZM7 | Ribonuclease Y | 0.00e+00 | 4.84e-64 | 5.13e-116 | 0.713 |
1. PBF | Q1WT14 | Ribonuclease Y | 0.00e+00 | 1.63e-67 | 1.13e-111 | 0.5701 |
1. PBF | A4J5T7 | Ribonuclease Y | 0.00e+00 | 4.25e-70 | 4.13e-113 | 0.7027 |
1. PBF | Q8EQR7 | Ribonuclease Y | 0.00e+00 | 2.18e-65 | 1.53e-111 | 0.7042 |
1. PBF | B0TII8 | Ribonuclease Y | 0.00e+00 | 4.98e-70 | 2.52e-101 | 0.69 |
1. PBF | Q2YXN1 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6924 |
1. PBF | Q8XJT1 | Ribonuclease Y | 0.00e+00 | 1.60e-74 | 8.66e-114 | 0.7019 |
1. PBF | P67280 | Ribonuclease Y | 0.00e+00 | 4.79e-62 | 6.75e-112 | 0.648 |
1. PBF | A4IMH1 | Ribonuclease Y | 0.00e+00 | 2.14e-62 | 3.87e-112 | 0.6106 |
1. PBF | A0AIK1 | Ribonuclease Y | 0.00e+00 | 7.89e-67 | 1.20e-109 | 0.6943 |
1. PBF | Q3AQC9 | Ribonuclease Y | 0.00e+00 | 4.37e-69 | 6.01e-90 | 0.5678 |
1. PBF | O25455 | Ribonuclease Y | 0.00e+00 | 2.15e-58 | 1.01e-76 | 0.6856 |
1. PBF | P0A4Q7 | Ribonuclease Y | 0.00e+00 | 2.25e-66 | 1.42e-109 | 0.6645 |
1. PBF | A0L5J3 | Ribonuclease Y | 0.00e+00 | 1.31e-68 | 8.29e-114 | 0.5994 |
1. PBF | Q11W14 | Ribonuclease Y | 0.00e+00 | 2.89e-64 | 7.92e-95 | 0.6438 |
1. PBF | Q6MNQ3 | Ribonuclease Y 1 | 0.00e+00 | 4.86e-61 | 2.27e-97 | 0.7149 |
1. PBF | Q2LRA0 | Ribonuclease Y | 0.00e+00 | 1.50e-70 | 1.04e-108 | 0.6341 |
1. PBF | Q5XAP0 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.6365 |
1. PBF | Q8RHT2 | Ribonuclease Y | 0.00e+00 | 1.35e-59 | 4.85e-97 | 0.6639 |
1. PBF | A5ISH0 | Ribonuclease Y | 0.00e+00 | 3.87e-70 | 2.13e-106 | 0.675 |
1. PBF | Q6YQV1 | Ribonuclease Y | 0.00e+00 | 8.25e-70 | 3.78e-108 | 0.7114 |
1. PBF | B2A3V6 | Ribonuclease Y | 0.00e+00 | 3.63e-40 | 1.05e-114 | 0.7335 |
1. PBF | Q1AW41 | Ribonuclease Y | 0.00e+00 | 3.89e-65 | 7.28e-107 | 0.7825 |
1. PBF | Q6MCB9 | Ribonuclease Y | 0.00e+00 | 1.69e-76 | 4.83e-93 | 0.656 |
1. PBF | Q67NH9 | Ribonuclease Y | 0.00e+00 | 6.66e-63 | 4.51e-112 | 0.685 |
1. PBF | P67279 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.644 |
1. PBF | A6QGI5 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6851 |
1. PBF | Q0RDW7 | Ribonuclease Y | 0.00e+00 | 1.41e-04 | 5.05e-94 | 0.698 |
1. PBF | A8FDG4 | Ribonuclease Y | 0.00e+00 | 6.16e-67 | 2.79e-114 | 0.6293 |
1. PBF | G2JZ15 | Ribonuclease Y | 0.00e+00 | 2.25e-66 | 1.42e-109 | 0.6097 |
1. PBF | Q71ZS1 | Ribonuclease Y | 0.00e+00 | 2.25e-66 | 1.42e-109 | 0.6992 |
1. PBF | A2RN36 | Ribonuclease Y | 0.00e+00 | 3.25e-62 | 1.97e-108 | 0.7013 |
1. PBF | Q6AJ81 | Ribonuclease Y | 0.00e+00 | 7.42e-76 | 1.07e-109 | 0.6878 |
1. PBF | Q03E93 | Ribonuclease Y 2 | 0.00e+00 | 1.23e-73 | 2.39e-78 | 0.6284 |
1. PBF | A6TRJ1 | Ribonuclease Y | 0.00e+00 | 1.35e-41 | 2.94e-110 | 0.801 |
1. PBF | A5GAT3 | Ribonuclease Y | 0.00e+00 | 1.33e-65 | 2.86e-106 | 0.6858 |
1. PBF | A8M7V7 | Ribonuclease Y | 0.00e+00 | 1.42e-39 | 7.95e-95 | 0.7437 |
1. PBF | Q661B6 | Ribonuclease Y | 0.00e+00 | 1.38e-72 | 1.05e-106 | 0.6564 |
1. PBF | Q9PR60 | Ribonuclease Y | 0.00e+00 | 4.44e-47 | 2.40e-72 | 0.7402 |
1. PBF | A2RD66 | Ribonuclease Y | 0.00e+00 | 2.62e-66 | 1.71e-108 | 0.6618 |
1. PBF | Q5L9Y0 | Ribonuclease Y | 0.00e+00 | 1.00e-72 | 3.17e-106 | 0.6325 |
1. PBF | Q03NQ6 | Ribonuclease Y 2 | 0.00e+00 | 4.97e-57 | 1.50e-87 | 0.6339 |
1. PBF | A8MFC3 | Ribonuclease Y | 0.00e+00 | 2.37e-71 | 2.58e-113 | 0.718 |
1. PBF | A8AVU9 | Ribonuclease Y | 0.00e+00 | 1.24e-58 | 1.35e-113 | 0.6404 |
1. PBF | Q5HGE5 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | 0.6876 |
2. PF | P47369 | Uncharacterized protein MG123 | 6.62e-09 | 7.72e-04 | NA | 0.4319 |
2. PF | P75513 | Uncharacterized protein MG123 homolog | 6.20e-06 | 2.62e-03 | NA | 0.2987 |
4. PB | Q2FZ08 | Ribonuclease Y | 0.00e+00 | 4.53e-70 | 8.41e-105 | NA |
5. P | P46344 | Cyclic-di-AMP phosphodiesterase PgpH | 5.29e-03 | 2.33e-02 | NA | NA |
6. F | Q1MKQ6 | Glycine--tRNA ligase beta subunit | 6.06e-03 | NA | NA | 0.2737 |
6. F | A9CK39 | Glycine--tRNA ligase beta subunit | 5.86e-03 | NA | NA | 0.2885 |
6. F | Q2KBT5 | Glycine--tRNA ligase beta subunit | 6.81e-03 | NA | NA | 0.2735 |
7. B | P47482 | Uncharacterized protein MG240 | 2.05e-02 | NA | 0.007 | NA |
7. B | Q6DB17 | Glycine--tRNA ligase beta subunit | 2.90e-01 | NA | 0.005 | NA |
7. B | Q7VKG6 | Glycine--tRNA ligase beta subunit | 3.02e-01 | NA | 0.020 | NA |
7. B | C3LP93 | Glycine--tRNA ligase beta subunit | 2.79e-01 | NA | 0.025 | NA |
7. B | B5FEW0 | Glycine--tRNA ligase beta subunit | 2.71e-01 | NA | 0.008 | NA |
7. B | A5UI65 | Glycine--tRNA ligase beta subunit | 1.43e-02 | NA | 0.045 | NA |
7. B | A9MLF8 | Glycine--tRNA ligase beta subunit | 1.26e-02 | NA | 0.016 | NA |
7. B | C6DII7 | Glycine--tRNA ligase beta subunit | 2.29e-02 | NA | 0.008 | NA |
7. B | B8F711 | Glycine--tRNA ligase beta subunit | 2.92e-01 | NA | 0.025 | NA |
7. B | A1JT50 | Glycine--tRNA ligase beta subunit | 1.19e-02 | NA | 0.028 | NA |
7. B | Q7MB99 | Glycine--tRNA ligase beta subunit | 2.90e-01 | NA | 0.026 | NA |
7. B | Q5E8Y5 | Glycine--tRNA ligase beta subunit | 2.85e-01 | NA | 0.015 | NA |
7. B | B2VCH1 | Glycine--tRNA ligase beta subunit | 1.20e-02 | NA | 0.026 | NA |
7. B | A4W573 | Glycine--tRNA ligase beta subunit | 1.15e-02 | NA | 6.73e-04 | NA |
7. B | A5F487 | Glycine--tRNA ligase beta subunit | 2.81e-01 | NA | 0.025 | NA |
7. B | Q6LW15 | Glycine--tRNA ligase beta subunit | 2.70e-01 | NA | 0.022 | NA |
7. B | A7MKS3 | Glycine--tRNA ligase beta subunit | 1.15e-02 | NA | 0.004 | NA |
7. B | Q979R3 | tRNA (cytidine(56)-2'-O)-methyltransferase | 2.92e-02 | NA | 0.023 | NA |
7. B | Q328L9 | Glycine--tRNA ligase beta subunit | 3.02e-01 | NA | 0.049 | NA |
7. B | C4L762 | Glycine--tRNA ligase beta subunit | 1.23e-02 | NA | 0.045 | NA |
7. B | A6VLE1 | Glycine--tRNA ligase beta subunit | 2.11e-02 | NA | 0.004 | NA |
7. B | C4K460 | Glycine--tRNA ligase beta subunit | 5.35e-03 | NA | 0.005 | NA |
7. B | Q9KVW8 | Glycine--tRNA ligase beta subunit | 2.83e-01 | NA | 0.025 | NA |
7. B | Q0I273 | Glycine--tRNA ligase beta subunit | 6.82e-03 | NA | 0.002 | NA |
7. B | B4EZ95 | Glycine--tRNA ligase beta subunit | 1.05e-02 | NA | 0.003 | NA |
7. B | Q7MQI8 | Glycine--tRNA ligase beta subunit | 2.85e-01 | NA | 0.022 | NA |
7. B | B0UWA9 | Glycine--tRNA ligase beta subunit | 1.26e-02 | NA | 0.008 | NA |
7. B | A6TFH4 | Glycine--tRNA ligase beta subunit | 1.16e-02 | NA | 0.027 | NA |
7. B | Q65R47 | Glycine--tRNA ligase beta subunit | 1.21e-02 | NA | 0.004 | NA |
7. B | B5XMY7 | Glycine--tRNA ligase beta subunit | 2.94e-01 | NA | 0.020 | NA |
7. B | Q05626 | Uncharacterized protein Cbei_0205 | 3.48e-03 | NA | 4.66e-04 | NA |
7. B | P57905 | Glycine--tRNA ligase beta subunit | 2.82e-02 | NA | 0.029 | NA |
7. B | B6EGT3 | Glycine--tRNA ligase beta subunit | 5.41e-03 | NA | 0.009 | NA |