Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54737.1
JCVISYN3A_0360
Signal recognition particle protein.
M. mycoides homolog: Q6MTI5.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 38
Unique PROST Go: 7
Unique BLAST Go: 3
Unique Foldseek Go: 3
Total Homologs: 229
Unique PROST Homologs: 27
Unique BLAST Homologs: 12
Unique Foldseek Homologs: 38
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
O59307
(Signal recognition particle 54 kDa protein) with a FATCAT P-Value: 0 and RMSD of 2.53 angstrom. The sequence alignment identity is 36.1%.
Structural alignment shown in left. Query protein AVX54737.1 colored as red in alignment, homolog O59307 colored as blue.
Query protein AVX54737.1 is also shown in right top, homolog O59307 showed in right bottom. They are colored based on secondary structures.
AVX54737.1 MGFGDFLSKRMQKSIEKNMKNSTLNEENIKETLKEIRLSLLEADVNIEAAKEIINNVKQKAL-----GGYISEGASAHQQMIKIVHEELVNILGKENAPL 95 O59307 MVL-DSLGRALSNALKKIARAGSVDEALVKEVVRDIQRALLQADVNVRLVLKLTKEIQRRALEEKPPAG-ISK--KEH--IIKIVYEELTKFLGTEAKPI 94 AVX54737.1 DINKKPSVVMMVGLQGSGKTTTANKLA-YLLNKKNKKKVLLVGL---DIYRPGAIEQLVQLGQKTNTQVF-EKGKQDPVKTAEQALQYAKENNFDVVILD 190 O59307 EIKEKPTVLLTVGVQGSGKTTTVAKLARY-FQKRGYK----VGVVCSDTWRPGAYHQLKQLLDPYHIEVFGDPNEKDAVKLAKEGVEYFKTRDVDLIIVD 189 AVX54737.1 TAGRLQVDQFLMKELDNLKKKTSPNEILLVVDGMSGQEIINVTNEFNSKLKLSGVVVTKLDGDARGGATLSISYLTKLPIKFIGEGEGYNALAAFYPKRM 290 O59307 TAGRHKEEKDLIEEMRMISEEIRPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDSSAKGGGALSAVAATGAPIKFIGVGEKIDDLEPFDPARF 289 AVX54737.1 ADRLMGMGDIETLFERAVENIDERSIQKT---MNRMFL-GQFDLEDLRNQLAQIAKMGSLNKLMKMLP-IN-KVSESQIQDAQRKLAVFSILMDSMTLKE 384 O59307 VSRLLGLGDIQGLLEKFKE-L-EKEVEFTEEDIDR-FLRGKFTLKDMYAQLEAMRKMGPLKQILRMIPGLGYSLPDELISVGEERLRKFKVIMDSMTEEE 386 AVX54737.1 RRDPRVLKAISRKNRIIKGSGRSEKEFNELINSFEKGKKQVLEITK-MIKSGRMPNLSKGGFKF-- 447 O59307 LMNPEIIN-YSRIKRIARGSGTSIKDVKELLTQYNQMKK----FFKSMNK--R--QLSRLARRFGM 443
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006617 | SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition |
| 1. PBF | GO:0006614 | SRP-dependent cotranslational protein targeting to membrane |
| 1. PBF | GO:0019003 | GDP binding |
| 1. PBF | GO:0045047 | protein targeting to ER |
| 1. PBF | GO:0005786 | signal recognition particle, endoplasmic reticulum targeting |
| 1. PBF | GO:0003924 | GTPase activity |
| 1. PBF | GO:0031017 | exocrine pancreas development |
| 1. PBF | GO:0008312 | 7S RNA binding |
| 1. PBF | GO:0048500 | signal recognition particle |
| 1. PBF | GO:0016607 | nuclear speck |
| 1. PBF | GO:0043021 | ribonucleoprotein complex binding |
| 1. PBF | GO:0030851 | granulocyte differentiation |
| 1. PBF | GO:0030593 | neutrophil chemotaxis |
| 1. PBF | GO:0030942 | endoplasmic reticulum signal peptide binding |
| 1. PBF | GO:0006616 | SRP-dependent cotranslational protein targeting to membrane, translocation |
| 1. PBF | GO:0005525 | GTP binding |
| 3. BF | GO:0005785 | signal recognition particle receptor complex |
| 3. BF | GO:0016020 | membrane |
| 3. BF | GO:0005524 | ATP binding |
| 3. BF | GO:0031226 | intrinsic component of plasma membrane |
| 3. BF | GO:0006605 | protein targeting |
| 3. BF | GO:0005047 | signal recognition particle binding |
| 3. BF | GO:0044781 | bacterial-type flagellum organization |
| 4. PB | GO:0070208 | protein heterotrimerization |
| 4. PB | GO:0005783 | endoplasmic reticulum |
| 5. P | GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism |
| 5. P | GO:0009399 | nitrogen fixation |
| 5. P | GO:0016163 | nitrogenase activity |
| 5. P | GO:0018697 | carbonyl sulfide nitrogenase activity |
| 5. P | GO:0005737 | cytoplasm |
| 5. P | GO:0045261 | proton-transporting ATP synthase complex, catalytic core F(1) |
| 5. P | GO:0046961 | proton-transporting ATPase activity, rotational mechanism |
| 6. F | GO:0048472 | threonine-phosphate decarboxylase activity |
| 6. F | GO:0006807 | nitrogen compound metabolic process |
| 6. F | GO:0016151 | nickel cation binding |
| 7. B | GO:0006613 | cotranslational protein targeting to membrane |
| 7. B | GO:0005789 | endoplasmic reticulum membrane |
| 7. B | GO:0046872 | metal ion binding |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0003723 | RNA binding |
| GO:1990904 | ribonucleoprotein complex |
| GO:0008312 | 7S RNA binding |
| GO:0003924 | GTPase activity |
| GO:0048500 | signal recognition particle |
| GO:0005737 | cytoplasm |
| GO:0006614 | SRP-dependent cotranslational protein targeting to membrane |
| GO:0006612 | protein targeting to membrane |
| GO:0000166 | nucleotide binding |
| GO:0005525 | GTP binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P75054 | Signal recognition particle protein | 0.00e+00 | 2.26e-51 | 7.25e-130 | 0.8887 |
| 1. PBF | A3DML3 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.38e-43 | 1.00e-64 | 0.6115 |
| 1. PBF | Q977V2 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.06e-27 | 1.23e-69 | 0.8449 |
| 1. PBF | Q4R965 | Signal recognition particle 54 kDa protein | 0.00e+00 | 8.95e-15 | 1.39e-61 | 0.8842 |
| 1. PBF | C3NDW4 | Signal recognition particle 54 kDa protein | 0.00e+00 | 3.41e-45 | 3.19e-67 | 0.6015 |
| 1. PBF | A1RS43 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.54e-47 | 5.09e-67 | 0.6385 |
| 1. PBF | A9A9B0 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.37e-46 | 3.28e-79 | 0.8881 |
| 1. PBF | A4FVX4 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.14e-47 | 3.77e-74 | 0.8918 |
| 1. PBF | Q92J55 | Signal recognition particle protein | 0.00e+00 | 4.09e-50 | 7.97e-96 | 0.6334 |
| 1. PBF | Q2NE47 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.55e-47 | 1.32e-84 | 0.931 |
| 1. PBF | O29633 | Signal recognition particle 54 kDa protein | 0.00e+00 | 8.34e-49 | 8.24e-73 | 0.8935 |
| 1. PBF | P49968 | Signal recognition particle 54 kDa protein 1 | 0.00e+00 | 1.40e-16 | 4.48e-61 | 0.9017 |
| 1. PBF | Q01442 | Signal recognition particle protein | 0.00e+00 | 1.70e-95 | 0.0 | 0.9801 |
| 1. PBF | Q8PXF3 | Signal recognition particle 54 kDa protein | 0.00e+00 | 6.38e-48 | 2.27e-72 | 0.8976 |
| 1. PBF | P49971 | Signal recognition particle 54 kDa protein 1 | 0.00e+00 | 4.89e-18 | 1.43e-58 | 0.8837 |
| 1. PBF | P47294 | Signal recognition particle protein | 0.00e+00 | 1.60e-56 | 6.65e-129 | 0.8808 |
| 1. PBF | P74214 | Signal recognition particle protein | 0.00e+00 | 6.89e-22 | 2.48e-119 | 0.8783 |
| 1. PBF | P9WGD6 | Signal recognition particle protein | 0.00e+00 | 3.31e-12 | 8.40e-92 | 0.6498 |
| 1. PBF | Q46E01 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.93e-49 | 9.16e-75 | 0.8936 |
| 1. PBF | A5UMY7 | Signal recognition particle 54 kDa protein | 0.00e+00 | 3.13e-45 | 6.26e-83 | 0.6196 |
| 1. PBF | Q89AE4 | Signal recognition particle protein | 0.00e+00 | 1.80e-44 | 2.05e-98 | 0.6595 |
| 1. PBF | Q6LX03 | Signal recognition particle 54 kDa protein | 0.00e+00 | 9.91e-48 | 1.68e-74 | 0.8832 |
| 1. PBF | B1Y9L4 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.72e-47 | 1.53e-68 | 0.6442 |
| 1. PBF | P44518 | Signal recognition particle protein | 0.00e+00 | 2.08e-34 | 2.56e-99 | 0.9254 |
| 1. PBF | B6YSS1 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.92e-44 | 4.62e-88 | 0.9003 |
| 1. PBF | O07347 | Signal recognition particle protein | 0.00e+00 | 2.45e-46 | 3.91e-88 | 0.876 |
| 1. PBF | C3NHT9 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.37e-44 | 3.82e-67 | 0.6002 |
| 1. PBF | P0AGD8 | Signal recognition particle protein | 0.00e+00 | 4.76e-41 | 1.18e-104 | 0.6505 |
| 1. PBF | O33013 | Signal recognition particle protein | 0.00e+00 | 1.51e-17 | 6.76e-95 | 0.6439 |
| 1. PBF | Q12ZG8 | Signal recognition particle 54 kDa protein | 0.00e+00 | 7.49e-50 | 2.39e-83 | 0.8727 |
| 1. PBF | Q8TUY9 | Signal recognition particle 54 kDa protein | 0.00e+00 | 7.62e-41 | 7.30e-81 | 0.6205 |
| 1. PBF | P49969 | Signal recognition particle 54 kDa protein 2 | 0.00e+00 | 3.03e-16 | 7.89e-61 | 0.9017 |
| 1. PBF | C4KGX6 | Signal recognition particle 54 kDa protein | 0.00e+00 | 9.11e-45 | 1.03e-66 | 0.6027 |
| 1. PBF | Q8K9F7 | Signal recognition particle protein | 0.00e+00 | 1.31e-46 | 5.78e-87 | 0.6499 |
| 1. PBF | C3MYM8 | Signal recognition particle 54 kDa protein | 0.00e+00 | 9.11e-45 | 1.03e-66 | 0.6095 |
| 1. PBF | O59307 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.13e-38 | 1.07e-84 | 0.9109 |
| 1. PBF | A3MWX6 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.88e-44 | 1.29e-70 | 0.6495 |
| 1. PBF | Q68XJ4 | Signal recognition particle protein | 0.00e+00 | 5.45e-54 | 2.92e-92 | 0.643 |
| 1. PBF | Q9HKT0 | Signal recognition particle 54 kDa protein | 0.00e+00 | 6.09e-41 | 8.03e-80 | 0.6066 |
| 1. PBF | Q5R4R6 | Signal recognition particle 54 kDa protein | 0.00e+00 | 8.95e-15 | 1.39e-61 | 0.8201 |
| 1. PBF | A4WLQ3 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.30e-46 | 2.49e-64 | 0.6401 |
| 1. PBF | Q2T9U1 | Signal recognition particle 54 kDa protein | 0.00e+00 | 8.95e-15 | 1.39e-61 | 0.8342 |
| 1. PBF | Q8U070 | Signal recognition particle 54 kDa protein | 0.00e+00 | 5.57e-45 | 3.16e-88 | 0.9156 |
| 1. PBF | A2STI3 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.53e-40 | 1.00e-72 | 0.8969 |
| 1. PBF | P57473 | Signal recognition particle protein | 0.00e+00 | 8.84e-44 | 2.17e-91 | 0.6634 |
| 1. PBF | C3MPN4 | Signal recognition particle 54 kDa protein | 0.00e+00 | 3.26e-45 | 5.77e-67 | 0.6022 |
| 1. PBF | Q8MZJ6 | Signal recognition particle 54 kDa protein | 0.00e+00 | 3.66e-19 | 3.13e-66 | 0.8863 |
| 1. PBF | O42816 | Signal recognition particle 54 kDa protein homolog | 0.00e+00 | 2.16e-10 | 1.74e-54 | 0.8664 |
| 1. PBF | Q5UY20 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.38e-27 | 1.41e-71 | 0.8284 |
| 1. PBF | P49972 | Signal recognition particle 54 kDa protein 2 | 0.00e+00 | 7.24e-17 | 7.08e-60 | 0.8877 |
| 1. PBF | Q971S9 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.09e-39 | 1.42e-77 | 0.6116 |
| 1. PBF | Q979Y8 | Signal recognition particle 54 kDa protein | 0.00e+00 | 3.48e-43 | 1.05e-76 | 0.8227 |
| 1. PBF | P0AGD9 | Signal recognition particle protein | 0.00e+00 | 4.76e-41 | 1.18e-104 | 0.6507 |
| 1. PBF | Q8THD0 | Signal recognition particle 54 kDa protein | 0.00e+00 | 4.39e-48 | 4.16e-78 | 0.8841 |
| 1. PBF | P56005 | Signal recognition particle protein | 0.00e+00 | 4.19e-49 | 2.11e-78 | 0.8713 |
| 1. PBF | Q99150 | Signal recognition particle 54 kDa protein homolog | 0.00e+00 | 1.02e-08 | 9.31e-59 | 0.8476 |
| 1. PBF | O15821 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.10e-23 | 2.05e-62 | 0.8742 |
| 1. PBF | B0R7X3 | Signal recognition particle 54 kDa protein | 0.00e+00 | 6.62e-30 | 1.65e-70 | 0.8213 |
| 1. PBF | O07853 | Signal recognition particle 54 kDa protein | 0.00e+00 | 5.12e-45 | 3.19e-78 | 0.5933 |
| 1. PBF | P61010 | Signal recognition particle 54 kDa protein | 0.00e+00 | 8.95e-15 | 1.39e-61 | 0.8816 |
| 1. PBF | O67615 | Signal recognition particle protein | 0.00e+00 | 1.58e-38 | 3.38e-106 | 0.8504 |
| 1. PBF | A2BNB5 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.41e-41 | 5.98e-75 | 0.6359 |
| 1. PBF | O27376 | Signal recognition particle 54 kDa protein | 0.00e+00 | 5.71e-47 | 3.50e-73 | 0.6481 |
| 1. PBF | Q0W2G1 | Signal recognition particle 54 kDa protein | 0.00e+00 | 4.17e-42 | 8.46e-75 | 0.8693 |
| 1. PBF | Q4UKH4 | Signal recognition particle protein | 0.00e+00 | 3.25e-53 | 2.22e-94 | 0.6429 |
| 1. PBF | C5A233 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.74e-43 | 9.06e-92 | 0.905 |
| 1. PBF | Q9HMN5 | Signal recognition particle 54 kDa protein | 0.00e+00 | 6.62e-30 | 1.65e-70 | 0.8301 |
| 1. PBF | A6UQJ8 | Signal recognition particle 54 kDa protein | 0.00e+00 | 6.38e-43 | 7.91e-84 | 0.8839 |
| 1. PBF | P66845 | Signal recognition particle protein | 0.00e+00 | 3.31e-12 | 8.40e-92 | 0.6482 |
| 1. PBF | A4YHL0 | Signal recognition particle 54 kDa protein | 0.00e+00 | 5.71e-47 | 1.56e-78 | 0.6016 |
| 1. PBF | Q1RHD6 | Signal recognition particle protein | 0.00e+00 | 3.33e-53 | 7.88e-96 | 0.6378 |
| 1. PBF | Q18EV2 | Signal recognition particle 54 kDa protein | 0.00e+00 | 3.97e-28 | 1.56e-73 | 0.8533 |
| 1. PBF | Q9V1E8 | Signal recognition particle 54 kDa protein | 0.00e+00 | 3.78e-43 | 2.40e-84 | 0.9096 |
| 1. PBF | Q00179 | Signal recognition particle 54 kDa protein homolog | 0.00e+00 | 2.31e-12 | 1.22e-50 | 0.8969 |
| 1. PBF | Q5JJC8 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.91e-47 | 3.51e-90 | 0.9078 |
| 1. PBF | Q9ZDZ0 | Signal recognition particle protein | 0.00e+00 | 3.88e-55 | 8.45e-90 | 0.6441 |
| 1. PBF | Q9YB62 | Signal recognition particle 54 kDa protein | 0.00e+00 | 7.76e-40 | 5.27e-72 | 0.6278 |
| 1. PBF | A6VHE0 | Signal recognition particle 54 kDa protein | 0.00e+00 | 5.35e-48 | 2.99e-82 | 0.8901 |
| 1. PBF | P70722 | Signal recognition particle 54 kDa protein (Fragment) | 0.00e+00 | 1.63e-46 | 1.48e-73 | 0.6021 |
| 1. PBF | A0B638 | Signal recognition particle 54 kDa protein | 0.00e+00 | 5.12e-46 | 1.83e-70 | 0.9014 |
| 1. PBF | Q3IUP1 | Signal recognition particle 54 kDa protein | 0.00e+00 | 9.96e-25 | 5.01e-72 | 0.8574 |
| 1. PBF | A6UWG4 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.90e-50 | 6.07e-81 | 0.9 |
| 1. PBF | Q97ZE7 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.04e-45 | 3.25e-68 | 0.6006 |
| 1. PBF | Q9ZK62 | Signal recognition particle protein | 0.00e+00 | 1.43e-49 | 5.10e-81 | 0.8538 |
| 1. PBF | C3N5B0 | Signal recognition particle 54 kDa protein | 0.00e+00 | 9.11e-45 | 1.03e-66 | 0.6019 |
| 1. PBF | P49970 | Signal recognition particle 54 kDa protein 3 | 0.00e+00 | 6.93e-20 | 4.09e-52 | 0.9009 |
| 1. PBF | Q8ZT95 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.28e-46 | 5.94e-69 | 0.6436 |
| 1. PBF | B9LT33 | Signal recognition particle 54 kDa protein | 0.00e+00 | 1.55e-29 | 8.32e-68 | 0.8626 |
| 1. PBF | Q54431 | Signal recognition particle protein | 0.00e+00 | 6.66e-17 | 5.14e-109 | 0.6537 |
| 1. PBF | P37105 | Signal recognition particle protein | 0.00e+00 | 2.97e-54 | 1.92e-120 | 0.6518 |
| 1. PBF | Q55311 | Signal recognition particle protein | 0.00e+00 | 1.67e-21 | 1.71e-115 | 0.863 |
| 3. BF | Q9Z6T7 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.01e-26 | 0.8195 |
| 3. BF | Q9I3P8 | Flagellar biosynthesis protein FlhF | 7.59e-08 | NA | 2.16e-13 | 0.7551 |
| 3. BF | O52256 | Flagellar biosynthesis protein FlhF | 3.13e-08 | NA | 9.66e-14 | 0.761 |
| 3. BF | A9CHH2 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 1.33e-34 | 0.8031 |
| 3. BF | Q89B28 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.70e-29 | 0.8429 |
| 3. BF | D4GYW6 | Signal recognition particle receptor FtsY | 1.33e-15 | NA | 4.02e-44 | 0.9273 |
| 3. BF | P27414 | Signal recognition particle receptor FtsY | 5.68e-13 | NA | 4.26e-44 | 0.839 |
| 3. BF | O33010 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.75e-28 | 0.8255 |
| 3. BF | O05948 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 8.56e-30 | 0.8316 |
| 3. BF | Q9ZM34 | Flagellar biosynthesis protein FlhF | 3.33e-10 | NA | 1.69e-07 | 0.7617 |
| 3. BF | P75362 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 9.08e-30 | 0.7847 |
| 3. BF | P57137 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 7.39e-36 | 0.8485 |
| 3. BF | P66843 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.62e-30 | 0.8242 |
| 3. BF | Q9ZL80 | Signal recognition particle receptor FtsY | 4.73e-13 | NA | 4.11e-32 | 0.7808 |
| 3. BF | Q8TIN7 | Signal recognition particle receptor FtsY | 6.77e-14 | NA | 7.05e-39 | 0.8949 |
| 3. BF | Q6MTB9 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 1.54e-29 | 0.7833 |
| 3. BF | Q726P7 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.06e-32 | 0.8568 |
| 3. BF | Q4UK46 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.22e-30 | 0.836 |
| 3. BF | Q3MHE8 | Signal recognition particle receptor subunit alpha | 1.55e-13 | NA | 4.10e-30 | 0.7916 |
| 3. BF | P57010 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 2.95e-36 | 0.8124 |
| 3. BF | P73930 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.14e-29 | 0.8147 |
| 3. BF | P44870 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 7.67e-37 | 0.7993 |
| 3. BF | O67266 | Flagellar biosynthesis protein FlhF | 4.25e-10 | NA | 7.92e-19 | 0.721 |
| 3. BF | Q8G736 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 4.84e-38 | 0.8199 |
| 3. BF | P51835 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 1.70e-36 | 0.7888 |
| 3. BF | O25679 | Flagellar biosynthesis protein FlhF | 3.20e-10 | NA | 1.27e-07 | 0.8323 |
| 3. BF | Q8KA77 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 5.88e-37 | 0.8239 |
| 3. BF | Q01960 | Flagellar biosynthesis protein FlhF | 4.20e-14 | NA | 4.59e-08 | 0.7356 |
| 3. BF | Q1RKK5 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 2.85e-27 | 0.8377 |
| 3. BF | P47539 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 7.17e-30 | 0.7643 |
| 3. BF | P83749 | Signal recognition particle receptor FtsY | 4.77e-15 | NA | 2.27e-29 | 0.7807 |
| 3. BF | Q8CWX8 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 1.78e-32 | 0.8048 |
| 3. BF | O32861 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 4.63e-27 | 0.79 |
| 3. BF | P14929 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.24e-35 | 0.8115 |
| 3. BF | Q44758 | Flagellar biosynthesis protein FlhF | 9.10e-09 | NA | 3.86e-05 | 0.7965 |
| 3. BF | O67066 | Signal recognition particle receptor FtsY | 1.32e-13 | NA | 1.43e-40 | 0.8214 |
| 3. BF | Q9RS67 | Signal recognition particle receptor FtsY | 1.93e-14 | NA | 2.39e-23 | 0.7326 |
| 3. BF | D3UJA7 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 9.11e-28 | 0.7848 |
| 3. BF | Q9HJ93 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 2.69e-47 | 0.8816 |
| 3. BF | Q92GB8 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 1.66e-29 | 0.8372 |
| 3. BF | O30391 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 1.83e-36 | 0.8108 |
| 3. BF | P9WGD8 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.62e-30 | 0.8212 |
| 3. BF | Q56339 | Flagellar biosynthesis protein FlhF | 1.72e-08 | NA | 2.96e-04 | 0.8052 |
| 3. BF | P57011 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 2.53e-36 | 0.8115 |
| 3. BF | Q68VX4 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 1.32e-30 | 0.8236 |
| 3. BF | P06625 | Signal recognition particle receptor subunit alpha | 2.34e-13 | NA | 2.33e-28 | 0.7781 |
| 3. BF | O25458 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.15e-32 | 0.7912 |
| 4. PB | P49966 | Signal recognition particle 54 kDa protein 2 | 0.00e+00 | 5.48e-16 | 9.59e-50 | NA |
| 4. PB | Q75K18 | Signal recognition particle 54 kDa protein | 0.00e+00 | 6.89e-08 | 7.73e-49 | NA |
| 4. PB | P37107 | Signal recognition particle 54 kDa protein, chloroplastic | 0.00e+00 | 1.00e-09 | 2.58e-106 | NA |
| 4. PB | Q57565 | Signal recognition particle 54 kDa protein | 0.00e+00 | 3.78e-43 | 3.77e-86 | NA |
| 4. PB | P49967 | Signal recognition particle 54 kDa protein 3 | 0.00e+00 | 1.22e-19 | 1.32e-59 | NA |
| 4. PB | P21565 | Signal recognition particle 54 kDa protein homolog | 0.00e+00 | 1.92e-13 | 9.29e-58 | NA |
| 4. PB | P37106 | Signal recognition particle 54 kDa protein 1 | 0.00e+00 | 1.16e-25 | 3.80e-52 | NA |
| 4. PB | P20424 | Signal recognition particle subunit SRP54 | 0.00e+00 | 7.46e-10 | 1.42e-58 | NA |
| 4. PB | Q7ZVN5 | Signal recognition particle 54 kDa protein | 0.00e+00 | 5.25e-15 | 5.25e-62 | NA |
| 4. PB | P9WGD7 | Signal recognition particle protein | 0.00e+00 | 3.31e-12 | 8.40e-92 | NA |
| 4. PB | P61011 | Signal recognition particle 54 kDa protein | 0.00e+00 | 8.95e-15 | 1.39e-61 | NA |
| 4. PB | P14576 | Signal recognition particle 54 kDa protein | 0.00e+00 | 2.08e-15 | 1.25e-61 | NA |
| 4. PB | Q6AYB5 | Signal recognition particle 54 kDa protein | 0.00e+00 | 6.45e-16 | 7.19e-62 | NA |
| 4. PB | P0AGD7 | Signal recognition particle protein | 0.00e+00 | 4.76e-41 | 1.18e-104 | NA |
| 5. P | A4VJ70 | Nitrogenase iron protein | 9.56e-04 | 4.39e-02 | NA | NA |
| 5. P | A6W7G7 | ATP synthase subunit alpha | 1.51e-02 | 4.97e-02 | NA | NA |
| 5. P | Q6MS92 | ATP synthase subunit alpha | 1.90e-02 | 3.30e-02 | NA | NA |
| 5. P | C5BTB0 | Nitrogenase iron protein | 1.81e-03 | 3.43e-02 | NA | NA |
| 5. P | Q9V225 | Putative GTPase PYRAB02490 | 7.95e-04 | 6.93e-06 | NA | NA |
| 5. P | Q2J6N1 | ATP synthase subunit alpha | 1.44e-02 | 2.82e-02 | NA | NA |
| 5. P | B5XPH2 | Nitrogenase iron protein | 3.03e-03 | 4.39e-02 | NA | NA |
| 5. P | P00459 | Nitrogenase iron protein 1 | 1.03e-03 | 1.91e-02 | NA | NA |
| 5. P | P07777 | Uncharacterized protein ACIAD1444 | 2.78e-02 | 2.60e-02 | NA | NA |
| 5. P | Q8KC92 | Nitrogenase iron protein | 7.81e-04 | 4.26e-02 | NA | NA |
| 5. P | Q6KI79 | ATP synthase subunit alpha | 3.98e-03 | 3.40e-02 | NA | NA |
| 5. P | O28980 | Putative GTPase AF_1289 | 7.29e-03 | 1.64e-06 | NA | NA |
| 5. P | Q44044 | Nitrogenase iron protein | 1.08e-03 | 1.84e-02 | NA | NA |
| 5. P | Q98QU3 | ATP synthase subunit alpha 1 | 2.79e-03 | 2.47e-02 | NA | NA |
| 5. P | Q54TE7 | GPN-loop GTPase 2 homolog | 1.56e-02 | 1.70e-02 | NA | NA |
| 5. P | P37895 | Putative GTPase CC_2483 | 1.41e-03 | 4.08e-05 | NA | NA |
| 5. P | P27254 | GTPase ArgK | 1.21e-03 | 9.00e-06 | NA | NA |
| 5. P | O58012 | Putative GTPase PH0274 | 1.01e-04 | 4.74e-05 | NA | NA |
| 5. P | Q5A0W6 | GPN-loop GTPase 3 | 3.62e-02 | 4.60e-02 | NA | NA |
| 5. P | P06118 | Nitrogenase iron protein 2 | 9.01e-04 | 2.30e-02 | NA | NA |
| 5. P | P63578 | Probable GTPase Mb1533 | 9.46e-04 | 2.30e-06 | NA | NA |
| 5. P | P9WPZ1 | Probable GTPase Rv1496 | 7.33e-04 | 2.30e-06 | NA | NA |
| 5. P | Q9BGQ3 | Septin-5 | 5.70e-03 | 4.90e-02 | NA | NA |
| 5. P | Q2T873 | ATP synthase subunit alpha 2 | 1.03e-02 | 2.31e-02 | NA | NA |
| 5. P | Q21Z99 | ATP synthase subunit alpha 2 | 8.87e-03 | 3.32e-02 | NA | NA |
| 5. P | P47641 | ATP synthase subunit alpha | 1.30e-02 | 1.59e-02 | NA | NA |
| 5. P | P9WPZ0 | Probable GTPase MT1543 | 8.66e-04 | 2.30e-06 | NA | NA |
| 6. F | Q473Q6 | Urease accessory protein UreG | 8.14e-04 | NA | NA | 0.6153 |
| 6. F | Q39IW6 | Urease accessory protein UreG | 4.94e-04 | NA | NA | 0.5859 |
| 6. F | A8LRR5 | Urease accessory protein UreG | 3.75e-03 | NA | NA | 0.6151 |
| 6. F | Q2SYG0 | Urease accessory protein UreG | 4.82e-04 | NA | NA | 0.5674 |
| 6. F | A7HHN3 | Urease accessory protein UreG | 1.18e-03 | NA | NA | 0.5261 |
| 6. F | Q7VRS8 | Urease accessory protein UreG | 3.73e-03 | NA | NA | 0.5866 |
| 6. F | Q45257 | Hydrogenase maturation factor HypB | 1.19e-03 | NA | NA | 0.5049 |
| 6. F | A0K573 | Urease accessory protein UreG | 8.42e-04 | NA | NA | 0.5944 |
| 6. F | Q0KCP3 | Urease accessory protein UreG | 9.69e-04 | NA | NA | 0.6153 |
| 6. F | A1SYY4 | Urease accessory protein UreG | 4.82e-04 | NA | NA | 0.6068 |
| 6. F | C1DMZ7 | Urease accessory protein UreG | 1.06e-03 | NA | NA | 0.5367 |
| 6. F | Q0BHN8 | Urease accessory protein UreG | 4.71e-04 | NA | NA | 0.5857 |
| 6. F | Q1BYH5 | Urease accessory protein UreG | 8.40e-04 | NA | NA | 0.5942 |
| 6. F | A4JC39 | Urease accessory protein UreG | 4.71e-04 | NA | NA | 0.5857 |
| 6. F | Q1LPS6 | Urease accessory protein UreG | 9.16e-04 | NA | NA | 0.6189 |
| 6. F | C3MGH8 | Urease accessory protein UreG | 7.64e-04 | NA | NA | 0.5928 |
| 6. F | B0KUZ3 | Urease accessory protein UreG | 4.50e-04 | NA | NA | 0.6071 |
| 6. F | B9J8L8 | Urease accessory protein UreG | 6.27e-04 | NA | NA | 0.621 |
| 6. F | P56346 | Putative septum site-determining protein MinD | 9.91e-04 | NA | NA | 0.5018 |
| 6. F | A5W4B2 | Urease accessory protein UreG | 4.26e-04 | NA | NA | 0.6244 |
| 6. F | B0V9P2 | Urease accessory protein UreG | 4.97e-03 | NA | NA | 0.5551 |
| 6. F | Q8EXQ7 | Adenosylcobalamin biosynthesis bifunctional protein CobDQ | 3.63e-02 | NA | NA | 0.4437 |
| 6. F | A8XGZ9 | Methylmalonic aciduria type A homolog, mitochondrial | 8.29e-04 | NA | NA | 0.3185 |
| 6. F | Q144E7 | Urease accessory protein UreG | 4.83e-04 | NA | NA | 0.6124 |
| 6. F | Q9FAS2 | Urease accessory protein UreG | 5.21e-04 | NA | NA | 0.5993 |
| 6. F | A2C4R6 | Urease accessory protein UreG | 1.37e-03 | NA | NA | 0.5795 |
| 6. F | A2SDI6 | Urease accessory protein UreG | 9.92e-04 | NA | NA | 0.6088 |
| 6. F | B1WZW5 | ATP-dependent dethiobiotin synthetase BioD | 6.91e-05 | NA | NA | 0.5915 |
| 6. F | E0ZS47 | Urease accessory protein G | 2.54e-03 | NA | NA | 0.5512 |
| 6. F | P72955 | Urease accessory protein UreG | 1.07e-03 | NA | NA | 0.5526 |
| 6. F | Q1MCW4 | Urease accessory protein UreG | 6.49e-04 | NA | NA | 0.6387 |
| 6. F | C5CY05 | Urease accessory protein UreG | 5.09e-04 | NA | NA | 0.5617 |
| 6. F | A1V1G3 | Urease accessory protein UreG | 4.71e-04 | NA | NA | 0.6202 |
| 6. F | B1XYX6 | Urease accessory protein UreG | 4.51e-04 | NA | NA | 0.5837 |
| 6. F | B1JX26 | Urease accessory protein UreG | 8.44e-04 | NA | NA | 0.5945 |
| 6. F | A5EJY3 | Urease accessory protein UreG 2 | 3.49e-04 | NA | NA | 0.59 |
| 6. F | A3MMV5 | Urease accessory protein UreG | 4.69e-04 | NA | NA | 0.6204 |
| 6. F | Q11EW1 | Urease accessory protein UreG | 6.43e-04 | NA | NA | 0.6203 |
| 7. B | Q9DBG7 | Signal recognition particle receptor subunit alpha | 1.34e-13 | NA | 5.32e-30 | NA |
| 7. B | Q9U5L1 | Signal recognition particle receptor subunit alpha homolog | 1.63e-14 | NA | 1.16e-28 | NA |
| 7. B | P32916 | Signal recognition particle receptor subunit alpha homolog | 1.29e-10 | NA | 2.74e-25 | NA |
| 7. B | P10121 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 9.82e-38 | NA |
| 7. B | O43032 | Signal recognition particle receptor subunit alpha homolog | 1.81e-14 | NA | 4.21e-27 | NA |
| 7. B | P9WGD9 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 3.62e-30 | NA |
| 7. B | P52978 | Bifunctional enzyme NodQ | 2.32e-01 | NA | 0.005 | NA |
| 7. B | O52908 | Flagellar biosynthesis protein FlhF | 5.62e-10 | NA | 3.74e-13 | NA |
| 7. B | Q57739 | Signal recognition particle receptor FtsY | 0.00e+00 | NA | 2.18e-43 | NA |
| 7. B | Q54ZR7 | Signal recognition particle receptor subunit alpha | 1.44e-15 | NA | 4.36e-28 | NA |
| 7. B | P08240 | Signal recognition particle receptor subunit alpha | 8.85e-11 | NA | 4.66e-30 | NA |
| 7. B | O80842 | Cell division protein FtsY homolog, chloroplastic | 0.00e+00 | NA | 6.07e-40 | NA |