Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54738.1
JCVISYN3A_0361
23S rRNA (pseudouridine(1915)-N3)-methyltransferase.
M. mycoides homolog: Q6MTI4.
TIGRfam Classification: 5=Equivalog.
Category: Nonessential.
Statistics
Total GO Annotation: 21
Unique PROST Go: 15
Unique BLAST Go: 0
Unique Foldseek Go: 1
Total Homologs: 913
Unique PROST Homologs: 284
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 5
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q38ZJ4
(Ribosomal RNA large subunit methyltransferase H) with a FATCAT P-Value: 0 and RMSD of 1.67 angstrom. The sequence alignment identity is 39.3%.
Structural alignment shown in left. Query protein AVX54738.1 colored as red in alignment, homolog Q38ZJ4 colored as blue.
Query protein AVX54738.1 is also shown in right top, homolog Q38ZJ4 showed in right bottom. They are colored based on secondary structures.
AVX54738.1 MKIKIICFGKLDKKFYIEA-FNDYFKRLEKYADIEIIELKEE-----IN-GELNKIKELNSDLLLNKLESYKDFEKVI-LDVNSKLISTE----NLVDLI 88 Q38ZJ4 MNIKIITVGKLKEK-YLKAGIAEYAKRLSKFCKFEIIEVSDEKAPESLSEAEMTTVKDKEGERILAKV---KDKEHVIVLAIHGKQRASEEFAKEIQDL- 95 AVX54738.1 QTNLNYKNAKILFVIGPSDGYSKKFLN-FFNNKISLAKITLPHQLCRIVLIEQIYRVFKIIKNEKYHK 155 Q38ZJ4 AT---YGTSDITFIIGGSLG-TSDAVNKRANDALSFGKLTLPHQLMRLVLTEQIYRAFMINQGSPYHK 159
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0005737 | cytoplasm |
1. PBF | GO:0070038 | rRNA (pseudouridine-N3-)-methyltransferase activity |
2. PF | GO:0002128 | tRNA nucleoside ribose methylation |
2. PF | GO:0008175 | tRNA methyltransferase activity |
3. BF | GO:0008168 | methyltransferase activity |
5. P | GO:0052666 | tRNA (cytosine-2'-O-)-methyltransferase activity |
5. P | GO:0002938 | tRNA guanine ribose methylation |
5. P | GO:0003723 | RNA binding |
5. P | GO:0002132 | wobble position uridine ribose methylation |
5. P | GO:0019630 | quinate metabolic process |
5. P | GO:0008757 | S-adenosylmethionine-dependent methyltransferase activity |
5. P | GO:0052665 | tRNA (uracil-2'-O-)-methyltransferase activity |
5. P | GO:0046279 | 3,4-dihydroxybenzoate biosynthetic process |
5. P | GO:0002131 | wobble position cytosine ribose methylation |
5. P | GO:0005829 | cytosol |
5. P | GO:0008652 | cellular amino acid biosynthetic process |
5. P | GO:0003855 | 3-dehydroquinate dehydratase activity |
5. P | GO:0009423 | chorismate biosynthetic process |
5. P | GO:0009020 | tRNA (guanosine-2'-O-)-methyltransferase activity |
5. P | GO:0009073 | aromatic amino acid family biosynthetic process |
6. F | GO:0052906 | tRNA (guanine(37)-N(1))-methyltransferase activity |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0016740 | transferase activity |
GO:0070038 | rRNA (pseudouridine-N3-)-methyltransferase activity |
GO:0005737 | cytoplasm |
GO:0006364 | rRNA processing |
GO:0008168 | methyltransferase activity |
GO:0032259 | methylation |
GO:0031167 | rRNA methylation |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | Q8XXC0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.21e-48 | 2.61e-16 | 0.8594 |
1. PBF | B7VKF3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.84e-49 | 1.17e-15 | 0.8683 |
1. PBF | Q5PM81 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8655 |
1. PBF | A6Q496 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.79e-50 | 5.32e-12 | 0.7844 |
1. PBF | A7GVM2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.35e-49 | 2.22e-29 | 0.9161 |
1. PBF | Q0TK37 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.847 |
1. PBF | B1LCI7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.51e-47 | 4.77e-16 | 0.9065 |
1. PBF | B6ITL1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.44e-39 | 9.88e-18 | 0.8552 |
1. PBF | B0RR12 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.46e-49 | 4.19e-21 | 0.8511 |
1. PBF | B5XZR8 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 2.04e-44 | 1.79e-13 | 0.8599 |
1. PBF | Q24MD8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.07e-40 | 1.85e-20 | 0.9161 |
1. PBF | Q87VV9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.22e-46 | 6.34e-18 | 0.8583 |
1. PBF | Q1QXB1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.81e-50 | 3.86e-20 | 0.8692 |
1. PBF | C5BGD2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.51e-44 | 1.14e-14 | 0.8772 |
1. PBF | A9MUL2 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8653 |
1. PBF | P0C1V0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9072 |
1. PBF | B8I1P0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.08e-43 | 8.93e-28 | 0.9089 |
1. PBF | Q8EHP8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.76e-48 | 2.84e-12 | 0.867 |
1. PBF | A6Q9W7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.12e-51 | 1.44e-12 | 0.7749 |
1. PBF | A5IBL8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.55e-50 | 4.04e-20 | 0.8769 |
1. PBF | C6BU53 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.58e-47 | 4.82e-14 | 0.9099 |
1. PBF | B8E4X2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.30e-49 | 4.35e-13 | 0.8728 |
1. PBF | A6T697 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 2.04e-44 | 1.79e-13 | 0.8599 |
1. PBF | Q8EVP2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.40e-54 | 7.21e-22 | 0.8897 |
1. PBF | A4XJN7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.31e-48 | 3.61e-20 | 0.8456 |
1. PBF | O52828 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.21e-49 | 1.10e-21 | 0.9058 |
1. PBF | Q31IE1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.34e-47 | 9.88e-16 | 0.8804 |
1. PBF | B7MFQ9 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8457 |
1. PBF | Q28VG7 | Ribosomal RNA large subunit methyltransferase H | 3.44e-15 | 4.09e-26 | 1.53e-11 | 0.7832 |
1. PBF | Q8NYX2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.22e-49 | 4.17e-32 | 0.9102 |
1. PBF | B0K569 | Ribosomal RNA large subunit methyltransferase H 2 | 0.00e+00 | 7.50e-38 | 3.85e-06 | 0.8784 |
1. PBF | A6VM72 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 2.08e-49 | 6.77e-15 | 0.8687 |
1. PBF | B7L2C1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.23e-49 | 6.40e-09 | 0.8785 |
1. PBF | A7HNK6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.27e-52 | 6.36e-17 | 0.9004 |
1. PBF | C3M9Y4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.36e-45 | 3.74e-13 | 0.8741 |
1. PBF | A5WGB3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.80e-50 | 1.66e-23 | 0.9173 |
1. PBF | Q0I9R7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.37e-40 | 6.40e-14 | 0.8497 |
1. PBF | P0A8J1 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.846 |
1. PBF | A9R6Z5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.8702 |
1. PBF | Q7MST2 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 7.81e-48 | 4.73e-12 | 0.7956 |
1. PBF | B7MRS3 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8457 |
1. PBF | A8HS37 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.73e-45 | 1.32e-14 | 0.8927 |
1. PBF | Q4A5P7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.94e-48 | 1.09e-21 | 0.9241 |
1. PBF | Q1BUW4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.83e-47 | 5.96e-14 | 0.8559 |
1. PBF | B9KAC4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.24e-47 | 7.28e-17 | 0.9221 |
1. PBF | Q2NUV2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.75e-47 | 4.94e-13 | 0.885 |
1. PBF | Q890H4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.49e-50 | 1.97e-25 | 0.9116 |
1. PBF | Q60BT8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.82e-47 | 1.29e-16 | 0.8607 |
1. PBF | Q4LAJ3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.10e-47 | 9.00e-35 | 0.9097 |
1. PBF | Q724B0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.73e-49 | 2.82e-32 | 0.9157 |
1. PBF | A8AJG7 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.36e-46 | 9.59e-14 | 0.847 |
1. PBF | Q1MA67 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.57e-46 | 1.67e-12 | 0.9033 |
1. PBF | B5FMN7 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8647 |
1. PBF | B8DNW9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.09e-47 | 2.54e-11 | 0.9017 |
1. PBF | A9HC19 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.84e-39 | 4.22e-12 | 0.8611 |
1. PBF | B2T2A0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.71e-50 | 6.99e-15 | 0.8598 |
1. PBF | B8ZQC9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.8999 |
1. PBF | B0V9Q3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.77e-48 | 9.49e-23 | 0.8946 |
1. PBF | Q1CSS2 | Ribosomal RNA large subunit methyltransferase H | 1.11e-15 | 8.37e-46 | 4.43e-04 | 0.8201 |
1. PBF | Q7WL83 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.07e-47 | 4.64e-13 | 0.8438 |
1. PBF | Q2GCB7 | Ribosomal RNA large subunit methyltransferase H | 1.04e-14 | 1.10e-30 | 6.69e-08 | 0.8508 |
1. PBF | Q98QV7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.31e-47 | 5.17e-17 | 0.9268 |
1. PBF | B8G0H2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.27e-41 | 1.66e-20 | 0.9152 |
1. PBF | Q6G4Y7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.17e-43 | 2.09e-08 | 0.8686 |
1. PBF | Q12QY2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.07e-48 | 6.83e-14 | 0.866 |
1. PBF | P67520 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8657 |
1. PBF | B4UM78 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.66e-49 | 1.79e-20 | 0.9017 |
1. PBF | Q03UB1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.52e-53 | 6.87e-23 | 0.9101 |
1. PBF | A8YWL2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.85e-47 | 1.17e-27 | 0.9083 |
1. PBF | A3NT43 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 4.20e-15 | 0.8651 |
1. PBF | P0DF08 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.50e-45 | 4.66e-21 | 0.9112 |
1. PBF | Q7N760 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.16e-47 | 5.71e-14 | 0.8711 |
1. PBF | B1KTH1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.24e-47 | 2.07e-28 | 0.9178 |
1. PBF | P59730 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.04e-51 | 3.26e-28 | 0.9159 |
1. PBF | A9L006 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.30e-49 | 4.35e-13 | 0.8674 |
1. PBF | Q9HX23 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.11e-45 | 6.48e-18 | 0.8659 |
1. PBF | Q0HLJ5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.26e-48 | 3.82e-12 | 0.8674 |
1. PBF | Q9A2X3 | Ribosomal RNA large subunit methyltransferase H | 8.88e-16 | 5.86e-47 | 2.28e-13 | 0.8382 |
1. PBF | A3QH52 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.68e-49 | 3.55e-12 | 0.8661 |
1. PBF | Q13DN3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.20e-48 | 2.65e-08 | 0.9003 |
1. PBF | Q0ABM7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.36e-49 | 9.22e-18 | 0.8797 |
1. PBF | Q8ZDG3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.8706 |
1. PBF | B1AIG8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.80e-50 | 4.32e-21 | 0.8785 |
1. PBF | Q5LXI0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.05e-48 | 4.26e-19 | 0.8912 |
1. PBF | B3E3Q8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.68e-43 | 1.97e-15 | 0.9383 |
1. PBF | Q07V06 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.52e-46 | 7.34e-09 | 0.901 |
1. PBF | A8G4N9 | Ribosomal RNA large subunit methyltransferase H | 1.33e-13 | 5.87e-33 | 4.25e-14 | 0.8093 |
1. PBF | Q5SLR5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.97e-31 | 3.34e-13 | 0.879 |
1. PBF | Q0HXU9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.63e-48 | 5.35e-12 | 0.8671 |
1. PBF | Q2VZT7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.76e-39 | 2.27e-12 | 0.8573 |
1. PBF | Q0C5F9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.77e-44 | 1.85e-09 | 0.8369 |
1. PBF | Q8P7J8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.46e-49 | 4.19e-21 | 0.8496 |
1. PBF | P0A0N6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9067 |
1. PBF | A6M3I3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.81e-49 | 1.75e-23 | 0.9224 |
1. PBF | A9BWE1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.04e-46 | 5.92e-16 | 0.8624 |
1. PBF | Q033W5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.45e-49 | 1.47e-26 | 0.9127 |
1. PBF | B7UKS6 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8454 |
1. PBF | A5IXW4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.18e-49 | 3.30e-18 | 0.8829 |
1. PBF | A8LKJ4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.39e-42 | 2.25e-14 | 0.8502 |
1. PBF | C4LCB6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.03e-48 | 1.38e-14 | 0.8704 |
1. PBF | B0TR49 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.21e-49 | 3.23e-12 | 0.8743 |
1. PBF | A9GVS4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.73e-40 | 6.90e-17 | 0.8868 |
1. PBF | B2URH6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.20e-40 | 4.98e-16 | 0.8775 |
1. PBF | B2SWG5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.12e-49 | 5.79e-21 | 0.8539 |
1. PBF | A6QD63 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9065 |
1. PBF | A4G2M2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.00e-48 | 2.86e-15 | 0.8618 |
1. PBF | B1JGB0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.87 |
1. PBF | Q3BRF1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.96e-46 | 1.53e-21 | 0.8507 |
1. PBF | Q6KID5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.54e-46 | 1.62e-17 | 0.9258 |
1. PBF | Q39QQ9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.17e-44 | 6.07e-19 | 0.9018 |
1. PBF | Q6GD66 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.22e-49 | 4.17e-32 | 0.9104 |
1. PBF | A7IAU3 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.27e-44 | 2.72e-19 | 0.9028 |
1. PBF | A5V9D8 | Ribosomal RNA large subunit methyltransferase H | 5.55e-16 | 2.93e-32 | 3.60e-06 | 0.8654 |
1. PBF | Q324Q7 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8469 |
1. PBF | A7ZC60 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.15e-43 | 1.86e-07 | 0.7522 |
1. PBF | Q181Q1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.44e-49 | 1.59e-21 | 0.9198 |
1. PBF | Q99XH0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.27e-44 | 1.20e-20 | 0.9107 |
1. PBF | B9E3M4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.40e-50 | 5.14e-22 | 0.8834 |
1. PBF | Q11RC7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.90e-46 | 3.68e-19 | 0.8841 |
1. PBF | Q0I1H1 | Ribosomal RNA large subunit methyltransferase H | 2.22e-16 | 1.20e-48 | 2.81e-16 | 0.8584 |
1. PBF | Q8DFD8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.48e-48 | 2.97e-16 | 0.8845 |
1. PBF | Q5LX20 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.66e-44 | 2.53e-11 | 0.8569 |
1. PBF | Q1AVF5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-47 | 4.45e-21 | 0.9074 |
1. PBF | A1AV33 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.49e-41 | 3.81e-18 | 0.9302 |
1. PBF | B2S801 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.20e-33 | 1.45e-11 | 0.8826 |
1. PBF | Q65CS8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.89e-48 | 5.06e-29 | 0.9193 |
1. PBF | Q0AU48 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.54e-53 | 1.67e-25 | 0.8491 |
1. PBF | Q142M1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.17e-48 | 1.43e-13 | 0.8629 |
1. PBF | B9MJ26 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.17e-48 | 4.54e-16 | 0.8622 |
1. PBF | B6JD16 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.66e-48 | 4.59e-10 | 0.888 |
1. PBF | Q3IZI5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.48e-44 | 9.29e-14 | 0.8191 |
1. PBF | Q12C39 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.90e-49 | 1.94e-14 | 0.8722 |
1. PBF | Q6MGS7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.54e-49 | 1.71e-04 | 0.892 |
1. PBF | Q1MPY2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.34e-43 | 4.38e-14 | 0.9177 |
1. PBF | A5UBA5 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 8.00e-47 | 7.25e-16 | 0.8656 |
1. PBF | B2VBM9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.15e-46 | 1.75e-13 | 0.8681 |
1. PBF | A5G903 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.52e-46 | 1.85e-24 | 0.9263 |
1. PBF | B4U126 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.41e-48 | 5.85e-23 | 0.8843 |
1. PBF | A7NE94 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.58e-26 | 5.43e-22 | 0.8864 |
1. PBF | B5FBK3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.05e-47 | 4.19e-18 | 0.8749 |
1. PBF | Q1IVS1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.31e-40 | 5.76e-22 | 0.866 |
1. PBF | A7FZD1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.04e-46 | 4.21e-29 | 0.922 |
1. PBF | A4YKE8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.14e-48 | 1.80e-09 | 0.896 |
1. PBF | Q1QDN7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.77e-51 | 1.78e-24 | 0.924 |
1. PBF | A9ITN7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.40e-47 | 7.57e-16 | 0.8602 |
1. PBF | A5EY47 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.16e-48 | 3.48e-13 | 0.8727 |
1. PBF | C1CNL1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.9 |
1. PBF | B6I146 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8468 |
1. PBF | Q6HAH7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.39e-51 | 7.59e-28 | 0.9164 |
1. PBF | Q31B21 | Ribosomal RNA large subunit methyltransferase H | 2.22e-16 | 2.21e-34 | 1.16e-13 | 0.8374 |
1. PBF | B1J136 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.57e-49 | 1.77e-19 | 0.8632 |
1. PBF | B8E0D5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.61e-46 | 1.85e-12 | 0.9366 |
1. PBF | B2UU96 | Ribosomal RNA large subunit methyltransferase H | 1.89e-15 | 6.17e-44 | 7.38e-04 | 0.8157 |
1. PBF | Q0BD80 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.67e-47 | 3.19e-14 | 0.8647 |
1. PBF | A3DHU9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.36e-44 | 6.66e-28 | 0.9151 |
1. PBF | A7FKY2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.8697 |
1. PBF | Q92EY7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.21e-48 | 9.00e-32 | 0.9125 |
1. PBF | Q8XH85 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.83e-48 | 4.57e-27 | 0.9207 |
1. PBF | C1DMQ3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.28e-47 | 9.80e-14 | 0.8645 |
1. PBF | Q02VZ1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.44e-52 | 2.39e-26 | 0.908 |
1. PBF | B2RH13 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.74e-49 | 1.06e-17 | 0.9213 |
1. PBF | A1JPW6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.25e-45 | 3.05e-14 | 0.8714 |
1. PBF | A3D7P1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.30e-49 | 4.35e-13 | 0.8731 |
1. PBF | Q1LQB0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.22e-45 | 4.96e-16 | 0.8862 |
1. PBF | A9W528 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.23e-49 | 6.40e-09 | 0.8765 |
1. PBF | A3PCS1 | Ribosomal RNA large subunit methyltransferase H | 3.33e-16 | 7.66e-33 | 5.91e-14 | 0.8364 |
1. PBF | Q3JYD2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.40e-47 | 2.20e-22 | 0.9135 |
1. PBF | Q62II5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 4.20e-15 | 0.8651 |
1. PBF | B1MWX1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.44e-49 | 7.28e-19 | 0.9087 |
1. PBF | Q6MAG7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.26e-34 | 2.48e-15 | 0.8826 |
1. PBF | Q7V7V1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.18e-37 | 4.65e-14 | 0.8014 |
1. PBF | B7GNR6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.59e-47 | 2.10e-21 | 0.9141 |
1. PBF | Q1JJB0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.27e-44 | 1.20e-20 | 0.911 |
1. PBF | Q9ZKQ2 | Ribosomal RNA large subunit methyltransferase H | 1.55e-15 | 1.99e-46 | 1.22e-04 | 0.8176 |
1. PBF | A3CRD3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.74e-53 | 3.62e-20 | 0.9152 |
1. PBF | Q21FD2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.11e-50 | 8.64e-20 | 0.8819 |
1. PBF | C1KZ18 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.73e-49 | 2.82e-32 | 0.9157 |
1. PBF | B5ZAY6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.01e-50 | 4.30e-20 | 0.8718 |
1. PBF | Q57B50 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.20e-33 | 1.45e-11 | 0.8828 |
1. PBF | A2RNT8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.69e-51 | 3.10e-26 | 0.912 |
1. PBF | B5Y9X7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.39e-36 | 6.11e-25 | 0.8784 |
1. PBF | Q5FMT8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.94e-49 | 5.43e-28 | 0.9083 |
1. PBF | Q2FTV8 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.98e-43 | 1.07e-19 | 0.8817 |
1. PBF | A3M3G7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.77e-48 | 9.49e-23 | 0.9054 |
1. PBF | Q6LN94 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.26e-48 | 5.44e-16 | 0.8697 |
1. PBF | Q8A7G2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.95e-44 | 2.18e-23 | 0.9069 |
1. PBF | A1A8R1 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8459 |
1. PBF | B2U8Z7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.87e-48 | 4.35e-17 | 0.8563 |
1. PBF | Q16CH2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.29e-44 | 5.79e-13 | 0.8608 |
1. PBF | Q1DCX5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.26e-53 | 2.08e-23 | 0.9093 |
1. PBF | A4VYG8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.20e-50 | 4.75e-19 | 0.904 |
1. PBF | Q48DL7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.95e-46 | 4.14e-18 | 0.86 |
1. PBF | B1JW46 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.83e-47 | 5.96e-14 | 0.8645 |
1. PBF | Q21WP8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.48e-47 | 2.61e-16 | 0.8608 |
1. PBF | Q92LB0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.13e-45 | 2.53e-13 | 0.8749 |
1. PBF | Q3AKE4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.51e-38 | 1.23e-12 | 0.8384 |
1. PBF | Q0BRE3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.78e-38 | 8.19e-13 | 0.8341 |
1. PBF | Q1J963 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.46e-45 | 1.23e-20 | 0.9108 |
1. PBF | Q6NDE1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.02e-48 | 1.75e-08 | 0.9093 |
1. PBF | B7NLZ5 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8458 |
1. PBF | Q5WWX2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.21e-49 | 1.04e-19 | 0.8663 |
1. PBF | A1WYZ1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.09e-44 | 2.60e-16 | 0.886 |
1. PBF | B7J9S3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.52e-42 | 1.19e-10 | 0.8476 |
1. PBF | A5E958 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.14e-49 | 1.09e-09 | 0.8644 |
1. PBF | Q2FKN2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9069 |
1. PBF | Q5HX40 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.54e-46 | 4.69e-09 | 0.8005 |
1. PBF | Q1I4F3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.12e-47 | 4.75e-19 | 0.8671 |
1. PBF | Q98F00 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.24e-44 | 2.64e-13 | 0.9 |
1. PBF | B1HPJ4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.04e-46 | 1.39e-28 | 0.9163 |
1. PBF | A3PMR2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.72e-45 | 2.01e-15 | 0.8187 |
1. PBF | P59731 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.69e-51 | 4.18e-28 | 0.9161 |
1. PBF | Q8PIX0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.60e-47 | 2.04e-21 | 0.851 |
1. PBF | P67522 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.40e-47 | 2.20e-22 | 0.9138 |
1. PBF | A1VN17 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.12e-48 | 2.27e-16 | 0.8667 |
1. PBF | Q7U7D7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.19e-39 | 1.49e-11 | 0.8314 |
1. PBF | A2SFG5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.13e-46 | 1.54e-13 | 0.8508 |
1. PBF | A6WXS5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.70e-43 | 1.37e-12 | 0.8611 |
1. PBF | Q2YC51 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.80e-49 | 1.13e-17 | 0.8289 |
1. PBF | A0AFA6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.79e-47 | 3.49e-31 | 0.9162 |
1. PBF | B1IYH2 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.846 |
1. PBF | A7GJG3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.14e-46 | 1.33e-27 | 0.9174 |
1. PBF | C0RF89 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.01e-33 | 4.44e-11 | 0.8849 |
1. PBF | A7I0T3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.41e-46 | 2.96e-07 | 0.7654 |
1. PBF | Q2SZT5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.34e-51 | 8.28e-15 | 0.8647 |
1. PBF | Q0SPV0 | Ribosomal RNA large subunit methyltransferase H 1 | 0.00e+00 | 6.83e-48 | 4.57e-27 | 0.9207 |
1. PBF | Q5KU84 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.22e-47 | 1.64e-31 | 0.9148 |
1. PBF | C1CBL5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.8999 |
1. PBF | B7V8A9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.11e-45 | 6.48e-18 | 0.8667 |
1. PBF | A9IMC0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.23e-43 | 5.44e-09 | 0.878 |
1. PBF | Q02SH1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.22e-46 | 9.24e-19 | 0.8698 |
1. PBF | Q3SG64 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.46e-50 | 4.15e-15 | 0.8884 |
1. PBF | B1KDW5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.38e-48 | 3.07e-13 | 0.866 |
1. PBF | A8FZ15 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.16e-48 | 6.36e-13 | 0.8536 |
1. PBF | Q2RV09 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.16e-45 | 1.36e-14 | 0.8837 |
1. PBF | A5VSI0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.76e-35 | 1.45e-11 | 0.8836 |
1. PBF | A3MI42 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 4.20e-15 | 0.8587 |
1. PBF | B5QVP2 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8656 |
1. PBF | A2C1Z3 | Ribosomal RNA large subunit methyltransferase H | 7.77e-16 | 7.90e-42 | 3.22e-16 | 0.8198 |
1. PBF | Q9RWP7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.10e-35 | 2.75e-15 | 0.8836 |
1. PBF | A1V2F7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 4.20e-15 | 0.8654 |
1. PBF | B2TU82 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8457 |
1. PBF | B6JMG9 | Ribosomal RNA large subunit methyltransferase H | 4.44e-16 | 1.72e-44 | 6.04e-04 | 0.8262 |
1. PBF | B0KB09 | Ribosomal RNA large subunit methyltransferase H 2 | 1.15e-12 | 5.82e-27 | 2.27e-06 | 0.8505 |
1. PBF | A5UFK3 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.43e-46 | 8.24e-16 | 0.877 |
1. PBF | Q8G4X1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.77e-47 | 3.33e-20 | 0.9136 |
1. PBF | C0ZA28 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.03e-46 | 1.92e-25 | 0.9188 |
1. PBF | Q2K2W7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.04e-45 | 1.97e-11 | 0.9041 |
1. PBF | Q1QQT4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.56e-46 | 1.23e-09 | 0.8844 |
1. PBF | Q72GU0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.34e-31 | 9.55e-13 | 0.879 |
1. PBF | Q5FRS9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.51e-35 | 2.56e-10 | 0.8615 |
1. PBF | Q3Z4F6 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8458 |
1. PBF | Q5P2U2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.36e-48 | 3.77e-15 | 0.8212 |
1. PBF | A8B011 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.40e-51 | 1.33e-22 | 0.9086 |
1. PBF | Q97DE2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.18e-45 | 1.41e-25 | 0.913 |
1. PBF | C3LTJ9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.26e-48 | 2.34e-17 | 0.8694 |
1. PBF | Q5GXJ5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.12e-49 | 5.79e-21 | 0.8544 |
1. PBF | A4W822 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.02e-46 | 7.21e-14 | 0.8439 |
1. PBF | A7H6X6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.11e-45 | 4.24e-22 | 0.8838 |
1. PBF | A7ZJ25 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8466 |
1. PBF | A6WRK4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.30e-49 | 4.35e-13 | 0.8712 |
1. PBF | A1VEG0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.74e-48 | 2.24e-13 | 0.8936 |
1. PBF | B8CSG9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.22e-49 | 2.70e-11 | 0.8787 |
1. PBF | Q2N6F2 | Ribosomal RNA large subunit methyltransferase H | 9.99e-16 | 2.26e-34 | 2.22e-10 | 0.8553 |
1. PBF | A6VZ82 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.99e-48 | 5.69e-20 | 0.8843 |
1. PBF | A4ITU1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.12e-46 | 1.24e-30 | 0.9139 |
1. PBF | A0Q842 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.81e-51 | 3.69e-29 | 0.9084 |
1. PBF | A4WNV2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.12e-46 | 1.42e-13 | 0.8423 |
1. PBF | P67521 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8649 |
1. PBF | A5I7U4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.04e-46 | 4.21e-29 | 0.9173 |
1. PBF | C4Z0V6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.19e-47 | 9.85e-27 | 0.9054 |
1. PBF | A9B9X8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.21e-39 | 2.48e-12 | 0.8219 |
1. PBF | B1LL85 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.846 |
1. PBF | C1CHN8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.8998 |
1. PBF | B2JE39 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.69e-49 | 3.40e-14 | 0.8629 |
1. PBF | P67523 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.40e-47 | 2.20e-22 | 0.914 |
1. PBF | B7N9P2 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8462 |
1. PBF | B4RR86 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.50e-49 | 3.90e-14 | 0.8955 |
1. PBF | Q57RT4 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.21e-44 | 6.02e-12 | 0.8662 |
1. PBF | A5INR5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9133 |
1. PBF | A6H0Q2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.30e-42 | 4.25e-21 | 0.9094 |
1. PBF | A0K973 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.83e-47 | 5.96e-14 | 0.8649 |
1. PBF | Q2SRU4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.82e-81 | 7.22e-91 | 0.9966 |
1. PBF | Q5HK23 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.24e-47 | 1.35e-33 | 0.9097 |
1. PBF | Q47JQ1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.78e-51 | 1.07e-16 | 0.8536 |
1. PBF | Q30Z08 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.83e-48 | 3.59e-11 | 0.9074 |
1. PBF | Q5F554 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.28e-48 | 1.01e-13 | 0.8829 |
1. PBF | B1XVK0 | Ribosomal RNA large subunit methyltransferase H | 5.27e-14 | 7.07e-32 | 1.65e-11 | 0.8206 |
1. PBF | A9KCR0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.27e-52 | 4.86e-18 | 0.8862 |
1. PBF | B3DPH4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.77e-47 | 3.33e-20 | 0.9136 |
1. PBF | A1B510 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.34e-46 | 1.22e-11 | 0.8305 |
1. PBF | C5CFQ6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.90e-45 | 7.95e-13 | 0.924 |
1. PBF | Q8VUW1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.48e-48 | 3.17e-31 | 0.9096 |
1. PBF | Q67J66 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.56e-46 | 2.23e-25 | 0.9353 |
1. PBF | Q046Z0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.28e-51 | 1.05e-25 | 0.9075 |
1. PBF | B3PS03 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.74e-45 | 8.08e-12 | 0.9014 |
1. PBF | Q2P0N7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.12e-49 | 5.79e-21 | 0.8537 |
1. PBF | Q087K7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.28e-47 | 5.71e-14 | 0.8717 |
1. PBF | Q4QPL1 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.82e-46 | 4.94e-16 | 0.867 |
1. PBF | A6TXH4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9134 |
1. PBF | B1YU55 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.51e-47 | 7.05e-14 | 0.8603 |
1. PBF | B0T320 | Ribosomal RNA large subunit methyltransferase H | 2.11e-15 | 1.16e-45 | 4.95e-13 | 0.8005 |
1. PBF | B4SYJ9 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8651 |
1. PBF | Q5LFI4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.81e-43 | 1.03e-18 | 0.9037 |
1. PBF | A7IH12 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.25e-45 | 2.61e-10 | 0.8943 |
1. PBF | Q3K696 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.79e-49 | 2.72e-18 | 0.8587 |
1. PBF | A5GS43 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.46e-39 | 2.56e-17 | 0.8081 |
1. PBF | Q4AAU5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.25e-45 | 7.81e-07 | 0.8648 |
1. PBF | P0C949 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9065 |
1. PBF | Q5ZVR4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.36e-49 | 7.38e-20 | 0.8632 |
1. PBF | Q0BKF0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.58e-26 | 5.43e-22 | 0.8763 |
1. PBF | Q747Q7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.05e-47 | 2.57e-19 | 0.9044 |
1. PBF | A1RGU0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.44e-48 | 2.12e-12 | 0.8648 |
1. PBF | B2FPR2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.40e-47 | 7.91e-22 | 0.8803 |
1. PBF | Q484R1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.16e-48 | 9.40e-13 | 0.8635 |
1. PBF | B2TRC7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.77e-45 | 5.98e-25 | 0.9173 |
1. PBF | Q9PJ01 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.42e-45 | 4.74e-09 | 0.8051 |
1. PBF | Q03UV6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.21e-47 | 8.26e-22 | 0.9123 |
1. PBF | Q7NKY9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 5.94e-21 | 0.871 |
1. PBF | Q6LYF4 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.41e-53 | 3.16e-23 | 0.8873 |
1. PBF | Q87RQ4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.50e-49 | 1.00e-16 | 0.8766 |
1. PBF | A2BWR4 | Ribosomal RNA large subunit methyltransferase H | 3.44e-15 | 3.86e-33 | 6.99e-11 | 0.8451 |
1. PBF | Q0AKW7 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 3.53e-43 | 1.90e-09 | 0.8363 |
1. PBF | A1VXK9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.60e-46 | 9.85e-10 | 0.8176 |
1. PBF | A4SJW3 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 2.43e-46 | 1.70e-14 | 0.8532 |
1. PBF | B2A3L2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.98e-48 | 2.65e-20 | 0.8665 |
1. PBF | Q1G7S5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.61e-48 | 1.01e-25 | 0.9094 |
1. PBF | P0DF09 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.50e-45 | 4.66e-21 | 0.9111 |
1. PBF | B5XJC8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.27e-44 | 1.20e-20 | 0.9106 |
1. PBF | A5GKP6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.11e-38 | 4.61e-08 | 0.8843 |
1. PBF | A1S8T3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.58e-48 | 2.33e-12 | 0.8652 |
1. PBF | A4Y9F4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.44e-48 | 2.12e-12 | 0.8643 |
1. PBF | B6EIM8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.52e-49 | 5.19e-18 | 0.8837 |
1. PBF | Q8YA66 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.86e-49 | 9.10e-32 | 0.9157 |
1. PBF | Q8NYY7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.29e-44 | 3.86e-20 | 0.9113 |
1. PBF | A7ZXR2 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8452 |
1. PBF | P67519 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.37e-50 | 2.33e-12 | 0.8947 |
1. PBF | B2I8D4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.95e-50 | 1.30e-21 | 0.8785 |
1. PBF | Q3IJ98 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.86e-46 | 2.97e-13 | 0.8743 |
1. PBF | B5YER1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.22e-49 | 3.96e-13 | 0.9254 |
1. PBF | Q3SVH7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.60e-46 | 1.65e-10 | 0.8938 |
1. PBF | A2RH29 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.53e-45 | 1.78e-20 | 0.912 |
1. PBF | Q6MTI4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.28e-77 | 1.98e-90 | 0.9909 |
1. PBF | B0KB08 | Ribosomal RNA large subunit methyltransferase H 1 | 0.00e+00 | 2.71e-39 | 2.30e-05 | 0.8769 |
1. PBF | A9M0D2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.77e-48 | 5.04e-13 | 0.8948 |
1. PBF | A8FJA3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.93e-48 | 4.17e-32 | 0.9155 |
1. PBF | A9MKD5 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.865 |
1. PBF | B8DEV0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.66e-49 | 4.03e-32 | 0.9156 |
1. PBF | B9KEU1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.01e-46 | 5.46e-10 | 0.8207 |
1. PBF | Q8CU83 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.24e-47 | 1.35e-33 | 0.9102 |
1. PBF | Q04HG9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.04e-50 | 4.40e-27 | 0.909 |
1. PBF | Q9PGG4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.24e-50 | 1.66e-21 | 0.8812 |
1. PBF | Q0TM49 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.83e-48 | 4.57e-27 | 0.9208 |
1. PBF | A0RMM1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.53e-41 | 7.13e-09 | 0.8116 |
1. PBF | Q1H3S5 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 3.68e-43 | 6.73e-16 | 0.8854 |
1. PBF | C5CLQ6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.17e-46 | 2.25e-16 | 0.866 |
1. PBF | B7LLH6 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 9.14e-48 | 1.12e-13 | 0.8429 |
1. PBF | A4JGI0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.56e-49 | 3.05e-14 | 0.8648 |
1. PBF | C3K2M6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.15e-48 | 1.70e-18 | 0.8596 |
1. PBF | Q64WA8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.81e-43 | 1.03e-18 | 0.9034 |
1. PBF | A2BQZ8 | Ribosomal RNA large subunit methyltransferase H | 1.33e-15 | 2.42e-31 | 2.14e-13 | 0.8291 |
1. PBF | P59733 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.63e-49 | 8.30e-18 | 0.8663 |
1. PBF | C0MGS7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.73e-49 | 5.60e-23 | 0.9085 |
1. PBF | B3PNC7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.74e-45 | 2.51e-16 | 0.9245 |
1. PBF | A5IIT9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.51e-47 | 4.77e-16 | 0.9013 |
1. PBF | A6TX97 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.07e-48 | 2.37e-23 | 0.9174 |
1. PBF | Q2IMI1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.46e-51 | 6.81e-21 | 0.8946 |
1. PBF | A9VTJ5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.34e-49 | 1.02e-28 | 0.9173 |
1. PBF | B4TB44 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8656 |
1. PBF | B9JUH4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.21e-42 | 3.70e-13 | 0.9049 |
1. PBF | A0KN93 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 6.15e-46 | 3.73e-15 | 0.8513 |
1. PBF | Q72WX0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 5.92e-28 | 0.9167 |
1. PBF | Q1J434 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.27e-44 | 1.20e-20 | 0.9109 |
1. PBF | A9KLG6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.00e-49 | 3.17e-26 | 0.9115 |
1. PBF | B9MR74 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.45e-52 | 2.99e-16 | 0.8708 |
1. PBF | Q9CJR9 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 2.80e-47 | 2.74e-15 | 0.8652 |
1. PBF | Q2YUP7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9069 |
1. PBF | A4FXE1 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.09e-51 | 3.34e-25 | 0.9127 |
1. PBF | B9M0D9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.52e-45 | 1.62e-23 | 0.9303 |
1. PBF | Q39E96 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.98e-48 | 6.77e-15 | 0.8649 |
1. PBF | Q2SA30 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.88e-46 | 3.56e-20 | 0.8805 |
1. PBF | B1Z888 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.56e-49 | 2.32e-08 | 0.8793 |
1. PBF | A8YYU7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9071 |
1. PBF | Q3J7T4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.34e-47 | 2.30e-19 | 0.8497 |
1. PBF | Q1GVM5 | Ribosomal RNA large subunit methyltransferase H | 5.55e-16 | 4.77e-35 | 1.22e-09 | 0.8477 |
1. PBF | Q630E3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.04e-51 | 3.26e-28 | 0.916 |
1. PBF | Q5X5I9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.81e-50 | 4.80e-20 | 0.8776 |
1. PBF | B3WBI0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.21e-48 | 5.74e-26 | 0.9128 |
1. PBF | B0BRS6 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 2.43e-46 | 3.90e-15 | 0.8541 |
1. PBF | A6LJG1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.21e-48 | 1.57e-16 | 0.8897 |
1. PBF | A4VR04 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.02e-44 | 4.91e-18 | 0.8593 |
1. PBF | A9AJJ5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.29e-49 | 1.79e-13 | 0.8628 |
1. PBF | A8F6Q8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.18e-49 | 2.55e-14 | 0.9172 |
1. PBF | Q4A155 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.33e-46 | 1.40e-31 | 0.9106 |
1. PBF | B9JES1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.75e-44 | 2.09e-13 | 0.8854 |
1. PBF | Q2KYV4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.71e-47 | 2.62e-13 | 0.8444 |
1. PBF | Q7VWE4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.07e-47 | 4.64e-13 | 0.8406 |
1. PBF | C1CW51 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.42e-36 | 2.30e-12 | 0.8893 |
1. PBF | A0RLN8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.04e-51 | 3.26e-28 | 0.9161 |
1. PBF | B5E466 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.9156 |
1. PBF | Q9KTF1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.26e-48 | 2.34e-17 | 0.8695 |
1. PBF | Q6D7M1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.90e-47 | 3.36e-14 | 0.8697 |
1. PBF | Q74LW2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.01e-50 | 1.12e-25 | 0.9123 |
1. PBF | B5R7Y9 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8656 |
1. PBF | Q5X994 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.27e-44 | 1.20e-20 | 0.9109 |
1. PBF | Q9PQW3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.80e-50 | 4.32e-21 | 0.8786 |
1. PBF | A2S4B8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 4.20e-15 | 0.865 |
1. PBF | A8ERZ9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.84e-43 | 1.83e-09 | 0.8305 |
1. PBF | Q8R6V4 | Ribosomal RNA large subunit methyltransferase H 1 | 2.80e-13 | 5.04e-33 | 8.44e-08 | 0.8679 |
1. PBF | C1CUF5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.8996 |
1. PBF | Q5QYD9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.19e-46 | 6.08e-14 | 0.8916 |
1. PBF | Q5WAI7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.68e-47 | 1.33e-22 | 0.9162 |
1. PBF | Q03D72 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.06e-44 | 1.09e-25 | 0.9145 |
1. PBF | Q03I69 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.22e-49 | 3.75e-19 | 0.892 |
1. PBF | A7HT62 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.77e-45 | 4.76e-14 | 0.8783 |
1. PBF | B7HGB9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.04e-51 | 3.26e-28 | 0.9165 |
1. PBF | Q8EL52 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.45e-48 | 2.52e-26 | 0.9169 |
1. PBF | Q5E6V2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.42e-48 | 9.14e-18 | 0.8829 |
1. PBF | A6SVD2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.00e-47 | 6.49e-15 | 0.852 |
1. PBF | A1U3C0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.15e-46 | 1.60e-23 | 0.8758 |
1. PBF | B5EZ81 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8646 |
1. PBF | A9BHV5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.17e-45 | 6.50e-13 | 0.8789 |
1. PBF | B6J870 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.27e-52 | 4.86e-18 | 0.8851 |
1. PBF | C5BNN2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.57e-54 | 2.54e-20 | 0.9146 |
1. PBF | Q0VN46 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.75e-44 | 5.25e-15 | 0.9051 |
1. PBF | Q2J3J3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.68e-49 | 3.53e-08 | 0.8735 |
1. PBF | C4XSX5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.43e-46 | 5.02e-15 | 0.896 |
1. PBF | Q4ZN76 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.22e-46 | 6.34e-18 | 0.8583 |
1. PBF | B9DID6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.88e-46 | 8.88e-31 | 0.9091 |
1. PBF | A6UP47 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.40e-50 | 1.31e-21 | 0.8839 |
1. PBF | B5YIF9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.14e-45 | 1.40e-16 | 0.9094 |
1. PBF | A4J9P0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.55e-48 | 4.75e-26 | 0.9092 |
1. PBF | A7ZAL8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.10e-48 | 2.22e-29 | 0.9184 |
1. PBF | Q8RG55 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.46e-49 | 3.36e-23 | 0.934 |
1. PBF | Q45601 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.34e-48 | 1.05e-30 | 0.9182 |
1. PBF | Q7VGT3 | Ribosomal RNA large subunit methyltransferase H | 4.44e-16 | 1.34e-47 | 2.26e-05 | 0.868 |
1. PBF | O25603 | Ribosomal RNA large subunit methyltransferase H | 2.22e-15 | 1.18e-43 | 8.07e-04 | 0.8148 |
1. PBF | A4SWG7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.40e-40 | 7.10e-15 | 0.8601 |
1. PBF | Q7VKA3 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 6.22e-49 | 4.11e-14 | 0.8583 |
1. PBF | B5Z7V2 | Ribosomal RNA large subunit methyltransferase H | 2.55e-15 | 1.45e-45 | 4.18e-04 | 0.7846 |
1. PBF | Q2YLJ0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.20e-33 | 1.45e-11 | 0.8848 |
1. PBF | B2GEW8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.90e-51 | 1.47e-26 | 0.9129 |
1. PBF | A6VFY5 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.39e-51 | 1.51e-24 | 0.9116 |
1. PBF | Q9ZH20 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.81e-49 | 4.38e-27 | 0.8994 |
1. PBF | Q6F0Y7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.30e-61 | 1.03e-56 | 0.9788 |
1. PBF | Q1IXU8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.57e-38 | 1.30e-11 | 0.8762 |
1. PBF | B0UP23 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.09e-44 | 6.40e-11 | 0.9047 |
1. PBF | B3Q736 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.80e-49 | 8.23e-09 | 0.911 |
1. PBF | B0VSA3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.70e-48 | 6.24e-22 | 0.9041 |
1. PBF | B2V1Q9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.58e-45 | 1.27e-24 | 0.9166 |
1. PBF | C6DBW3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.07e-45 | 1.24e-13 | 0.8676 |
1. PBF | Q38ZJ4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.82e-46 | 3.07e-26 | 0.9117 |
1. PBF | Q4UWK2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.46e-49 | 4.19e-21 | 0.851 |
1. PBF | B8DTN1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.14e-46 | 6.31e-25 | 0.9108 |
1. PBF | Q8DRQ7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.55e-50 | 1.00e-19 | 0.9102 |
1. PBF | Q2A1Q2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.58e-26 | 5.43e-22 | 0.8822 |
1. PBF | Q30RD1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.43e-46 | 1.05e-12 | 0.7741 |
1. PBF | B8ENA6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.21e-41 | 3.98e-14 | 0.8879 |
1. PBF | B1Y0V7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.51e-49 | 4.07e-12 | 0.8571 |
1. PBF | B0TA39 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.86e-46 | 3.03e-26 | 0.9136 |
1. PBF | A7MY83 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.71e-50 | 1.43e-17 | 0.8656 |
1. PBF | A8FJT1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.60e-46 | 9.85e-10 | 0.8181 |
1. PBF | A5F2Y7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.26e-48 | 2.34e-17 | 0.8685 |
1. PBF | B2HVT7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.77e-48 | 9.49e-23 | 0.905 |
1. PBF | A1KBL9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.19e-46 | 9.81e-13 | 0.8568 |
1. PBF | P67516 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.01e-33 | 4.44e-11 | 0.8845 |
1. PBF | Q4A908 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.48e-44 | 9.49e-07 | 0.8651 |
1. PBF | A2CA37 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.75e-36 | 4.72e-14 | 0.8004 |
1. PBF | Q0AFM7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.17e-48 | 2.01e-21 | 0.8538 |
1. PBF | Q63VT4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 4.20e-15 | 0.865 |
1. PBF | A6UDW1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.71e-44 | 6.69e-12 | 0.8766 |
1. PBF | B5YQI8 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8464 |
1. PBF | Q89X82 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.49e-50 | 1.57e-09 | 0.8731 |
1. PBF | A8H7C7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.21e-49 | 3.23e-12 | 0.8741 |
1. PBF | A7H1K5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.24e-44 | 9.74e-09 | 0.8162 |
1. PBF | P67518 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.37e-50 | 2.33e-12 | 0.8927 |
1. PBF | Q46Y95 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.35e-44 | 1.43e-12 | 0.8937 |
1. PBF | A1KWA0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.79e-49 | 6.85e-13 | 0.8936 |
1. PBF | Q46L60 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.37e-40 | 5.30e-12 | 0.8263 |
1. PBF | A6LDQ1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.16e-39 | 4.49e-21 | 0.9096 |
1. PBF | Q87AV1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.45e-49 | 1.60e-21 | 0.887 |
1. PBF | B7M5G3 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8454 |
1. PBF | Q66DE8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.871 |
1. PBF | B3R3D9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.36e-45 | 3.74e-15 | 0.8891 |
1. PBF | B4TPW8 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8652 |
1. PBF | A6L2W9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.34e-45 | 1.23e-20 | 0.9082 |
1. PBF | P0A8J0 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8452 |
1. PBF | B2IKW1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.39e-45 | 1.01e-11 | 0.8764 |
1. PBF | A5VHH9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.38e-52 | 2.58e-25 | 0.9134 |
1. PBF | A8GB16 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.38e-44 | 3.06e-12 | 0.8708 |
1. PBF | B5EPW2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.52e-42 | 1.19e-10 | 0.8153 |
1. PBF | Q5NLX2 | Ribosomal RNA large subunit methyltransferase H | 3.84e-14 | 8.34e-37 | 5.61e-09 | 0.829 |
1. PBF | A7H000 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.83e-44 | 1.30e-06 | 0.8073 |
1. PBF | B7GXS8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.77e-48 | 9.49e-23 | 0.8938 |
1. PBF | P0A8I9 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8465 |
1. PBF | P59732 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.48e-47 | 5.34e-31 | 0.9027 |
1. PBF | B5BCF3 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8652 |
1. PBF | B1IH25 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.03e-46 | 2.79e-29 | 0.9169 |
1. PBF | C6E7L6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.48e-46 | 4.70e-24 | 0.9269 |
1. PBF | A1SU08 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.87e-46 | 4.40e-16 | 0.8768 |
1. PBF | Q4FUQ0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.36e-50 | 1.13e-23 | 0.9236 |
1. PBF | B9KMK8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.06e-45 | 1.65e-15 | 0.8228 |
1. PBF | Q3JUG4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 4.20e-15 | 0.8654 |
1. PBF | C0MBH4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.73e-49 | 5.60e-23 | 0.8836 |
1. PBF | Q01UR1 | Ribosomal RNA large subunit methyltransferase H | 1.11e-15 | 5.28e-34 | 1.90e-10 | 0.8926 |
1. PBF | B7I8V1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.77e-48 | 9.49e-23 | 0.9053 |
1. PBF | A9AAR1 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.32e-52 | 5.67e-22 | 0.8866 |
1. PBF | C1A8S7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.83e-48 | 2.12e-21 | 0.9092 |
1. PBF | Q602E6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.25e-45 | 7.81e-07 | 0.8662 |
1. PBF | B7IS03 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.04e-51 | 3.26e-28 | 0.916 |
1. PBF | Q3A1E3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.54e-45 | 1.06e-23 | 0.9253 |
1. PBF | Q8R6V3 | Ribosomal RNA large subunit methyltransferase H 2 | 0.00e+00 | 5.83e-36 | 7.43e-11 | 0.8857 |
1. PBF | A8MKH4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-50 | 1.50e-25 | 0.9148 |
1. PBF | Q8UBS4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.13e-46 | 1.85e-10 | 0.8753 |
1. PBF | B0U4I5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.28e-50 | 1.98e-21 | 0.8789 |
1. PBF | Q3AG04 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.92e-50 | 1.11e-26 | 0.9161 |
1. PBF | A5MZP4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.40e-50 | 5.14e-22 | 0.8864 |
1. PBF | A7WWR5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9075 |
1. PBF | B1X631 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8462 |
1. PBF | A1URN9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.66e-41 | 8.32e-09 | 0.9058 |
1. PBF | A1TS23 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.16e-48 | 4.38e-15 | 0.8623 |
1. PBF | A5FYS5 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 7.49e-44 | 1.14e-14 | 0.8345 |
1. PBF | A5W9J3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.24e-48 | 2.53e-19 | 0.8634 |
1. PBF | B8J916 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.52e-49 | 9.30e-21 | 0.9032 |
1. PBF | Q0T6P6 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8465 |
1. PBF | B1M692 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.95e-39 | 1.38e-06 | 0.8506 |
1. PBF | Q0KD64 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.36e-45 | 3.74e-15 | 0.8548 |
1. PBF | A3N7F4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 9.84e-51 | 4.20e-15 | 0.8653 |
1. PBF | C0PW71 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.39e-45 | 2.79e-13 | 0.8651 |
1. PBF | B9E922 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.28e-47 | 1.58e-24 | 0.9122 |
1. PBF | Q7P0P9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.33e-46 | 8.43e-17 | 0.871 |
1. PBF | A4TP02 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.8704 |
1. PBF | Q11CQ1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.76e-25 | 1.16e-10 | 0.8788 |
1. PBF | Q9CDS7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.16e-50 | 2.15e-26 | 0.9097 |
1. PBF | P0A4S4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.9145 |
1. PBF | A5FE53 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.09e-44 | 1.23e-21 | 0.9077 |
1. PBF | Q17X37 | Ribosomal RNA large subunit methyltransferase H | 3.11e-15 | 3.89e-48 | 7.70e-05 | 0.8038 |
1. PBF | Q1C516 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.8697 |
1. PBF | Q1CKQ9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.8701 |
1. PBF | B8IYS8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.47e-43 | 5.41e-14 | 0.8907 |
1. PBF | C3KWC5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.87e-46 | 1.55e-28 | 0.9175 |
1. PBF | Q899K8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.97e-45 | 2.04e-21 | 0.917 |
1. PBF | B2INZ9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.8998 |
1. PBF | A5CY81 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.11e-45 | 2.68e-26 | 0.9118 |
1. PBF | B4RD56 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 6.72e-44 | 1.02e-13 | 0.8453 |
1. PBF | Q48QK3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.27e-44 | 1.20e-20 | 0.9109 |
1. PBF | Q7V1D9 | Ribosomal RNA large subunit methyltransferase H | 1.01e-14 | 1.27e-29 | 2.83e-10 | 0.8086 |
1. PBF | Q72CM9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.74e-48 | 2.24e-13 | 0.8938 |
1. PBF | B4E5S1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.43e-47 | 3.36e-14 | 0.8602 |
1. PBF | A3N2P8 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 3.28e-47 | 2.57e-15 | 0.8529 |
1. PBF | B0S3F3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.68e-47 | 2.23e-17 | 0.9174 |
1. PBF | Q9WZU8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.90e-46 | 2.20e-14 | 0.9055 |
1. PBF | Q6AL30 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.47e-48 | 1.09e-18 | 0.8812 |
1. PBF | Q9K5T1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.36e-47 | 1.29e-29 | 0.9181 |
1. PBF | A9NEQ8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.76e-43 | 1.48e-13 | 0.8961 |
1. PBF | Q1GDM9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.31e-41 | 7.38e-13 | 0.8569 |
1. PBF | B8CZR7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.20e-48 | 4.13e-24 | 0.9166 |
1. PBF | Q7MT92 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.43e-46 | 2.76e-18 | 0.9211 |
1. PBF | Q6GKS1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9073 |
1. PBF | Q15VK5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.85e-47 | 1.07e-12 | 0.8732 |
1. PBF | Q04CM2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.61e-48 | 1.01e-25 | 0.9096 |
1. PBF | B5ZUF2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.51e-47 | 8.60e-13 | 0.9035 |
1. PBF | A2SR93 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.00e-47 | 5.40e-23 | 0.9054 |
1. PBF | Q65RH0 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 2.00e-47 | 1.39e-15 | 0.8546 |
1. PBF | A6V0A6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.11e-45 | 6.48e-18 | 0.8657 |
1. PBF | B1YG85 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 3.75e-47 | 7.44e-26 | 0.9153 |
1. PBF | Q1RES6 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8463 |
1. PBF | B9DWF3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.50e-47 | 5.42e-23 | 0.9089 |
1. PBF | A7MK41 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 3.67e-44 | 4.84e-13 | 0.8589 |
1. PBF | B0K568 | Ribosomal RNA large subunit methyltransferase H 1 | 1.17e-12 | 5.82e-27 | 2.27e-06 | 0.8501 |
1. PBF | Q7W7U3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.87e-48 | 1.73e-13 | 0.845 |
1. PBF | A1W757 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.53e-48 | 5.44e-16 | 0.8624 |
1. PBF | Q88DL7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.24e-48 | 2.53e-19 | 0.8681 |
1. PBF | B5EEI1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.01e-47 | 1.76e-22 | 0.9271 |
1. PBF | B2K881 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-46 | 1.33e-12 | 0.8706 |
1. PBF | Q21CZ7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.57e-47 | 1.16e-10 | 0.871 |
1. PBF | B0KJY2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.50e-47 | 2.90e-19 | 0.8679 |
1. PBF | B7L9I0 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8461 |
1. PBF | A1A0L0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.78e-49 | 3.36e-20 | 0.9159 |
1. PBF | Q04HU2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.9149 |
1. PBF | C1DA28 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.74e-49 | 1.21e-16 | 0.8675 |
1. PBF | C3LGR6 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.04e-51 | 3.26e-28 | 0.9163 |
1. PBF | Q32IU4 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.8462 |
1. PBF | Q3AXE9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.36e-38 | 1.59e-10 | 0.8617 |
1. PBF | P67517 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.01e-33 | 4.44e-11 | 0.8737 |
1. PBF | A0KTW2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.26e-48 | 3.82e-12 | 0.8689 |
1. PBF | B2G510 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.38e-52 | 2.58e-25 | 0.9134 |
1. PBF | C5D9W1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.46e-49 | 2.11e-29 | 0.9147 |
1. PBF | B4SRE2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.14e-46 | 4.06e-21 | 0.8796 |
1. PBF | B0TX39 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.91e-52 | 3.21e-29 | 0.9043 |
1. PBF | A1WL60 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.96e-47 | 1.86e-14 | 0.8672 |
1. PBF | Q2RFU1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.02e-45 | 4.76e-19 | 0.8783 |
1. PBF | A0M0D0 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.82e-44 | 4.33e-25 | 0.9021 |
1. PBF | A4XYY1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.45e-48 | 7.63e-21 | 0.8639 |
1. PBF | Q5M229 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.05e-48 | 4.26e-19 | 0.8908 |
1. PBF | B0UVQ3 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.58e-48 | 1.38e-16 | 0.8596 |
1. PBF | C4ZWC3 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | 0.845 |
1. PBF | B8IEM4 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.20e-43 | 2.20e-10 | 0.8866 |
1. PBF | A0B913 | Putative ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.67e-42 | 3.01e-26 | 0.9001 |
1. PBF | C4L022 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.16e-48 | 6.28e-24 | 0.914 |
1. PBF | B8GV07 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.80e-52 | 3.82e-14 | 0.8876 |
1. PBF | P44470 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.43e-46 | 8.24e-16 | 0.864 |
1. PBF | C1FNH5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.63e-46 | 4.12e-29 | 0.9177 |
1. PBF | Q7MN10 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.48e-48 | 2.97e-16 | 0.869 |
1. PBF | B3PKN1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 5.04e-53 | 1.37e-21 | 0.87 |
1. PBF | P0A4S3 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.84e-46 | 3.64e-23 | 0.8998 |
1. PBF | Q7VCH9 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.55e-39 | 6.34e-12 | 0.8437 |
1. PBF | A0LCY8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 7.64e-48 | 4.81e-14 | 0.8747 |
1. PBF | A0LI59 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.51e-48 | 7.64e-12 | 0.9115 |
1. PBF | P0A0N7 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | 0.9068 |
1. PBF | A0PXE8 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 8.95e-50 | 2.57e-28 | 0.9199 |
1. PBF | B7IFP5 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 6.40e-47 | 3.26e-14 | 0.9142 |
1. PBF | B4EV08 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.68e-44 | 2.58e-14 | 0.8765 |
1. PBF | Q4K5G2 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 1.44e-48 | 3.64e-18 | 0.8595 |
1. PBF | Q1WVS1 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 4.19e-47 | 1.34e-24 | 0.9139 |
1. PBF | B3H2J7 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 3.28e-47 | 2.57e-15 | 0.8648 |
2. PF | O27185 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.50e-04 | 4.53e-07 | NA | 0.5402 |
2. PF | Q6LXC7 | tRNA (cytidine(56)-2'-O)-methyltransferase | 3.77e-05 | 4.65e-10 | NA | 0.5151 |
2. PF | A0RYD1 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.42e-04 | 2.92e-12 | NA | 0.5053 |
2. PF | A5ULQ9 | tRNA (cytidine(56)-2'-O)-methyltransferase | 6.38e-05 | 5.88e-08 | NA | 0.5375 |
3. BF | Q01445 | Uncharacterized protein in ffh 3'region (Fragment) | 1.49e-05 | NA | 1.37e-29 | 0.7351 |
3. BF | Q0SPW1 | Putative ribosomal RNA large subunit methyltransferase H 2 | 9.98e-11 | NA | 1.86e-18 | 0.8824 |
4. PB | Q2G252 | Ribosomal RNA large subunit methyltransferase H | 0.00e+00 | 2.87e-49 | 3.74e-32 | NA |
4. PB | Q9LXB4 | Putative RNA methyltransferase At5g10620 | 0.00e+00 | 1.01e-04 | 1.16e-10 | NA |
4. PB | P0A8I8 | Ribosomal RNA large subunit methyltransferase H | 1.11e-16 | 1.49e-46 | 9.49e-14 | NA |
5. P | A8AQF2 | 3-dehydroquinate dehydratase | 2.47e-02 | 1.47e-03 | NA | NA |
5. P | A4WF69 | 3-dehydroquinate dehydratase | 2.12e-02 | 1.51e-02 | NA | NA |
5. P | Q3IDT2 | 3-dehydroquinate dehydratase | 9.78e-03 | 8.62e-03 | NA | NA |
5. P | Q7U4X5 | 3-dehydroquinate dehydratase | 2.49e-02 | 4.69e-02 | NA | NA |
5. P | Q1CEX0 | UPF0301 protein YPN_3133 | 4.49e-01 | 1.94e-02 | NA | NA |
5. P | Q2A220 | 3-dehydroquinate dehydratase | 1.17e-02 | 8.07e-03 | NA | NA |
5. P | Q7NR75 | UPF0301 protein CV_3909 | 4.41e-01 | 3.85e-02 | NA | NA |
5. P | C6X9I5 | tRNA (cytidine(34)-2'-O)-methyltransferase | 3.31e-06 | 1.12e-09 | NA | NA |
5. P | A1AFD4 | UPF0301 protein YqgE | 4.93e-01 | 4.80e-02 | NA | NA |
5. P | A0KNI3 | 3-dehydroquinate dehydratase | 2.53e-02 | 1.21e-03 | NA | NA |
5. P | B0R434 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.68e-04 | 7.83e-09 | NA | NA |
5. P | A3DN06 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.95e-04 | 3.34e-10 | NA | NA |
5. P | B0UWW1 | UPF0301 protein HSM_1900 | 2.73e-01 | 4.92e-03 | NA | NA |
5. P | A5IHD0 | 3-dehydroquinate dehydratase | 2.78e-02 | 3.64e-04 | NA | NA |
5. P | Q02U07 | UPF0301 protein PA14_05290 | 4.78e-01 | 4.23e-02 | NA | NA |
5. P | Q0I1Y1 | 3-dehydroquinate dehydratase | 3.70e-02 | 3.20e-02 | NA | NA |
5. P | Q5H2Z2 | UPF0301 protein XOO1425 | 4.83e-01 | 1.65e-03 | NA | NA |
5. P | B7IXJ0 | 3-dehydroquinate dehydratase | 2.50e-02 | 8.07e-03 | NA | NA |
5. P | Q3IP06 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.85e-04 | 1.17e-10 | NA | NA |
5. P | A1RY31 | tRNA (cytidine(56)-2'-O)-methyltransferase | 3.15e-05 | 1.03e-12 | NA | NA |
5. P | Q2FT21 | tRNA (cytidine(56)-2'-O)-methyltransferase | 7.78e-05 | 2.60e-10 | NA | NA |
5. P | Q8TX72 | tRNA (cytidine(56)-2'-O)-methyltransferase | 2.14e-04 | 1.21e-07 | NA | NA |
5. P | C6DIK5 | 3-dehydroquinate dehydratase | 2.69e-02 | 3.84e-03 | NA | NA |
5. P | Q5SM16 | tRNA (guanosine(18)-2'-O)-methyltransferase | 4.83e-04 | 2.36e-02 | NA | NA |
5. P | B6I786 | UPF0301 protein YqgE | 4.72e-01 | 4.80e-02 | NA | NA |
5. P | A9IM00 | 3-dehydroquinate dehydratase | 1.89e-02 | 1.16e-02 | NA | NA |
5. P | Q3AMA6 | 3-dehydroquinate dehydratase | 1.98e-02 | 2.96e-02 | NA | NA |
5. P | A5UYA1 | 3-dehydroquinate dehydratase | 2.67e-02 | 1.72e-02 | NA | NA |
5. P | Q8YGU6 | 3-dehydroquinate dehydratase | 1.99e-02 | 4.44e-02 | NA | NA |
5. P | Q730Z4 | 3-dehydroquinate dehydratase | 2.55e-02 | 2.21e-02 | NA | NA |
5. P | B5XNE4 | 3-dehydroquinate dehydratase | 2.31e-02 | 4.30e-02 | NA | NA |
5. P | Q4UZB2 | 3-dehydroquinate dehydratase | 2.63e-02 | 1.78e-02 | NA | NA |
5. P | P74516 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 1.24e-05 | 1.46e-06 | NA | NA |
5. P | Q9HRC8 | tRNA (cytidine(56)-2'-O)-methyltransferase | 2.46e-04 | 7.83e-09 | NA | NA |
5. P | Q721N0 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 1.18e-06 | 8.60e-08 | NA | NA |
5. P | P43878 | 3-dehydroquinate dehydratase | 2.52e-02 | 4.16e-02 | NA | NA |
5. P | B7HNW2 | 3-dehydroquinate dehydratase | 2.56e-02 | 2.21e-02 | NA | NA |
5. P | Q8ZHG3 | UPF0301 protein YPO0936/y3322/YP_3506 | 4.65e-01 | 1.94e-02 | NA | NA |
5. P | Q12E50 | tRNA (cytidine(34)-2'-O)-methyltransferase | 9.59e-05 | 7.35e-06 | NA | NA |
5. P | Q9YAD3 | tRNA (cytidine(56)-2'-O)-methyltransferase | 7.56e-05 | 2.16e-05 | NA | NA |
5. P | Q21LN7 | tRNA (cytidine(34)-2'-O)-methyltransferase | 6.21e-06 | 3.15e-08 | NA | NA |
5. P | B0UV80 | 3-dehydroquinate dehydratase | 3.69e-02 | 3.20e-02 | NA | NA |
5. P | B1JNP6 | UPF0301 protein YPK_0837 | 4.57e-01 | 2.34e-02 | NA | NA |
5. P | P0A8W7 | UPF0301 protein YqgE | 4.77e-01 | 4.80e-02 | NA | NA |
5. P | B7I9Y9 | 3-dehydroquinate dehydratase | 2.96e-02 | 4.47e-02 | NA | NA |
5. P | D7A3L6 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.54e-05 | 2.16e-09 | NA | NA |
5. P | Q48V41 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 5.00e-06 | 5.08e-05 | NA | NA |
5. P | Q9KV60 | 3-dehydroquinate dehydratase | 2.58e-02 | 1.36e-02 | NA | NA |
5. P | A9R1Y4 | 3-dehydroquinate dehydratase | 2.23e-02 | 4.65e-02 | NA | NA |
5. P | B2K461 | 3-dehydroquinate dehydratase | 2.41e-02 | 4.65e-02 | NA | NA |
5. P | B8CQG1 | UPF0301 protein swp_3600 | 4.09e-01 | 1.36e-02 | NA | NA |
5. P | O30557 | 3-dehydroquinate dehydratase 1 | 2.52e-02 | 3.91e-02 | NA | NA |
5. P | B0TZ52 | 3-dehydroquinate dehydratase | 1.20e-02 | 1.98e-03 | NA | NA |
5. P | B9WC12 | Catabolic 3-dehydroquinase | 2.56e-02 | 2.69e-02 | NA | NA |
5. P | Q8DLJ7 | 3-dehydroquinate dehydratase | 1.01e-02 | 1.82e-02 | NA | NA |
5. P | Q8P765 | UPF0301 protein XCC2748 | 5.09e-01 | 2.28e-03 | NA | NA |
5. P | Q741J6 | 3-dehydroquinate dehydratase | 2.57e-02 | 2.69e-02 | NA | NA |
5. P | C3LQQ3 | 3-dehydroquinate dehydratase | 2.70e-02 | 3.94e-03 | NA | NA |
5. P | Q8K9F1 | 3-dehydroquinate dehydratase | 2.46e-02 | 3.94e-03 | NA | NA |
5. P | B0V732 | 3-dehydroquinate dehydratase | 2.99e-02 | 4.47e-02 | NA | NA |
5. P | P47588 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 1.29e-06 | 6.54e-09 | NA | NA |
5. P | Q4QLT8 | 3-dehydroquinate dehydratase | 2.50e-02 | 1.69e-02 | NA | NA |
5. P | Q0I1B4 | UPF0301 protein HS_0009 | 2.22e-01 | 1.10e-02 | NA | NA |
5. P | P54517 | 3-dehydroquinate dehydratase | 2.30e-02 | 4.33e-02 | NA | NA |
5. P | B2VF12 | UPF0301 protein ETA_28320 | 4.75e-01 | 1.16e-02 | NA | NA |
5. P | Q7WF89 | 3-dehydroquinate dehydratase | 2.07e-02 | 5.77e-03 | NA | NA |
5. P | Q975T9 | tRNA (cytidine(56)-2'-O)-methyltransferase | 9.19e-05 | 5.89e-07 | NA | NA |
5. P | Q9PH97 | 3-dehydroquinate dehydratase | 3.02e-02 | 5.97e-03 | NA | NA |
5. P | Q14IY5 | 3-dehydroquinate dehydratase | 1.15e-02 | 8.07e-03 | NA | NA |
5. P | Q1C1N7 | 3-dehydroquinate dehydratase | 2.31e-02 | 4.65e-02 | NA | NA |
5. P | B7LYX8 | UPF0301 protein YqgE | 4.72e-01 | 4.80e-02 | NA | NA |
5. P | Q0AIU6 | UPF0301 protein Neut_0448 | 3.94e-01 | 2.21e-02 | NA | NA |
5. P | Q2NF55 | tRNA (cytidine(56)-2'-O)-methyltransferase | 6.37e-05 | 3.69e-11 | NA | NA |
5. P | Q2P5W3 | UPF0301 protein XOO1309 | 4.81e-01 | 1.65e-03 | NA | NA |
5. P | Q4FVM7 | UPF0301 protein Psyc_0057 | 4.24e-01 | 3.03e-02 | NA | NA |
5. P | C3P7X7 | 3-dehydroquinate dehydratase | 2.66e-02 | 1.98e-02 | NA | NA |
5. P | A6VH11 | tRNA (cytidine(56)-2'-O)-methyltransferase | 3.61e-05 | 2.63e-09 | NA | NA |
5. P | A9VGY2 | 3-dehydroquinate dehydratase | 2.41e-02 | 9.85e-03 | NA | NA |
5. P | A4SJM5 | 3-dehydroquinate dehydratase | 2.32e-02 | 9.69e-03 | NA | NA |
5. P | Q487R8 | 3-dehydroquinate dehydratase | 1.66e-02 | 3.24e-03 | NA | NA |
5. P | C7BSD3 | tRNA (cytidine(34)-2'-O)-methyltransferase | 6.70e-05 | 2.21e-09 | NA | NA |
5. P | C3LKM7 | 3-dehydroquinate dehydratase | 2.56e-02 | 1.98e-02 | NA | NA |
5. P | Q1R1I6 | UPF0301 protein Csal_0058 | 4.54e-01 | 1.14e-03 | NA | NA |
5. P | Q2S9M0 | 3-dehydroquinate dehydratase | 1.82e-02 | 1.85e-02 | NA | NA |
5. P | P32813 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 4.40e-07 | 6.61e-09 | NA | NA |
5. P | Q0TDQ3 | UPF0301 protein YqgE | 4.70e-01 | 4.80e-02 | NA | NA |
5. P | B2FRV1 | UPF0301 protein Smlt1098 | 4.68e-01 | 4.84e-02 | NA | NA |
5. P | Q6DAJ1 | 3-dehydroquinate dehydratase | 2.09e-02 | 2.16e-03 | NA | NA |
5. P | B2SDP9 | 3-dehydroquinate dehydratase | 1.32e-02 | 8.62e-03 | NA | NA |
5. P | A0Q5E2 | 3-dehydroquinate dehydratase | 1.15e-02 | 8.07e-03 | NA | NA |
5. P | A4FW99 | tRNA (cytidine(56)-2'-O)-methyltransferase | 4.10e-05 | 3.22e-10 | NA | NA |
5. P | A2RKW7 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 2.17e-04 | 2.82e-08 | NA | NA |
5. P | A1WBM9 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.65e-03 | 4.78e-07 | NA | NA |
5. P | A9I1W8 | 3-dehydroquinate dehydratase | 2.02e-02 | 2.64e-03 | NA | NA |
5. P | Q4QNN9 | UPF0301 protein NTHI0415 | 4.70e-01 | 1.94e-02 | NA | NA |
5. P | A8APG7 | UPF0301 protein CKO_04323 | 4.77e-01 | 1.71e-02 | NA | NA |
5. P | C4L3G2 | 3-dehydroquinate dehydratase | 2.79e-02 | 6.17e-03 | NA | NA |
5. P | B1KR25 | 3-dehydroquinate dehydratase | 1.83e-02 | 9.29e-03 | NA | NA |
5. P | Q12J15 | 3-dehydroquinate dehydratase | 1.11e-02 | 1.25e-02 | NA | NA |
5. P | Q3BR19 | UPF0301 protein XCV3063 | 4.98e-01 | 4.08e-03 | NA | NA |
5. P | Q1QEQ7 | UPF0301 protein Pcryo_0062 | 4.52e-01 | 2.93e-02 | NA | NA |
5. P | Q818P8 | 3-dehydroquinate dehydratase | 2.78e-02 | 2.38e-02 | NA | NA |
5. P | B1XFA8 | UPF0301 protein YqgE | 4.94e-01 | 4.80e-02 | NA | NA |
5. P | B8ECJ0 | 3-dehydroquinate dehydratase | 1.74e-02 | 1.09e-02 | NA | NA |
5. P | B0TS36 | 3-dehydroquinate dehydratase | 1.99e-02 | 2.91e-02 | NA | NA |
5. P | A2BLW3 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.79e-04 | 1.04e-08 | NA | NA |
5. P | Q8DD00 | 3-dehydroquinate dehydratase | 2.68e-02 | 1.19e-02 | NA | NA |
5. P | Q31II2 | 3-dehydroquinate dehydratase | 2.52e-02 | 1.04e-03 | NA | NA |
5. P | Q87F94 | 3-dehydroquinate dehydratase | 2.08e-02 | 1.60e-02 | NA | NA |
5. P | B7KFE6 | 3-dehydroquinate dehydratase | 1.44e-02 | 3.85e-02 | NA | NA |
5. P | B9IXJ3 | 3-dehydroquinate dehydratase | 2.55e-02 | 2.21e-02 | NA | NA |
5. P | P57903 | 3-dehydroquinate dehydratase | 2.51e-02 | 5.82e-03 | NA | NA |
5. P | P75257 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 1.72e-06 | 5.87e-11 | NA | NA |
5. P | B7MMD6 | UPF0301 protein YqgE | 4.95e-01 | 4.80e-02 | NA | NA |
5. P | A4XQ67 | 3-dehydroquinate dehydratase | 2.76e-02 | 1.17e-02 | NA | NA |
5. P | A7I7T4 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.79e-04 | 4.04e-10 | NA | NA |
5. P | Q18HD7 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.93e-04 | 1.06e-09 | NA | NA |
5. P | Q12Z63 | tRNA (cytidine(56)-2'-O)-methyltransferase | 6.23e-04 | 1.17e-09 | NA | NA |
5. P | C4LAE7 | 3-dehydroquinate dehydratase | 2.02e-02 | 3.91e-02 | NA | NA |
5. P | A4TI77 | UPF0301 protein YPDSF_0579 | 4.51e-01 | 1.94e-02 | NA | NA |
5. P | A6UWW4 | tRNA (cytidine(56)-2'-O)-methyltransferase | 9.36e-05 | 2.59e-11 | NA | NA |
5. P | Q7N030 | 3-dehydroquinate dehydratase | 1.48e-02 | 4.37e-02 | NA | NA |
5. P | Q74Y93 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.73e-03 | 2.03e-10 | NA | NA |
5. P | B8CTL3 | 3-dehydroquinate dehydratase | 1.33e-02 | 2.32e-02 | NA | NA |
5. P | A5GF08 | 3-dehydroquinate dehydratase | 2.26e-02 | 3.50e-03 | NA | NA |
5. P | B8GP63 | UPF0301 protein Tgr7_2910 | 4.00e-01 | 1.39e-02 | NA | NA |
5. P | Q9YAD8 | Uncharacterized protein APE_2001.1 | 1.06e-03 | 9.04e-05 | NA | NA |
5. P | B7HB70 | 3-dehydroquinate dehydratase | 2.55e-02 | 1.60e-02 | NA | NA |
5. P | A7FEZ1 | UPF0301 protein YpsIP31758_0835 | 5.10e-01 | 2.34e-02 | NA | NA |
5. P | Q8Q0Q0 | tRNA (cytidine(56)-2'-O)-methyltransferase | 4.99e-04 | 4.40e-14 | NA | NA |
5. P | A5DAY6 | Catabolic 3-dehydroquinase | 2.85e-02 | 4.63e-03 | NA | NA |
5. P | Q82U41 | UPF0301 protein NE1668 | 4.39e-01 | 4.13e-02 | NA | NA |
5. P | A4J3D2 | 3-dehydroquinate dehydratase | 2.42e-02 | 1.87e-02 | NA | NA |
5. P | Q1R779 | UPF0301 protein YqgE | 5.16e-01 | 4.80e-02 | NA | NA |
5. P | A8FSM5 | UPF0301 protein Ssed_1237 | 4.50e-01 | 4.00e-02 | NA | NA |
5. P | Q466X1 | tRNA (cytidine(56)-2'-O)-methyltransferase | 5.35e-04 | 3.11e-12 | NA | NA |
5. P | Q32C17 | UPF0301 protein YqgE | 4.84e-01 | 4.80e-02 | NA | NA |
5. P | A4VPK2 | 3-dehydroquinate dehydratase | 2.57e-02 | 4.07e-02 | NA | NA |
5. P | A6UQ70 | tRNA (cytidine(56)-2'-O)-methyltransferase | 5.88e-05 | 9.76e-11 | NA | NA |
5. P | A7MJR9 | UPF0301 protein ESA_00394 | 5.04e-01 | 2.36e-02 | NA | NA |
5. P | Q7VUS7 | 3-dehydroquinate dehydratase | 1.96e-02 | 5.77e-03 | NA | NA |
5. P | A8G0R9 | 3-dehydroquinate dehydratase | 1.18e-02 | 1.47e-03 | NA | NA |
5. P | Q9YDX2 | tRNA (pseudouridine(54)-N(1))-methyltransferase | 2.45e-03 | 2.38e-05 | NA | NA |
5. P | Q0W8P0 | tRNA (cytidine(56)-2'-O)-methyltransferase | 2.84e-04 | 5.81e-10 | NA | NA |
5. P | Q665E8 | 3-dehydroquinate dehydratase | 2.38e-02 | 4.65e-02 | NA | NA |
5. P | Q8ZAX1 | 3-dehydroquinate dehydratase | 2.28e-02 | 4.65e-02 | NA | NA |
5. P | C5BP61 | 3-dehydroquinate dehydratase | 2.41e-02 | 3.28e-02 | NA | NA |
5. P | Q8TL02 | tRNA (cytidine(56)-2'-O)-methyltransferase | 5.49e-04 | 1.10e-12 | NA | NA |
5. P | A1U695 | 3-dehydroquinate dehydratase | 2.57e-02 | 1.72e-02 | NA | NA |
5. P | Q6FBI3 | 3-dehydroquinate dehydratase | 2.51e-02 | 2.58e-02 | NA | NA |
5. P | A3CZT7 | 3-dehydroquinate dehydratase | 1.52e-02 | 8.91e-03 | NA | NA |
5. P | Q8ZVQ3 | tRNA (pseudouridine(54)-N(1))-methyltransferase | 2.15e-04 | 9.58e-08 | NA | NA |
5. P | B8GUV7 | 3-dehydroquinate dehydratase | 2.32e-02 | 4.96e-03 | NA | NA |
5. P | Q60A28 | 3-dehydroquinate dehydratase | 1.49e-02 | 1.41e-02 | NA | NA |
5. P | A9A624 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.29e-04 | 1.33e-09 | NA | NA |
5. P | A4YJ14 | tRNA (cytidine(56)-2'-O)-methyltransferase | 3.11e-04 | 2.95e-05 | NA | NA |
5. P | B8FQ77 | 3-dehydroquinate dehydratase | 2.47e-02 | 9.29e-03 | NA | NA |
5. P | A6WT39 | 3-dehydroquinate dehydratase | 1.85e-02 | 8.91e-03 | NA | NA |
5. P | A3NR15 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.05e-04 | 1.99e-07 | NA | NA |
5. P | B2K0T3 | UPF0301 protein YPTS_3341 | 4.50e-01 | 2.34e-02 | NA | NA |
5. P | A9R308 | UPF0301 protein YpAngola_A3341 | 4.49e-01 | 1.94e-02 | NA | NA |
5. P | Q9UYD1 | tRNA (cytidine(56)-2'-O)-methyltransferase | 6.60e-05 | 2.36e-06 | NA | NA |
5. P | Q8XCW1 | UPF0301 protein YqgE | 4.72e-01 | 4.80e-02 | NA | NA |
5. P | A6W6P9 | 3-dehydroquinate dehydratase | 1.55e-02 | 7.87e-03 | NA | NA |
5. P | C5M799 | Catabolic 3-dehydroquinase | 2.65e-02 | 1.33e-02 | NA | NA |
5. P | B1JKF8 | 3-dehydroquinate dehydratase | 2.55e-02 | 4.65e-02 | NA | NA |
5. P | B8CHC9 | tRNA (cytidine(34)-2'-O)-methyltransferase | 2.50e-06 | 2.66e-09 | NA | NA |
5. P | A7NDV1 | 3-dehydroquinate dehydratase | 1.22e-02 | 8.07e-03 | NA | NA |
5. P | B1XT51 | 3-dehydroquinate dehydratase | 2.35e-02 | 4.22e-03 | NA | NA |
5. P | Q65HH2 | 3-dehydroquinate dehydratase | 1.16e-02 | 2.98e-02 | NA | NA |
5. P | Q1CDU2 | 3-dehydroquinate dehydratase | 2.41e-02 | 4.65e-02 | NA | NA |
5. P | B7N7K1 | UPF0301 protein YqgE | 4.70e-01 | 4.80e-02 | NA | NA |
5. P | A5UIB2 | 3-dehydroquinate dehydratase | 2.50e-02 | 1.90e-02 | NA | NA |
5. P | A1SZA3 | 3-dehydroquinate dehydratase | 2.96e-02 | 1.58e-03 | NA | NA |
5. P | A4SVB8 | 3-dehydroquinate dehydratase | 2.65e-02 | 4.01e-03 | NA | NA |
5. P | Q4UWY9 | UPF0301 protein XC_1365 | 4.67e-01 | 2.28e-03 | NA | NA |
5. P | C1DCV6 | 3-dehydroquinate dehydratase | 3.56e-02 | 1.43e-02 | NA | NA |
5. P | Q72GI1 | tRNA (guanosine(18)-2'-O)-methyltransferase | 1.35e-03 | 2.36e-02 | NA | NA |
5. P | Q634Y5 | 3-dehydroquinate dehydratase | 2.57e-02 | 1.98e-02 | NA | NA |
5. P | P0A8W5 | UPF0301 protein YqgE | 5.20e-01 | 4.80e-02 | NA | NA |
5. P | A7ZR71 | UPF0301 protein YqgE | 4.74e-01 | 4.80e-02 | NA | NA |
5. P | A1WZI8 | 3-dehydroquinate dehydratase | 2.29e-02 | 2.70e-04 | NA | NA |
5. P | Q57677 | Uncharacterized protein MJ0224 | 4.12e-04 | 1.33e-04 | NA | NA |
5. P | P73367 | 3-dehydroquinate dehydratase | 1.98e-02 | 1.85e-03 | NA | NA |
5. P | B1LXE5 | 3-dehydroquinate dehydratase | 1.60e-02 | 1.91e-02 | NA | NA |
5. P | C5A0L7 | UPF0301 protein YqgE | 4.73e-01 | 4.80e-02 | NA | NA |
5. P | B0U0F0 | UPF0301 protein Fphi_1754 | 4.76e-01 | 4.40e-02 | NA | NA |
5. P | Q5JEG5 | tRNA (cytidine(56)-2'-O)-methyltransferase | 3.51e-05 | 5.87e-11 | NA | NA |
5. P | Q81M32 | 3-dehydroquinate dehydratase | 2.60e-02 | 1.98e-02 | NA | NA |
5. P | P44868 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.80e-05 | 2.02e-09 | NA | NA |
5. P | Q12KS3 | UPF0301 protein Sden_2674 | 4.56e-01 | 2.46e-02 | NA | NA |
5. P | Q0AEU9 | 3-dehydroquinate dehydratase | 2.49e-02 | 3.79e-02 | NA | NA |
5. P | Q9PBB6 | UPF0301 protein XF_2228 | 4.29e-01 | 9.61e-03 | NA | NA |
5. P | Q24UX5 | 3-dehydroquinate dehydratase | 2.29e-02 | 7.48e-03 | NA | NA |
5. P | Q07Z75 | UPF0301 protein Sfri_2850 | 5.15e-01 | 3.52e-02 | NA | NA |
5. P | Q58599 | Uncharacterized protein MJ1199 | 6.52e-05 | 1.59e-08 | NA | NA |
5. P | B0U3C2 | UPF0301 protein Xfasm12_1428 | 4.43e-01 | 7.87e-03 | NA | NA |
5. P | Q0C000 | 3-dehydroquinate dehydratase | 2.37e-02 | 2.89e-02 | NA | NA |
5. P | Q8TQU1 | tRNA (pseudouridine(54)-N(1))-methyltransferase | 1.09e-04 | 2.07e-03 | NA | NA |
5. P | O29507 | tRNA (cytidine(56)-2'-O)-methyltransferase | 9.59e-05 | 6.16e-10 | NA | NA |
5. P | O58214 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.96e-04 | 3.31e-02 | NA | NA |
5. P | A3CVQ1 | tRNA (cytidine(56)-2'-O)-methyltransferase | 2.63e-04 | 2.33e-12 | NA | NA |
5. P | O31590 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 8.43e-07 | 1.40e-08 | NA | NA |
5. P | Q8U3K5 | tRNA (cytidine(56)-2'-O)-methyltransferase | 6.41e-05 | 4.94e-06 | NA | NA |
5. P | A1TKL7 | UPF0301 protein Aave_0907 | 6.49e-01 | 2.80e-02 | NA | NA |
5. P | A3M692 | 3-dehydroquinate dehydratase | 2.77e-02 | 2.84e-02 | NA | NA |
5. P | Q0BBL1 | tRNA (cytidine(34)-2'-O)-methyltransferase | 7.15e-05 | 1.52e-07 | NA | NA |
5. P | Q7NHU3 | 3-dehydroquinate dehydratase | 1.63e-02 | 2.14e-02 | NA | NA |
5. P | Q5ZYA8 | 3-dehydroquinate dehydratase | 2.78e-02 | 5.52e-04 | NA | NA |
5. P | Q6HDW6 | 3-dehydroquinate dehydratase | 2.55e-02 | 1.98e-02 | NA | NA |
5. P | Q9CJX1 | UPF0301 protein PM1869 | 2.65e-01 | 2.84e-02 | NA | NA |
5. P | B3E9N5 | 3-dehydroquinate dehydratase | 2.33e-02 | 6.60e-03 | NA | NA |
5. P | Q5WZ76 | 3-dehydroquinate dehydratase | 2.78e-02 | 5.52e-04 | NA | NA |
5. P | P69001 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase | 8.84e-07 | 3.10e-07 | NA | NA |
5. P | B8E0Z3 | 3-dehydroquinate dehydratase | 8.91e-03 | 4.92e-03 | NA | NA |
5. P | Q3YXS3 | UPF0301 protein YqgE | 5.44e-01 | 4.80e-02 | NA | NA |
5. P | A3QID1 | 3-dehydroquinate dehydratase | 3.02e-02 | 2.46e-02 | NA | NA |
5. P | Q8PIH9 | UPF0301 protein XAC2918 | 4.96e-01 | 5.39e-03 | NA | NA |
5. P | Q5V3R4 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.43e-04 | 1.20e-11 | NA | NA |
5. P | A4THC4 | 3-dehydroquinate dehydratase | 2.55e-02 | 4.65e-02 | NA | NA |
5. P | B0RN47 | 3-dehydroquinate dehydratase | 2.62e-02 | 2.48e-02 | NA | NA |
5. P | A8A488 | UPF0301 protein YqgE | 4.93e-01 | 4.80e-02 | NA | NA |
5. P | B0RQM8 | UPF0301 protein xcc-b100_1413 | 4.94e-01 | 2.28e-03 | NA | NA |
5. P | P0AGJ7 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.34e-05 | 7.15e-09 | NA | NA |
5. P | B2I663 | 3-dehydroquinate dehydratase | 2.84e-02 | 1.60e-02 | NA | NA |
5. P | B7JM50 | 3-dehydroquinate dehydratase | 2.58e-02 | 1.98e-02 | NA | NA |
5. P | A5UAI5 | UPF0301 protein CGSHiEE_01530 | 5.04e-01 | 1.33e-02 | NA | NA |
5. P | Q2KUV4 | 3-dehydroquinate dehydratase | 3.99e-02 | 1.12e-03 | NA | NA |
5. P | A2SQM4 | tRNA (cytidine(56)-2'-O)-methyltransferase | 2.78e-04 | 1.81e-08 | NA | NA |
5. P | A1JPT5 | UPF0301 protein YE3428 | 5.30e-01 | 4.22e-03 | NA | NA |
5. P | A0B9Q9 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.46e-04 | 5.84e-12 | NA | NA |
5. P | Q7NZD5 | 3-dehydroquinate dehydratase | 3.17e-02 | 1.65e-02 | NA | NA |
5. P | B7LFL1 | UPF0301 protein YqgE | 5.37e-01 | 4.80e-02 | NA | NA |
5. P | B2I5Z0 | UPF0301 protein XfasM23_1361 | 4.31e-01 | 7.74e-03 | NA | NA |
5. P | Q5NHI3 | 3-dehydroquinate dehydratase | 1.18e-02 | 8.07e-03 | NA | NA |
5. P | Q82WL9 | 3-dehydroquinate dehydratase | 3.31e-02 | 9.93e-03 | NA | NA |
5. P | Q8RH64 | 3-dehydroquinate dehydratase | 9.39e-03 | 1.51e-02 | NA | NA |
5. P | B7MZP7 | UPF0301 protein YqgE | 4.91e-01 | 4.80e-02 | NA | NA |
5. P | A7FDQ8 | 3-dehydroquinate dehydratase | 2.27e-02 | 4.65e-02 | NA | NA |
5. P | Q3AWG6 | 3-dehydroquinate dehydratase | 1.91e-02 | 1.23e-03 | NA | NA |
5. P | B7H1C7 | 3-dehydroquinate dehydratase | 3.00e-02 | 4.47e-02 | NA | NA |
5. P | C1ERS1 | 3-dehydroquinate dehydratase | 2.32e-02 | 1.98e-02 | NA | NA |
5. P | B9MKD4 | 3-dehydroquinate dehydratase | 1.06e-02 | 3.76e-02 | NA | NA |
5. P | Q666P0 | UPF0301 protein YPTB3208 | 5.10e-01 | 2.34e-02 | NA | NA |
5. P | Q9X1Q6 | Uncharacterized protein TM_1570 | 5.05e-04 | 3.79e-07 | NA | NA |
5. P | P43980 | UPF0301 protein HI_0304 | 5.08e-01 | 2.01e-02 | NA | NA |
5. P | A4IZE9 | 3-dehydroquinate dehydratase | 1.28e-02 | 8.07e-03 | NA | NA |
5. P | Q87C20 | UPF0301 protein PD_1276 | 4.31e-01 | 7.74e-03 | NA | NA |
5. P | Q7W3V9 | 3-dehydroquinate dehydratase | 2.10e-02 | 5.77e-03 | NA | NA |
5. P | A6UYL5 | UPF0301 protein PSPA7_0505 | 4.53e-01 | 2.82e-02 | NA | NA |
5. P | Q980M4 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.01e-04 | 3.17e-07 | NA | NA |
5. P | Q1LSZ6 | UPF0301 protein BCI_0481 | 4.92e-01 | 1.55e-02 | NA | NA |
5. P | Q8PD27 | 3-dehydroquinate dehydratase | 2.67e-02 | 1.78e-02 | NA | NA |
5. P | B8F6C8 | 3-dehydroquinate dehydratase | 2.84e-02 | 7.00e-03 | NA | NA |
5. P | Q7MGU2 | 3-dehydroquinate dehydratase | 2.67e-02 | 1.19e-02 | NA | NA |
5. P | A5UDA0 | 3-dehydroquinate dehydratase | 2.36e-02 | 1.22e-02 | NA | NA |
5. P | Q2Y654 | UPF0301 protein Nmul_A2478 | 4.59e-01 | 1.72e-02 | NA | NA |
5. P | A0KAS4 | tRNA (cytidine(34)-2'-O)-methyltransferase | 6.83e-05 | 1.57e-06 | NA | NA |
5. P | Q5X7S5 | 3-dehydroquinate dehydratase | 2.75e-02 | 3.64e-04 | NA | NA |
5. P | A5F3S6 | 3-dehydroquinate dehydratase | 2.63e-02 | 3.94e-03 | NA | NA |
5. P | B2I3H4 | 3-dehydroquinate dehydratase | 2.98e-02 | 4.47e-02 | NA | NA |
5. P | Q3AAZ0 | 3-dehydroquinate dehydratase | 1.95e-02 | 3.16e-03 | NA | NA |
5. P | B0VR94 | 3-dehydroquinate dehydratase | 2.96e-02 | 4.47e-02 | NA | NA |
5. P | Q1CB75 | UPF0301 protein YPA_0329 | 4.57e-01 | 1.94e-02 | NA | NA |
5. P | Q59Z17 | Catabolic 3-dehydroquinase | 2.66e-02 | 2.16e-02 | NA | NA |
5. P | Q5QVU2 | 3-dehydroquinate dehydratase | 1.29e-02 | 1.04e-02 | NA | NA |
5. P | P0A8W6 | UPF0301 protein YqgE | 4.73e-01 | 4.80e-02 | NA | NA |
5. P | Q8TWL5 | tRNA (pseudouridine(54)-N(1))-methyltransferase | 2.54e-04 | 2.82e-02 | NA | NA |
5. P | A9L4M4 | 3-dehydroquinate dehydratase | 1.79e-02 | 1.07e-02 | NA | NA |
5. P | Q58780 | tRNA (cytidine(56)-2'-O)-methyltransferase | 5.12e-05 | 1.19e-09 | NA | NA |
5. P | B2IBT9 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.09e-04 | 1.24e-07 | NA | NA |
5. P | P0AGJ8 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.33e-05 | 7.15e-09 | NA | NA |
5. P | B2U0W8 | UPF0301 protein YqgE | 5.41e-01 | 4.80e-02 | NA | NA |
5. P | B5YQE6 | UPF0301 protein YqgE | 5.36e-01 | 4.80e-02 | NA | NA |
5. P | Q057I1 | 3-dehydroquinate dehydratase | 2.50e-02 | 8.07e-03 | NA | NA |
5. P | B2SIZ5 | UPF0301 protein PXO_02000 | 4.89e-01 | 1.65e-03 | NA | NA |
5. P | A0KEQ6 | tRNA (cytidine(34)-2'-O)-methyltransferase | 1.13e-05 | 5.71e-09 | NA | NA |
5. P | A1JRK0 | 3-dehydroquinate dehydratase | 2.56e-02 | 3.59e-03 | NA | NA |
5. P | Q3JC85 | 3-dehydroquinate dehydratase | 1.87e-02 | 6.44e-03 | NA | NA |
5. P | Q042B4 | Putative RNA (cytidine(34)-2'-O)-methyltransferase | 3.92e-06 | 2.62e-04 | NA | NA |
5. P | B2FJN5 | 3-dehydroquinate dehydratase | 2.44e-02 | 1.81e-02 | NA | NA |
5. P | Q0BKP9 | 3-dehydroquinate dehydratase | 1.16e-02 | 8.07e-03 | NA | NA |
5. P | B2VGX5 | 3-dehydroquinate dehydratase | 2.39e-02 | 2.69e-02 | NA | NA |
5. P | A9A9N8 | tRNA (cytidine(56)-2'-O)-methyltransferase | 4.35e-05 | 4.38e-10 | NA | NA |
6. F | Q6MTI1 | tRNA (guanine-N(1)-)-methyltransferase | 7.24e-08 | NA | NA | 0.5833 |
6. F | Q0IC33 | tRNA (guanine-N(1)-)-methyltransferase | 6.06e-07 | NA | NA | 0.5594 |
6. F | Q24UA9 | tRNA (guanine-N(1)-)-methyltransferase | 1.92e-06 | NA | NA | 0.6059 |
6. F | B1VAA9 | tRNA (guanine-N(1)-)-methyltransferase | 3.91e-07 | NA | NA | 0.5852 |
6. F | B1WPL5 | tRNA (guanine-N(1)-)-methyltransferase | 3.61e-07 | NA | NA | 0.5678 |