Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54740.1

JCVISYN3A_0363

16S rRNA processing protein.
M. mycoides homolog: Q6MTI2.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 8
Unique PROST Go: 3
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 765
Unique PROST Homologs: 133
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 3

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: rimM; Ribosome maturation factor RimM
Zhang et al. [4]: GO:0003977|UDP-N-acetylglucosamine diphosphorylase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q6F0S4 (Ribosome maturation factor RimM) with a FATCAT P-Value: 0 and RMSD of 3.05 angstrom. The sequence alignment identity is 41.6%.
Structural alignment shown in left. Query protein AVX54740.1 colored as red in alignment, homolog Q6F0S4 colored as blue. Query protein AVX54740.1 is also shown in right top, homolog Q6F0S4 showed in right bottom. They are colored based on secondary structures.

  AVX54740.1 M-NANLIKIGVIVNTFSIKGQVKVILNDDIMIDDLNKIDTFFI-KTNNNFQVL---RVQNITLNKTKNQLIVKFLNLDNINDV-IKYKNQEI-YCLKDKN 93
      Q6F0S4 MENKNLLSIGKIVNTFGIKGAVKIALEKSIEVNDINGIKLLFIENTNN---VIIPKQVESISMQKS--HLVVYFKEHNHINEVEI-FKGKKVKY-LNDND 93

  AVX54740.1 ISQII-SLIGFKFVSLKTNGIISDYMNNTYQQLVKVKSEN-QKEFWVPLVDVFIKEIDYQNKVIIAKDVEGLK 164
      Q6F0S4 AFSIFYDLTYYSVVYNKQNGKVIETMFNGNHDLVKVLLENEEKAFWVPLVDVYTNNIDDESRIITLKNIEGLK 166

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0043022	ribosome binding
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0006364	rRNA processing
1. PBF	GO:0042274	ribosomal small subunit biogenesis
1. PBF	GO:0005840	ribosome
5. P	GO:0005829	cytosol
5. P	GO:0008097	5S rRNA binding
5. P	GO:0019843	rRNA binding

Uniprot GO Annotations

GO	Description
GO:0043022	ribosome binding
GO:0005737	cytoplasm
GO:0042254	ribosome biogenesis
GO:0006364	rRNA processing
GO:0042274	ribosomal small subunit biogenesis
GO:0005840	ribosome

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q6G9X4	Ribosome maturation factor RimM	1.29e-10	2.08e-29	1.09e-05	0.5713
1. PBF	A3DDH3	Ribosome maturation factor RimM	1.34e-10	6.14e-32	1.26e-05	0.62
1. PBF	B7HLH5	Ribosome maturation factor RimM	2.24e-11	2.00e-33	0.002	0.5938
1. PBF	P66656	Ribosome maturation factor RimM	1.45e-10	2.08e-29	1.09e-05	0.5882
1. PBF	Q97I95	Ribosome maturation factor RimM	1.73e-11	1.08e-36	2.59e-06	0.6152
1. PBF	B1MZT5	Ribosome maturation factor RimM	1.23e-11	4.14e-36	7.12e-16	0.6148
1. PBF	Q819W5	Ribosome maturation factor RimM	3.57e-10	6.53e-35	0.002	0.5904
1. PBF	Q8CPH7	Ribosome maturation factor RimM	1.92e-10	2.65e-29	1.31e-07	0.599
1. PBF	Q8DYW8	Ribosome maturation factor RimM	1.81e-10	4.78e-37	0.002	0.5952
1. PBF	Q5M3J4	Ribosome maturation factor RimM	1.54e-09	7.24e-37	0.019	0.5851
1. PBF	A0LMM1	Ribosome maturation factor RimM	3.93e-10	9.60e-31	6.20e-06	0.6042
1. PBF	A6U158	Ribosome maturation factor RimM	1.50e-10	2.08e-29	1.09e-05	0.5722
1. PBF	A5N815	Ribosome maturation factor RimM	5.34e-10	1.63e-37	0.019	0.5847
1. PBF	Q03JS0	Ribosome maturation factor RimM	7.96e-08	1.18e-37	0.023	0.5898
1. PBF	Q1WU93	Ribosome maturation factor RimM	1.12e-10	6.65e-35	8.62e-06	0.5577
1. PBF	Q4L5U1	Ribosome maturation factor RimM	1.38e-10	1.39e-28	4.05e-08	0.5964
1. PBF	Q74IQ5	Ribosome maturation factor RimM	2.00e-10	1.30e-37	3.70e-09	0.5736
1. PBF	Q49X25	Ribosome maturation factor RimM	1.00e-09	2.66e-30	0.022	0.563
1. PBF	A7GRH2	Ribosome maturation factor RimM	5.30e-11	7.54e-33	5.10e-04	0.5824
1. PBF	Q5L0P5	Ribosome maturation factor RimM	1.46e-11	4.23e-32	3.01e-07	0.6318
1. PBF	A6QGD9	Ribosome maturation factor RimM	1.13e-10	2.08e-29	1.09e-05	0.5457
1. PBF	A0RHL5	Ribosome maturation factor RimM	2.42e-11	2.00e-33	0.002	0.5914
1. PBF	Q732M8	Ribosome maturation factor RimM	2.46e-11	2.00e-33	0.002	0.5873
1. PBF	B1YIM5	Ribosome maturation factor RimM	2.36e-12	2.15e-36	7.78e-05	0.6399
1. PBF	Q9CFB6	Ribosome maturation factor RimM	5.81e-12	3.54e-38	0.001	0.6396
1. PBF	Q88WJ3	Ribosome maturation factor RimM	4.24e-10	1.17e-34	7.84e-04	0.5718
1. PBF	Q8E4H6	Ribosome maturation factor RimM	5.14e-10	4.78e-37	0.002	0.5873
1. PBF	A4XLF2	Ribosome maturation factor RimM	5.53e-11	9.42e-35	0.009	0.6151
1. PBF	A8FD66	Ribosome maturation factor RimM	7.91e-13	3.51e-34	0.028	0.686
1. PBF	Q038J9	Ribosome maturation factor RimM	3.65e-09	8.55e-34	0.005	0.5026
1. PBF	A8MHC3	Ribosome maturation factor RimM	4.46e-11	1.30e-27	1.13e-04	0.5677
1. PBF	Q3K0F7	Ribosome maturation factor RimM	5.99e-10	8.08e-39	0.001	0.5837
1. PBF	B9IVD1	Ribosome maturation factor RimM	2.52e-11	2.00e-33	0.002	0.552
1. PBF	P66657	Ribosome maturation factor RimM	1.30e-10	2.08e-29	1.09e-05	0.5853
1. PBF	Q6GHJ6	Ribosome maturation factor RimM	1.23e-10	9.26e-29	5.75e-06	0.5626
1. PBF	B2V4E4	Ribosome maturation factor RimM	1.29e-08	4.40e-40	1.88e-04	0.5591
1. PBF	B2GD26	Ribosome maturation factor RimM	6.39e-11	9.03e-38	6.58e-06	0.5967
1. PBF	Q72S29	Ribosome maturation factor RimM	1.79e-09	3.42e-32	0.005	0.6361
1. PBF	C4L602	Ribosome maturation factor RimM	3.40e-10	9.53e-34	2.08e-06	0.6076
1. PBF	Q81WJ5	Ribosome maturation factor RimM	2.61e-11	1.70e-33	0.002	0.594
1. PBF	A6LSN0	Ribosome maturation factor RimM	1.75e-09	6.68e-42	0.022	0.5875
1. PBF	A6TRS7	Ribosome maturation factor RimM	2.46e-10	8.37e-29	5.86e-04	0.5858
1. PBF	Q03W51	Ribosome maturation factor RimM	3.90e-13	2.37e-35	7.15e-09	0.6782
1. PBF	Q9KA14	Ribosome maturation factor RimM	8.20e-09	3.55e-32	6.64e-05	0.5858
1. PBF	A4IM75	Ribosome maturation factor RimM	6.56e-11	3.08e-29	5.44e-04	0.588
1. PBF	B7HDW5	Ribosome maturation factor RimM	4.54e-11	6.53e-35	0.002	0.6066
1. PBF	Q833P4	Ribosome maturation factor RimM	1.78e-09	2.29e-37	0.018	0.5581
1. PBF	P66655	Ribosome maturation factor RimM	1.06e-10	2.08e-29	1.09e-05	0.5582
1. PBF	Q8EQZ8	Ribosome maturation factor RimM	2.34e-11	1.10e-36	1.38e-05	0.6083
1. PBF	B2G819	Ribosome maturation factor RimM	2.26e-11	5.14e-35	1.78e-08	0.5914
1. PBF	Q6ML96	Ribosome maturation factor RimM	8.03e-11	6.18e-35	0.010	0.5494
1. PBF	Q1MQV0	Ribosome maturation factor RimM	4.43e-09	7.10e-36	0.026	0.5056
1. PBF	Q5LYY1	Ribosome maturation factor RimM	7.84e-10	7.24e-37	0.019	0.6019
1. PBF	Q8DUN7	Ribosome maturation factor RimM	3.39e-10	6.98e-37	0.017	0.6114
1. PBF	C5D8U4	Ribosome maturation factor RimM	2.88e-11	6.19e-30	5.95e-07	0.5814
1. PBF	B2A2N9	Ribosome maturation factor RimM	9.09e-12	3.75e-31	0.011	0.6793
1. PBF	Q8F3L3	Ribosome maturation factor RimM	3.23e-11	3.42e-32	0.005	0.6425
1. PBF	A5VKN5	Ribosome maturation factor RimM	1.62e-11	5.14e-35	1.78e-08	0.6083
1. PBF	C1EP66	Ribosome maturation factor RimM	2.55e-11	2.00e-33	0.002	0.5959
1. PBF	Q049R7	Ribosome maturation factor RimM	5.96e-10	3.84e-36	5.76e-05	0.5304
1. PBF	B3WEU1	Ribosome maturation factor RimM	3.28e-09	8.55e-34	0.005	0.5008
1. PBF	A9NHF8	Ribosome maturation factor RimM	4.40e-10	1.69e-37	1.11e-04	0.4721
1. PBF	C3P5P3	Ribosome maturation factor RimM	3.21e-11	1.70e-33	0.002	0.5923
1. PBF	A6GWI5	Ribosome maturation factor RimM	8.74e-10	2.41e-28	3.91e-07	0.5088
1. PBF	Q8RGK8	Ribosome maturation factor RimM	1.06e-10	6.90e-35	4.36e-07	0.5671
1. PBF	Q2YXK2	Ribosome maturation factor RimM	1.11e-10	9.84e-30	9.32e-06	0.5502
1. PBF	Q636I4	Ribosome maturation factor RimM	2.92e-11	4.25e-33	0.007	0.5917
1. PBF	Q5HPV2	Ribosome maturation factor RimM	1.99e-10	3.19e-29	1.45e-08	0.6147
1. PBF	Q04FP6	Ribosome maturation factor RimM	6.26e-10	1.04e-38	3.86e-10	0.5477
1. PBF	B9EBB8	Ribosome maturation factor RimM	1.50e-09	4.73e-33	2.74e-05	0.4612
1. PBF	Q5HGJ3	Ribosome maturation factor RimM	1.11e-10	2.08e-29	1.09e-05	0.5617
1. PBF	A5ISC4	Ribosome maturation factor RimM	1.28e-10	2.08e-29	1.09e-05	0.5737
1. PBF	Q2FHJ9	Ribosome maturation factor RimM	1.11e-10	2.08e-29	1.09e-05	0.5659
1. PBF	B1HQI2	Ribosome maturation factor RimM	1.27e-09	1.10e-33	1.95e-05	0.5517
1. PBF	B1I2N0	Ribosome maturation factor RimM	4.07e-10	5.87e-33	0.002	0.6473
1. PBF	C3L785	Ribosome maturation factor RimM	2.47e-11	1.70e-33	0.002	0.6032
1. PBF	A7X1K9	Ribosome maturation factor RimM	1.36e-10	2.08e-29	1.09e-05	0.5863
1. PBF	Q18BB6	Ribosome maturation factor RimM	1.38e-11	1.14e-32	3.61e-08	0.6408
1. PBF	B5XKX3	Ribosome maturation factor RimM	1.32e-09	9.08e-37	0.032	0.5747
1. PBF	Q2S233	Ribosome maturation factor RimM	1.12e-09	3.58e-15	1.74e-08	0.4602
1. PBF	B9MQW9	Ribosome maturation factor RimM	5.36e-11	8.71e-36	0.005	0.6287
1. PBF	Q8Y0V9	Ribosome maturation factor RimM	7.61e-11	1.94e-19	1.06e-04	0.539
1. PBF	Q6HEX3	Ribosome maturation factor RimM	2.28e-11	2.00e-33	0.002	0.5669
1. PBF	Q6F0S4	Ribosome maturation factor RimM	0.00e+00	7.68e-42	4.18e-25	0.7757
1. PBF	Q65JP7	Ribosome maturation factor RimM	1.92e-10	5.68e-36	0.005	0.6155
1. PBF	Q1G9L3	Ribosome maturation factor RimM	7.09e-10	3.84e-36	5.76e-05	0.5615
1. PBF	B0S046	Ribosome maturation factor RimM	1.40e-10	4.91e-33	5.01e-04	0.6523
1. PBF	A9NBR0	Ribosome maturation factor RimM	8.51e-12	4.11e-29	9.11e-05	0.6544
1. PBF	Q3AC71	Ribosome maturation factor RimM	3.31e-11	8.05e-38	9.66e-07	0.5098
1. PBF	B7IUK1	Ribosome maturation factor RimM	2.04e-11	9.78e-35	0.002	0.6097
1. PBF	Q38XQ8	Ribosome maturation factor RimM	3.51e-10	8.10e-33	2.65e-04	0.6241
1. PBF	Q02Y16	Ribosome maturation factor RimM	1.17e-09	8.37e-40	2.18e-04	0.5572
1. PBF	B8CW20	Ribosome maturation factor RimM	8.22e-12	9.60e-31	0.003	0.6135
1. PBF	A9KLM3	Ribosome maturation factor RimM	1.35e-12	2.39e-29	1.22e-10	0.6198
1. PBF	Q044E4	Ribosome maturation factor RimM	9.36e-12	2.93e-38	5.70e-08	0.6169
1. PBF	A2RJS5	Ribosome maturation factor RimM	9.73e-10	2.69e-41	4.15e-04	0.5789
2. PF	Q1QT49	Ribosome maturation factor RimM	1.17e-09	1.50e-22	NA	0.5767
2. PF	Q7NRV6	Ribosome maturation factor RimM	2.33e-11	3.59e-25	NA	0.6247
2. PF	A4WDH3	Ribosome maturation factor RimM	8.34e-09	2.61e-25	NA	0.5375
2. PF	Q5SJH5	Ribosome maturation factor RimM	2.02e-08	2.88e-26	NA	0.5601
2. PF	A7NEB2	Ribosome maturation factor RimM	3.15e-08	3.03e-29	NA	0.5624
2. PF	B3DTN1	Ribosome maturation factor RimM	1.85e-07	7.42e-21	NA	0.421
2. PF	B4U396	Ribosome maturation factor RimM	2.15e-09	1.81e-38	NA	0.5705
2. PF	A2S4N9	Ribosome maturation factor RimM	2.41e-09	1.30e-04	NA	0.5409
2. PF	Q313J8	Ribosome maturation factor RimM	1.95e-09	2.96e-30	NA	0.5355
2. PF	Q3BVY9	Ribosome maturation factor RimM	1.33e-08	6.86e-18	NA	0.4605
2. PF	A5D1J5	Ribosome maturation factor RimM	9.55e-10	1.51e-28	NA	0.5858
2. PF	Q5H391	Ribosome maturation factor RimM	1.12e-08	4.39e-22	NA	0.4371
2. PF	A4QFB9	Ribosome maturation factor RimM	2.10e-09	1.69e-34	NA	0.4594
2. PF	A8L5A4	Ribosome maturation factor RimM	1.45e-07	9.88e-13	NA	0.5386
2. PF	Q8Y6A2	Ribosome maturation factor RimM	1.76e-11	1.02e-32	NA	0.6032
2. PF	Q7V4K0	Ribosome maturation factor RimM	1.01e-09	7.18e-38	NA	0.4956
2. PF	Q5QUU9	Ribosome maturation factor RimM	1.70e-09	1.30e-26	NA	0.5921
2. PF	A3N385	Ribosome maturation factor RimM	5.75e-10	1.05e-27	NA	0.6162
2. PF	A7ZQ48	Ribosome maturation factor RimM	1.41e-10	5.50e-22	NA	0.6325
2. PF	Q60BS2	Ribosome maturation factor RimM	1.33e-09	4.69e-24	NA	0.5222
2. PF	A6W1U1	Ribosome maturation factor RimM	1.06e-10	1.07e-26	NA	0.6333
2. PF	A0RPR7	Ribosome maturation factor RimM	6.05e-09	8.77e-27	NA	0.5075
2. PF	Q9K0K3	Ribosome maturation factor RimM	5.10e-11	3.44e-26	NA	0.5823
2. PF	B5XVK4	Ribosome maturation factor RimM	2.76e-10	4.49e-23	NA	0.6168
2. PF	Q68X25	Ribosome maturation factor RimM	2.12e-07	8.91e-27	NA	0.5305
2. PF	Q31HX9	Ribosome maturation factor RimM	1.57e-09	6.32e-31	NA	0.522
2. PF	Q8FP33	Ribosome maturation factor RimM	7.34e-10	8.07e-31	NA	0.5488
2. PF	A1VFE4	Ribosome maturation factor RimM	5.09e-10	7.39e-31	NA	0.5427
2. PF	Q92IE7	Ribosome maturation factor RimM	3.33e-07	4.47e-30	NA	0.5455
2. PF	Q04LC6	Ribosome maturation factor RimM	1.36e-09	4.06e-36	NA	0.5723
2. PF	Q0T176	Ribosome maturation factor RimM	2.96e-10	5.50e-22	NA	0.6309
2. PF	Q2RV58	Ribosome maturation factor RimM	3.95e-07	3.02e-06	NA	0.5235
2. PF	O25767	Ribosome maturation factor RimM	1.17e-08	5.68e-29	NA	0.5128
2. PF	Q895M3	Ribosome maturation factor RimM	6.90e-10	1.67e-30	NA	0.5817
2. PF	B1Y0H6	Ribosome maturation factor RimM	1.10e-07	1.11e-22	NA	0.5671
2. PF	A7HKS0	Ribosome maturation factor RimM	1.73e-10	1.61e-29	NA	0.5716
2. PF	B6YRA4	Ribosome maturation factor RimM	1.31e-09	1.22e-31	NA	0.533
2. PF	C6DCQ0	Ribosome maturation factor RimM	1.24e-07	9.65e-23	NA	0.6084
2. PF	A9F3N7	Ribosome maturation factor RimM	4.23e-11	7.32e-32	NA	0.5847
2. PF	A8H1E0	Ribosome maturation factor RimM	2.51e-11	9.22e-23	NA	0.6494
2. PF	Q6LMV8	Ribosome maturation factor RimM	1.14e-09	3.89e-24	NA	0.5354
2. PF	Q0SSB0	Ribosome maturation factor RimM	2.88e-10	8.40e-36	NA	0.5657
2. PF	A9L5P6	Ribosome maturation factor RimM	1.99e-08	5.12e-28	NA	0.5938
2. PF	A9B0N2	Ribosome maturation factor RimM	1.65e-10	7.21e-27	NA	0.5848
2. PF	O33016	Ribosome maturation factor RimM	5.09e-09	7.82e-27	NA	0.6162
2. PF	B1XKY8	Ribosome maturation factor RimM	2.22e-09	3.71e-34	NA	0.4618
2. PF	Q8KD89	Ribosome maturation factor RimM	6.20e-11	2.00e-33	NA	0.5388
2. PF	Q73VN8	Ribosome maturation factor RimM	4.82e-09	5.04e-31	NA	0.5735
2. PF	A2SES7	Ribosome maturation factor RimM	7.07e-09	9.30e-24	NA	0.5312
2. PF	Q7MUW2	Ribosome maturation factor RimM	1.54e-09	7.93e-31	NA	0.5399
2. PF	Q9ZDI0	Ribosome maturation factor RimM	2.19e-07	1.21e-29	NA	0.5652
2. PF	Q07Z06	Ribosome maturation factor RimM	5.85e-08	9.74e-29	NA	0.62
2. PF	Q5NIC5	Ribosome maturation factor RimM	2.40e-08	5.21e-29	NA	0.5468
2. PF	B0K9W5	Ribosome maturation factor RimM	1.22e-11	5.62e-32	NA	0.6318
2. PF	C3LS52	Ribosome maturation factor RimM	1.12e-09	3.30e-22	NA	0.5528
2. PF	Q14JS8	Ribosome maturation factor RimM	1.04e-07	5.21e-29	NA	0.5305
2. PF	C1CJM4	Ribosome maturation factor RimM	3.18e-10	4.06e-36	NA	0.5895
2. PF	P44568	Ribosome maturation factor RimM	2.28e-10	1.20e-26	NA	0.6288
2. PF	A9W0G2	Ribosome maturation factor RimM	2.62e-08	3.47e-09	NA	0.5384
2. PF	A1AN01	Ribosome maturation factor RimM	9.66e-11	1.37e-33	NA	0.5708
2. PF	Q47S65	Ribosome maturation factor RimM	1.57e-07	1.51e-30	NA	0.5644
2. PF	Q0BH68	Ribosome maturation factor RimM	3.50e-09	7.89e-07	NA	0.578
2. PF	A9IK36	Ribosome maturation factor RimM	1.08e-09	1.99e-25	NA	0.5224
2. PF	Q493M2	Ribosome maturation factor RimM	1.12e-10	1.26e-16	NA	0.604
2. PF	A5E909	Ribosome maturation factor RimM	8.06e-08	8.21e-06	NA	0.5654
2. PF	B5QUG3	Ribosome maturation factor RimM	6.29e-10	3.27e-24	NA	0.5999
2. PF	B6J8I9	Ribosome maturation factor RimM	1.49e-11	4.06e-27	NA	0.6516
2. PF	B2JF30	Ribosome maturation factor RimM	2.00e-09	9.62e-04	NA	0.5458
2. PF	B3CLX1	Ribosome maturation factor RimM	2.34e-10	8.60e-35	NA	0.6532
2. PF	A6WXG0	Ribosome maturation factor RimM	5.80e-08	1.10e-17	NA	0.5803
2. PF	Q65VG2	Ribosome maturation factor RimM	5.55e-09	4.48e-25	NA	0.5944
2. PF	A6W7U9	Ribosome maturation factor RimM	3.59e-08	3.48e-24	NA	0.4517
2. PF	Q4ZWY8	Ribosome maturation factor RimM	1.33e-10	1.53e-31	NA	0.6261
2. PF	A1SLS4	Ribosome maturation factor RimM	3.03e-08	1.08e-25	NA	0.5666
2. PF	A0L4Y7	Ribosome maturation factor RimM	2.45e-09	9.44e-25	NA	0.5214
2. PF	B3PDH6	Ribosome maturation factor RimM	2.38e-11	2.97e-27	NA	0.6457
2. PF	Q73PB6	Ribosome maturation factor RimM	6.92e-09	3.26e-25	NA	0.5088
2. PF	B2I6A7	Ribosome maturation factor RimM	2.08e-08	5.34e-22	NA	0.4483
2. PF	Q7V9R4	Ribosome maturation factor RimM	6.77e-10	1.62e-39	NA	0.5738
2. PF	Q2A1N4	Ribosome maturation factor RimM	5.45e-08	3.03e-29	NA	0.5614
2. PF	B3ERZ2	Ribosome maturation factor RimM	1.84e-12	1.52e-35	NA	0.5104
2. PF	C4LD26	Ribosome maturation factor RimM	9.02e-09	7.59e-26	NA	0.5894
2. PF	Q48LV9	Ribosome maturation factor RimM	4.92e-11	1.12e-31	NA	0.6479
2. PF	A5G7Z6	Ribosome maturation factor RimM	1.15e-10	2.43e-29	NA	0.5236
2. PF	A1WB51	Ribosome maturation factor RimM	1.09e-09	9.88e-22	NA	0.568
2. PF	A6UE44	Ribosome maturation factor RimM	1.42e-07	1.64e-21	NA	0.545
2. PF	O67156	Ribosome maturation factor RimM	8.41e-10	2.97e-32	NA	0.567
2. PF	Q4QNY7	Ribosome maturation factor RimM	5.78e-12	6.67e-26	NA	0.7353
2. PF	Q2RJV5	Ribosome maturation factor RimM	2.46e-09	4.19e-28	NA	0.5735
2. PF	C3MAG2	Ribosome maturation factor RimM	7.74e-08	6.61e-24	NA	0.5586
2. PF	Q13DU3	Ribosome maturation factor RimM	9.23e-08	1.22e-20	NA	0.6099
2. PF	Q0HGA9	Ribosome maturation factor RimM	8.09e-09	8.88e-24	NA	0.5914
2. PF	Q63S31	Ribosome maturation factor RimM	2.85e-09	9.63e-05	NA	0.5295
2. PF	Q74FG4	Ribosome maturation factor RimM	3.31e-11	2.66e-33	NA	0.6402
2. PF	A0KG24	Ribosome maturation factor RimM	1.40e-09	2.11e-26	NA	0.5456
2. PF	Q6G1R8	Ribosome maturation factor RimM	1.44e-08	1.02e-21	NA	0.4846
2. PF	A4VUJ6	Ribosome maturation factor RimM	3.80e-10	1.42e-36	NA	0.6077
2. PF	Q89X39	Ribosome maturation factor RimM	3.18e-08	2.69e-25	NA	0.5497
2. PF	A4TE78	Ribosome maturation factor RimM	1.13e-09	8.73e-30	NA	0.5909
2. PF	Q1J778	Ribosome maturation factor RimM	6.93e-10	2.82e-38	NA	0.5928
2. PF	Q02RL7	Ribosome maturation factor RimM	2.51e-12	9.97e-28	NA	0.6668
2. PF	Q32CY0	Ribosome maturation factor RimM	6.50e-10	1.64e-21	NA	0.6104
2. PF	P66651	Ribosome maturation factor RimM	1.44e-07	1.06e-18	NA	0.5879
2. PF	O83877	Ribosome maturation factor RimM	1.96e-09	6.56e-25	NA	0.5006
2. PF	P0A7X7	Ribosome maturation factor RimM	9.51e-10	5.50e-22	NA	0.608
2. PF	Q5P9G0	Ribosome maturation factor RimM	2.82e-08	4.47e-32	NA	0.5348
2. PF	B0TJ76	Ribosome maturation factor RimM	2.09e-11	4.49e-23	NA	0.6526
2. PF	A0LV71	Ribosome maturation factor RimM	4.50e-09	1.02e-26	NA	0.5436
2. PF	B1IAV2	Ribosome maturation factor RimM	1.07e-09	4.06e-36	NA	0.5777
2. PF	Q1BAK8	Ribosome maturation factor RimM	8.85e-10	2.39e-29	NA	0.5255
2. PF	Q87LS9	Ribosome maturation factor RimM	1.27e-09	9.74e-24	NA	0.5451
2. PF	A2CCX2	Ribosome maturation factor RimM	1.27e-09	1.74e-38	NA	0.4948
2. PF	A4J666	Ribosome maturation factor RimM	1.29e-11	9.68e-33	NA	0.6334
2. PF	B2TJ30	Ribosome maturation factor RimM	7.24e-11	3.39e-39	NA	0.6005
2. PF	Q8PBC2	Ribosome maturation factor RimM	5.24e-09	1.18e-24	NA	0.4655
2. PF	B1KI69	Ribosome maturation factor RimM	1.07e-10	1.27e-23	NA	0.6177
2. PF	Q31XD7	Ribosome maturation factor RimM	2.48e-07	1.64e-21	NA	0.6131
2. PF	A4FME9	Ribosome maturation factor RimM	6.16e-09	1.46e-32	NA	0.4346
2. PF	Q2LVU6	Ribosome maturation factor RimM	2.59e-11	1.56e-30	NA	0.6214
2. PF	Q2NVK3	Ribosome maturation factor RimM	4.36e-11	8.03e-23	NA	0.6676
2. PF	Q3B0H7	Ribosome maturation factor RimM	3.88e-09	9.83e-27	NA	0.5021
2. PF	A5IHJ6	Ribosome maturation factor RimM	5.94e-09	1.21e-29	NA	0.5948
2. PF	Q0RDP3	Ribosome maturation factor RimM	2.08e-08	4.54e-24	NA	0.5406
2. PF	B5Z227	Ribosome maturation factor RimM	2.41e-07	2.75e-22	NA	0.5842
2. PF	A0QV39	Ribosome maturation factor RimM	3.19e-09	3.73e-28	NA	0.5935
2. PF	B0K1U8	Ribosome maturation factor RimM	1.02e-11	5.62e-32	NA	0.622
2. PF	Q2JUD0	Ribosome maturation factor RimM	1.36e-11	1.78e-25	NA	0.6776
2. PF	B0U289	Ribosome maturation factor RimM	2.80e-08	9.90e-24	NA	0.4825
2. PF	Q46IK7	Ribosome maturation factor RimM	2.35e-09	3.02e-33	NA	0.5733
2. PF	B1ZL68	Ribosome maturation factor RimM	6.32e-08	5.03e-08	NA	0.5264
2. PF	Q2G8H3	Ribosome maturation factor RimM	3.46e-08	3.01e-23	NA	0.5233
2. PF	Q057I4	Ribosome maturation factor RimM	8.99e-10	4.46e-31	NA	0.6729
2. PF	Q3JQ07	Ribosome maturation factor RimM	2.49e-09	9.63e-05	NA	0.5463
2. PF	A5IM15	Ribosome maturation factor RimM	3.48e-11	4.12e-28	NA	0.6363
2. PF	A1VM98	Ribosome maturation factor RimM	2.15e-09	2.30e-17	NA	0.509
2. PF	B6IP93	Ribosome maturation factor RimM	9.82e-07	5.22e-07	NA	0.5912
2. PF	A3CNE7	Ribosome maturation factor RimM	4.24e-10	3.75e-33	NA	0.6204
2. PF	B2TYN0	Ribosome maturation factor RimM	5.16e-10	2.97e-21	NA	0.6139
2. PF	A4JCJ8	Ribosome maturation factor RimM	1.54e-09	1.07e-06	NA	0.5649
2. PF	B7KZ57	Ribosome maturation factor RimM	8.91e-08	3.54e-09	NA	0.5049
2. PF	A8GA19	Ribosome maturation factor RimM	9.05e-09	5.67e-22	NA	0.602
2. PF	B7LUW5	Ribosome maturation factor RimM	1.18e-08	2.97e-21	NA	0.6024
2. PF	B2GFY3	Ribosome maturation factor RimM	1.58e-07	1.59e-30	NA	0.421
2. PF	A0QJ46	Ribosome maturation factor RimM	4.82e-09	2.88e-31	NA	0.5459
2. PF	A5FKD8	Ribosome maturation factor RimM	5.67e-10	7.74e-30	NA	0.4977
2. PF	Q4FQ43	Ribosome maturation factor RimM	1.04e-08	2.41e-28	NA	0.5419
2. PF	B2HJL4	Ribosome maturation factor RimM	7.96e-10	4.63e-32	NA	0.5374
2. PF	A6VLP7	Ribosome maturation factor RimM	3.87e-10	3.92e-26	NA	0.6161
2. PF	Q3YQP4	Ribosome maturation factor RimM	8.82e-07	2.08e-32	NA	0.6043
2. PF	Q82U37	Ribosome maturation factor RimM	1.10e-09	3.51e-30	NA	0.5827
2. PF	B0RXD8	Ribosome maturation factor RimM	8.48e-09	1.18e-24	NA	0.4659
2. PF	Q024L7	Ribosome maturation factor RimM	1.81e-10	4.54e-31	NA	0.6141
2. PF	A6SVI5	Ribosome maturation factor RimM	1.79e-08	5.78e-25	NA	0.5605
2. PF	A5V9P8	Ribosome maturation factor RimM	4.46e-08	1.64e-24	NA	0.5988
2. PF	Q9PH38	Ribosome maturation factor RimM	1.51e-08	1.14e-22	NA	0.4658
2. PF	Q0TPP3	Ribosome maturation factor RimM	6.46e-10	2.15e-36	NA	0.5542
2. PF	Q3ASF6	Ribosome maturation factor RimM	5.33e-11	2.65e-35	NA	0.5264
2. PF	A0JXU0	Ribosome maturation factor RimM	5.32e-08	1.41e-04	NA	0.4369
2. PF	B2V7T6	Ribosome maturation factor RimM	1.46e-09	1.06e-33	NA	0.5817
2. PF	A2C552	Ribosome maturation factor RimM	3.26e-10	7.95e-34	NA	0.5547
2. PF	Q16AP0	Ribosome maturation factor RimM	1.77e-09	4.47e-30	NA	0.6138
2. PF	Q1JMB4	Ribosome maturation factor RimM	3.72e-10	1.26e-38	NA	0.6247
2. PF	B7MYA1	Ribosome maturation factor RimM	1.21e-08	5.50e-22	NA	0.6033
2. PF	Q98EE0	Ribosome maturation factor RimM	2.61e-07	4.00e-07	NA	0.5286
2. PF	Q4JV02	Ribosome maturation factor RimM	6.40e-09	5.34e-25	NA	0.4318
2. PF	A8YVT3	Ribosome maturation factor RimM	7.97e-09	3.62e-27	NA	0.5155
2. PF	B8ZRW7	Ribosome maturation factor RimM	5.15e-09	7.82e-27	NA	0.6233
2. PF	A1KMQ1	Ribosome maturation factor RimM	7.27e-09	2.90e-30	NA	0.5575
2. PF	Q3YYN0	Ribosome maturation factor RimM	1.40e-10	1.64e-21	NA	0.6282
2. PF	A9HS64	Ribosome maturation factor RimM	1.23e-06	1.50e-16	NA	0.5258
2. PF	Q11YV5	Ribosome maturation factor RimM	1.23e-10	2.84e-24	NA	0.518
2. PF	B1YV58	Ribosome maturation factor RimM	1.19e-09	1.73e-06	NA	0.57
2. PF	P0DF04	Ribosome maturation factor RimM	3.95e-11	2.82e-38	NA	0.5979
2. PF	Q5FGP6	Ribosome maturation factor RimM	3.08e-08	4.41e-33	NA	0.5867
2. PF	B0TX17	Ribosome maturation factor RimM	1.39e-07	4.09e-31	NA	0.5643
2. PF	A9BD47	Ribosome maturation factor RimM	1.20e-09	7.51e-28	NA	0.528
2. PF	Q1IYA4	Ribosome maturation factor RimM	1.37e-07	7.99e-21	NA	0.4915
2. PF	A4SEN9	Ribosome maturation factor RimM	1.30e-09	1.18e-32	NA	0.5858
2. PF	Q3IEC8	Ribosome maturation factor RimM	1.63e-09	3.33e-26	NA	0.5609
2. PF	Q46Y83	Ribosome maturation factor RimM	2.22e-09	5.35e-08	NA	0.5045
2. PF	Q21YL7	Ribosome maturation factor RimM	7.53e-10	6.90e-21	NA	0.5351
2. PF	Q15VI8	Ribosome maturation factor RimM	1.24e-08	4.17e-30	NA	0.511
2. PF	C1CDC6	Ribosome maturation factor RimM	4.66e-10	5.58e-36	NA	0.5745
2. PF	C0ZXR9	Ribosome maturation factor RimM	6.07e-09	1.85e-13	NA	0.5608
2. PF	Q5NNK9	Ribosome maturation factor RimM	4.39e-08	4.53e-26	NA	0.5155
2. PF	A3QBT7	Ribosome maturation factor RimM	1.83e-08	8.89e-22	NA	0.602
2. PF	Q4US83	Ribosome maturation factor RimM	8.13e-09	1.18e-24	NA	0.4478
2. PF	Q03FW4	Ribosome maturation factor RimM	7.36e-08	5.31e-31	NA	0.5865
2. PF	Q0BKD2	Ribosome maturation factor RimM	4.31e-08	3.03e-29	NA	0.5468
2. PF	A4SW74	Ribosome maturation factor RimM	7.69e-09	9.67e-27	NA	0.516
2. PF	A3D1W6	Ribosome maturation factor RimM	2.98e-09	5.12e-28	NA	0.5908
2. PF	Q8EH71	Ribosome maturation factor RimM	9.74e-09	1.41e-23	NA	0.5882
2. PF	A9KEE8	Ribosome maturation factor RimM	2.07e-11	2.86e-28	NA	0.645
2. PF	B7N6J4	Ribosome maturation factor RimM	1.14e-08	5.50e-22	NA	0.6074
2. PF	Q0SMF7	Ribosome maturation factor RimM	1.67e-09	3.91e-36	NA	0.4906
2. PF	A1AXN8	Ribosome maturation factor RimM	2.16e-07	9.74e-12	NA	0.6207
2. PF	A5FRP5	Ribosome maturation factor RimM	2.86e-10	2.11e-34	NA	0.6356
2. PF	B1VYW1	Ribosome maturation factor RimM	2.99e-08	9.78e-04	NA	0.5749
2. PF	Q71YM3	Ribosome maturation factor RimM	4.31e-13	8.70e-34	NA	0.6813
2. PF	A5UG05	Ribosome maturation factor RimM	3.97e-10	1.34e-28	NA	0.6279
2. PF	Q2JPG6	Ribosome maturation factor RimM	2.73e-09	1.29e-30	NA	0.5487
2. PF	A0KZM2	Ribosome maturation factor RimM	1.54e-08	1.46e-23	NA	0.5662
2. PF	Q5ZYH5	Ribosome maturation factor RimM	5.33e-09	3.17e-30	NA	0.5729
2. PF	B1LVU1	Ribosome maturation factor RimM	1.20e-07	5.59e-06	NA	0.4981
2. PF	B5BE93	Ribosome maturation factor RimM	1.19e-08	3.27e-24	NA	0.5985
2. PF	Q9A2B4	Ribosome maturation factor RimM	2.43e-07	1.05e-16	NA	0.5637
2. PF	A5UAV2	Ribosome maturation factor RimM	8.38e-11	1.34e-28	NA	0.6446
2. PF	Q2GES2	Ribosome maturation factor RimM	1.14e-09	1.65e-32	NA	0.582
2. PF	B9JCM0	Ribosome maturation factor RimM	9.53e-08	4.72e-17	NA	0.5684
2. PF	A1UEF4	Ribosome maturation factor RimM	1.45e-09	2.39e-29	NA	0.5731
2. PF	A9IZB5	Ribosome maturation factor RimM	1.07e-08	3.06e-23	NA	0.4779
2. PF	A8FLE1	Ribosome maturation factor RimM	5.57e-09	5.84e-22	NA	0.5199
2. PF	C5CEB5	Ribosome maturation factor RimM	2.42e-10	2.67e-18	NA	0.4854
2. PF	A6LNY7	Ribosome maturation factor RimM	8.99e-10	2.71e-24	NA	0.6039
2. PF	P0A2B6	Ribosome maturation factor RimM	2.90e-10	3.27e-24	NA	0.6099
2. PF	Q8DK05	Ribosome maturation factor RimM	3.34e-11	4.04e-29	NA	0.6619
2. PF	P0A7X9	Ribosome maturation factor RimM	2.86e-10	5.50e-22	NA	0.6307
2. PF	C3K1H0	Ribosome maturation factor RimM	8.48e-12	1.70e-31	NA	0.6578
2. PF	Q5XCQ4	Ribosome maturation factor RimM	5.50e-11	3.35e-38	NA	0.5872
2. PF	A6L0W6	Ribosome maturation factor RimM	1.96e-09	2.13e-30	NA	0.5088
2. PF	Q3ANC6	Ribosome maturation factor RimM	1.53e-09	7.02e-33	NA	0.4833
2. PF	B2S869	Ribosome maturation factor RimM	1.31e-07	1.06e-18	NA	0.5927
2. PF	Q7NKH3	Ribosome maturation factor RimM	3.64e-09	5.57e-28	NA	0.5882
2. PF	B6J1N3	Ribosome maturation factor RimM	1.06e-11	2.86e-28	NA	0.6487
2. PF	Q3ZZT5	Ribosome maturation factor RimM	4.83e-10	2.11e-34	NA	0.6257
2. PF	B0CIR9	Ribosome maturation factor RimM	1.38e-07	1.06e-18	NA	0.5859
2. PF	Q92AL5	Ribosome maturation factor RimM	1.42e-13	2.98e-34	NA	0.6781
2. PF	Q2J6Z8	Ribosome maturation factor RimM	1.25e-08	7.35e-30	NA	0.5318
2. PF	A4TQ63	Ribosome maturation factor RimM	6.72e-10	5.86e-26	NA	0.6268
2. PF	Q1MAK4	Ribosome maturation factor RimM	7.44e-08	1.73e-19	NA	0.5538
2. PF	Q2YLT0	Ribosome maturation factor RimM	1.37e-07	1.06e-18	NA	0.5817
2. PF	Q3Z8Z0	Ribosome maturation factor RimM	1.16e-10	1.74e-32	NA	0.6553
2. PF	A5VSP2	Ribosome maturation factor RimM	1.27e-07	1.06e-18	NA	0.593
2. PF	A2BYY9	Ribosome maturation factor RimM	1.52e-11	1.14e-32	NA	0.6338
2. PF	Q31KY0	Ribosome maturation factor RimM	7.32e-10	6.46e-26	NA	0.5233
2. PF	B4SPH2	Ribosome maturation factor RimM	1.23e-08	2.71e-24	NA	0.4616
2. PF	Q0AWV6	Ribosome maturation factor RimM	1.22e-11	5.33e-34	NA	0.6506
2. PF	Q3J8X9	Ribosome maturation factor RimM	1.25e-09	3.01e-22	NA	0.5246
2. PF	Q0VRF1	Ribosome maturation factor RimM	4.15e-09	9.42e-18	NA	0.5782
2. PF	A5GQ79	Ribosome maturation factor RimM	8.96e-10	1.34e-35	NA	0.491
2. PF	A4G2T6	Ribosome maturation factor RimM	2.23e-08	9.42e-29	NA	0.5553
2. PF	Q3ME71	Probable 16S rRNA-processing protein RimM	9.87e-09	5.16e-05	NA	0.5819
2. PF	Q1IMM5	Ribosome maturation factor RimM	6.26e-10	3.27e-15	NA	0.6685
2. PF	Q67PD9	Ribosome maturation factor RimM	3.78e-08	6.09e-30	NA	0.5918
2. PF	B2K5Y9	Ribosome maturation factor RimM	2.85e-11	1.78e-25	NA	0.7039
2. PF	Q1RIG5	Ribosome maturation factor RimM	6.51e-09	1.67e-31	NA	0.5935
2. PF	Q2GI96	Ribosome maturation factor RimM	6.40e-08	4.19e-28	NA	0.559
2. PF	A9WP46	Ribosome maturation factor RimM	1.64e-08	2.74e-26	NA	0.4249
2. PF	B8IGW5	Ribosome maturation factor RimM	1.05e-08	5.21e-15	NA	0.5158
2. PF	P59425	Ribosome maturation factor RimM	7.72e-11	2.30e-25	NA	0.6507
2. PF	Q1LQE1	Ribosome maturation factor RimM	2.86e-09	4.36e-08	NA	0.5539
2. PF	Q6F7I0	Ribosome maturation factor RimM	6.94e-09	6.53e-27	NA	0.6058
2. PF	Q8DC32	Ribosome maturation factor RimM	1.05e-09	2.28e-23	NA	0.5582
2. PF	A5CQR0	Ribosome maturation factor RimM	8.71e-08	4.46e-11	NA	0.6404
2. PF	A9ADT0	Ribosome maturation factor RimM	2.21e-09	1.36e-06	NA	0.5814
2. PF	Q8DQG3	Ribosome maturation factor RimM	4.80e-10	4.06e-36	NA	0.5936
2. PF	B1MDI4	Ribosome maturation factor RimM	1.18e-10	1.00e-32	NA	0.6394
2. PF	A3PXV8	Ribosome maturation factor RimM	1.41e-09	2.39e-29	NA	0.5711
2. PF	Q87F55	Ribosome maturation factor RimM	1.28e-07	5.34e-22	NA	0.463
2. PF	Q64PY7	Ribosome maturation factor RimM	2.10e-09	6.21e-22	NA	0.494
2. PF	Q97RM5	Ribosome maturation factor RimM	2.41e-10	3.25e-36	NA	0.5764
2. PF	Q5L9P4	Ribosome maturation factor RimM	5.07e-09	6.21e-22	NA	0.5029
2. PF	A4SIV8	Ribosome maturation factor RimM	1.18e-09	2.01e-26	NA	0.5604
2. PF	Q1I5Y9	Ribosome maturation factor RimM	7.30e-11	1.60e-26	NA	0.5846
2. PF	B1JXU4	Ribosome maturation factor RimM	2.27e-09	1.73e-07	NA	0.5903
2. PF	B0KRI2	Ribosome maturation factor RimM	1.15e-10	1.93e-27	NA	0.5832
2. PF	A7ZDX8	Ribosome maturation factor RimM	4.50e-09	4.24e-30	NA	0.5269
2. PF	A9BNS8	Ribosome maturation factor RimM	1.21e-09	1.03e-18	NA	0.5104
2. PF	Q83E84	Ribosome maturation factor RimM	6.64e-12	2.86e-28	NA	0.6503
2. PF	A1WPU0	Ribosome maturation factor RimM	6.80e-10	5.81e-18	NA	0.541
2. PF	Q6FYH3	Ribosome maturation factor RimM	1.04e-07	3.25e-09	NA	0.509
2. PF	A9MZ50	Ribosome maturation factor RimM	4.05e-10	3.27e-24	NA	0.6096
2. PF	Q8A682	Ribosome maturation factor RimM	5.42e-09	3.78e-34	NA	0.4956
2. PF	Q1GYT7	Ribosome maturation factor RimM	8.25e-09	1.42e-24	NA	0.5697
2. PF	A7H4B3	Ribosome maturation factor RimM	6.83e-09	3.35e-21	NA	0.4995
2. PF	Q7UZQ3	Ribosome maturation factor RimM	2.21e-10	1.31e-30	NA	0.6015
2. PF	O31740	Ribosome maturation factor RimM	1.31e-10	1.23e-33	NA	0.6229
2. PF	Q12KJ4	Ribosome maturation factor RimM	1.80e-08	6.02e-27	NA	0.617
2. PF	B7K5W1	Ribosome maturation factor RimM	2.08e-09	7.09e-27	NA	0.5724
2. PF	B3EJ24	Ribosome maturation factor RimM	1.20e-10	2.03e-33	NA	0.516
2. PF	A9BF00	Ribosome maturation factor RimM	5.91e-11	1.07e-26	NA	0.5504
2. PF	Q24UA8	Ribosome maturation factor RimM	1.28e-11	3.88e-31	NA	0.6194
2. PF	Q0IDP0	Ribosome maturation factor RimM	1.59e-09	1.23e-24	NA	0.5917
2. PF	B3PR17	Ribosome maturation factor RimM	1.02e-07	3.70e-20	NA	0.5461
2. PF	Q1LTR0	Ribosome maturation factor RimM	1.15e-11	2.72e-28	NA	0.7006
2. PF	Q8PMY2	Ribosome maturation factor RimM	1.02e-08	1.57e-22	NA	0.4604
2. PF	Q1R8B7	Ribosome maturation factor RimM	7.57e-10	5.50e-22	NA	0.6069
2. PF	B9K8P4	Ribosome maturation factor RimM	1.21e-11	2.33e-26	NA	0.6567
2. PF	Q0TEN1	Ribosome maturation factor RimM	3.64e-10	5.50e-22	NA	0.6309
2. PF	A1KSK0	Ribosome maturation factor RimM	4.57e-11	2.45e-26	NA	0.5807
2. PF	Q0AIV0	Ribosome maturation factor RimM	1.81e-10	3.24e-29	NA	0.5131
2. PF	A0Q860	Ribosome maturation factor RimM	4.37e-08	2.78e-29	NA	0.5598
2. PF	Q0I1J9	Ribosome maturation factor RimM	4.73e-09	5.96e-25	NA	0.594
2. PF	P9WH18	Ribosome maturation factor RimM	9.98e-09	2.90e-30	NA	0.5541
2. PF	A1JK24	Ribosome maturation factor RimM	3.07e-10	6.56e-25	NA	0.6612
2. PF	C1F3B3	Ribosome maturation factor RimM	7.99e-10	4.85e-05	NA	0.594
2. PF	Q6ND66	Ribosome maturation factor RimM	1.32e-07	3.06e-19	NA	0.5525
2. PF	Q5N0Z1	Ribosome maturation factor RimM	6.53e-10	6.46e-26	NA	0.5457
2. PF	Q0HSK2	Ribosome maturation factor RimM	9.56e-09	8.88e-24	NA	0.5962
2. PF	Q2SL57	Ribosome maturation factor RimM	5.87e-11	2.97e-27	NA	0.6051
2. PF	Q62M51	Ribosome maturation factor RimM	2.47e-09	1.02e-04	NA	0.5406
2. PF	A5GI62	Ribosome maturation factor RimM	5.06e-10	2.66e-33	NA	0.5376
2. PF	Q8G7F9	Ribosome maturation factor RimM	2.25e-07	2.97e-19	NA	0.42
2. PF	B5E3G0	Ribosome maturation factor RimM	1.08e-09	4.06e-36	NA	0.5843
2. PF	A2BTI7	Ribosome maturation factor RimM	8.78e-10	1.85e-36	NA	0.4656
2. PF	A4Y4L4	Ribosome maturation factor RimM	1.56e-08	6.53e-27	NA	0.5936
2. PF	A1SZY7	Ribosome maturation factor RimM	2.70e-09	1.54e-25	NA	0.5444
2. PF	P74035	Ribosome maturation factor RimM	1.32e-09	8.25e-33	NA	0.5184
2. PF	Q39ID5	Ribosome maturation factor RimM	1.26e-09	2.68e-07	NA	0.5503
2. PF	Q07UU6	Ribosome maturation factor RimM	8.05e-08	1.61e-19	NA	0.5769
2. PF	Q66E58	Ribosome maturation factor RimM	9.68e-11	1.78e-25	NA	0.678
2. PF	C0R4Z3	Ribosome maturation factor RimM	1.99e-08	1.47e-33	NA	0.601
2. PF	Q1C410	Ribosome maturation factor RimM	2.07e-11	7.84e-26	NA	0.7029
2. PF	A0Q0Y1	Ribosome maturation factor RimM	3.76e-09	5.78e-37	NA	0.5819
2. PF	B9DRW5	Ribosome maturation factor RimM	2.15e-09	1.34e-33	NA	0.5495
2. PF	C1KW92	Ribosome maturation factor RimM	2.98e-10	1.89e-34	NA	0.5887
2. PF	B0CFM3	Ribosome maturation factor RimM	4.72e-10	3.89e-24	NA	0.5293
2. PF	Q1GPJ1	Ribosome maturation factor RimM	5.09e-10	3.42e-25	NA	0.5694
2. PF	Q660H4	Ribosome maturation factor RimM	1.46e-09	1.85e-34	NA	0.4998
2. PF	B0TH66	Ribosome maturation factor RimM	1.55e-08	2.48e-33	NA	0.5444
2. PF	A9VT80	Ribosome maturation factor RimM	5.66e-11	6.90e-35	NA	0.5902
2. PF	B1IVM5	Ribosome maturation factor RimM	1.74e-10	5.50e-22	NA	0.6236
2. PF	Q5PFF7	Ribosome maturation factor RimM	6.45e-10	3.27e-24	NA	0.592
2. PF	A9M8Q1	Ribosome maturation factor RimM	1.45e-07	1.06e-18	NA	0.5897
2. PF	A1AED9	Ribosome maturation factor RimM	6.53e-10	5.50e-22	NA	0.6214
2. PF	A7FLQ6	Ribosome maturation factor RimM	1.04e-10	1.78e-25	NA	0.6689
2. PF	Q2N9Q5	Ribosome maturation factor RimM	6.51e-08	5.51e-25	NA	0.5352
2. PF	Q12CW5	Ribosome maturation factor RimM	1.53e-09	6.53e-17	NA	0.5477
2. PF	Q7VXD7	Ribosome maturation factor RimM	1.60e-09	1.41e-21	NA	0.524
2. PF	Q2IJ53	Ribosome maturation factor RimM	3.71e-10	8.86e-25	NA	0.4878
2. PF	Q17WC1	Ribosome maturation factor RimM	1.37e-08	1.44e-25	NA	0.4982
2. PF	Q0S2C6	Ribosome maturation factor RimM	7.41e-09	1.37e-21	NA	0.5761
2. PF	Q6AEA0	Ribosome maturation factor RimM	1.03e-07	1.33e-14	NA	0.5381
2. PF	B1VG72	Ribosome maturation factor RimM	1.16e-08	1.50e-19	NA	0.4804
2. PF	A1T754	Ribosome maturation factor RimM	8.05e-10	1.51e-30	NA	0.5899
2. PF	Q5WFN5	Ribosome maturation factor RimM	3.11e-10	5.89e-37	NA	0.6125
2. PF	A1TND1	Ribosome maturation factor RimM	9.48e-10	1.24e-19	NA	0.5506
2. PF	B8DDW0	Ribosome maturation factor RimM	1.50e-11	3.04e-34	NA	0.6001
2. PF	A0M5T0	Ribosome maturation factor RimM	2.77e-10	4.34e-28	NA	0.5126
2. PF	A6TCL6	Ribosome maturation factor RimM	8.59e-10	7.54e-22	NA	0.6276
2. PF	C4ZYM6	Ribosome maturation factor RimM	5.91e-10	5.50e-22	NA	0.6127
2. PF	Q7W6N7	Ribosome maturation factor RimM	1.41e-09	2.51e-22	NA	0.5201
2. PF	A8ANE1	Ribosome maturation factor RimM	8.11e-09	3.59e-24	NA	0.5861
2. PF	A3PF96	Ribosome maturation factor RimM	1.47e-11	3.54e-37	NA	0.684
2. PF	Q48U56	Ribosome maturation factor RimM	2.08e-09	7.18e-38	NA	0.5369
2. PF	Q47WU9	Ribosome maturation factor RimM	1.04e-11	5.92e-27	NA	0.671
2. PF	Q4UM17	Ribosome maturation factor RimM	2.08e-07	5.77e-29	NA	0.5539
2. PF	A1U2Y8	Ribosome maturation factor RimM	6.94e-10	2.92e-25	NA	0.5775
2. PF	B7IEQ6	Ribosome maturation factor RimM	3.24e-10	1.14e-26	NA	0.5803
2. PF	A5W8C2	Ribosome maturation factor RimM	1.54e-10	4.21e-25	NA	0.5776
2. PF	C1C6B9	Ribosome maturation factor RimM	1.31e-09	4.06e-36	NA	0.5734
2. PF	P57935	Ribosome maturation factor RimM	6.42e-11	1.34e-27	NA	0.6422
2. PF	B0UCL3	Ribosome maturation factor RimM	4.31e-08	1.10e-11	NA	0.5443
2. PF	Q7U9V4	Ribosome maturation factor RimM	7.28e-10	4.97e-32	NA	0.5492
2. PF	A4IWA6	Ribosome maturation factor RimM	6.73e-08	4.41e-28	NA	0.5883
2. PF	C0MEI2	Ribosome maturation factor RimM	1.63e-09	4.19e-39	NA	0.5878
2. PF	A8IKV0	Ribosome maturation factor RimM	2.07e-09	1.54e-20	NA	0.5847
2. PF	Q5FJK6	Ribosome maturation factor RimM	9.41e-09	2.11e-28	NA	0.5341
2. PF	B7UH57	Ribosome maturation factor RimM	7.88e-10	5.50e-22	NA	0.6148
2. PF	Q57L30	Ribosome maturation factor RimM	1.51e-08	2.33e-25	NA	0.5958
2. PF	Q10VX5	Ribosome maturation factor RimM	1.08e-08	3.28e-12	NA	0.606
2. PF	A7IIB1	Ribosome maturation factor RimM	2.70e-07	1.19e-18	NA	0.5933
2. PF	B3E5S5	Ribosome maturation factor RimM	8.69e-11	6.75e-27	NA	0.506
2. PF	A0ZZV5	Ribosome maturation factor RimM	7.64e-08	1.36e-26	NA	0.6252
2. PF	P58183	Ribosome maturation factor RimM	1.62e-09	4.54e-38	NA	0.5847
2. PF	B2SJV2	Ribosome maturation factor RimM	1.42e-08	4.39e-22	NA	0.4304
2. PF	Q92L42	Ribosome maturation factor RimM	5.68e-08	5.18e-22	NA	0.5442
2. PF	A1RMB7	Ribosome maturation factor RimM	8.16e-09	6.53e-27	NA	0.5773
2. PF	B7LDJ7	Ribosome maturation factor RimM	1.28e-10	5.50e-22	NA	0.6314
2. PF	B4S7L8	Ribosome maturation factor RimM	1.58e-10	1.51e-30	NA	0.5849
2. PF	Q04SW3	Ribosome maturation factor RimM	7.40e-09	3.01e-36	NA	0.6074
2. PF	B3CTT8	Ribosome maturation factor RimM	9.59e-08	1.12e-31	NA	0.5437
2. PF	A5WBW9	Ribosome maturation factor RimM	3.15e-07	5.88e-30	NA	0.612
2. PF	A5CF62	Ribosome maturation factor RimM	4.95e-10	1.56e-31	NA	0.5822
2. PF	A8EZ93	Ribosome maturation factor RimM	2.81e-07	1.13e-28	NA	0.5865
2. PF	Q050Y7	Ribosome maturation factor RimM	5.00e-09	3.01e-36	NA	0.5729
2. PF	A8GRQ6	Ribosome maturation factor RimM	2.76e-07	6.41e-30	NA	0.5475
2. PF	B7UYK7	Ribosome maturation factor RimM	2.36e-12	9.97e-28	NA	0.6944
2. PF	A9MGT6	Ribosome maturation factor RimM	1.40e-08	1.16e-26	NA	0.5833
2. PF	P66652	Ribosome maturation factor RimM	1.24e-07	1.06e-18	NA	0.6022
2. PF	O51640	Ribosome maturation factor RimM	2.60e-09	3.16e-37	NA	0.4834
2. PF	B2FUB4	Ribosome maturation factor RimM	1.27e-08	1.02e-26	NA	0.4325
2. PF	Q47BI6	Ribosome maturation factor RimM	1.21e-09	1.76e-30	NA	0.4858
2. PF	B1XBT0	Ribosome maturation factor RimM	8.29e-10	5.50e-22	NA	0.6179
2. PF	B1WZK0	Ribosome maturation factor RimM	6.06e-09	1.56e-27	NA	0.4616
2. PF	Q8ZBU8	Ribosome maturation factor RimM	1.13e-10	7.84e-26	NA	0.6591
2. PF	B8I7T4	Ribosome maturation factor RimM	4.56e-12	1.23e-36	NA	0.6265
2. PF	Q5X7Z0	Ribosome maturation factor RimM	6.88e-09	1.21e-29	NA	0.5757
2. PF	B8ZND1	Ribosome maturation factor RimM	1.73e-07	4.06e-36	NA	0.5822
2. PF	A4YK99	Ribosome maturation factor RimM	1.18e-07	4.29e-06	NA	0.5781
2. PF	Q3SGC3	Ribosome maturation factor RimM	7.30e-09	6.90e-11	NA	0.5471
2. PF	P66654	Ribosome maturation factor RimM	6.10e-09	2.90e-30	NA	0.5566
2. PF	C0M749	Ribosome maturation factor RimM	1.86e-09	2.24e-38	NA	0.6504
2. PF	Q7MHT2	Ribosome maturation factor RimM	2.14e-08	2.28e-23	NA	0.5866
2. PF	A9WEK5	Ribosome maturation factor RimM	1.92e-11	7.56e-29	NA	0.6047
2. PF	B1JDE4	Ribosome maturation factor RimM	2.14e-10	7.47e-26	NA	0.6244
2. PF	A8AXT7	Ribosome maturation factor RimM	1.96e-09	6.39e-34	NA	0.5811
2. PF	Q318D6	Ribosome maturation factor RimM	8.66e-09	7.70e-35	NA	0.4715
2. PF	B7MIU6	Ribosome maturation factor RimM	1.29e-08	5.50e-22	NA	0.6024
2. PF	B7NSA7	Ribosome maturation factor RimM	1.68e-10	5.50e-22	NA	0.648
2. PF	B5RD84	Ribosome maturation factor RimM	1.15e-10	4.76e-24	NA	0.6439
2. PF	Q1QHI8	Ribosome maturation factor RimM	4.72e-08	1.93e-21	NA	0.5377
2. PF	B3GZ39	Ribosome maturation factor RimM	3.20e-11	1.05e-27	NA	0.6634
2. PF	P0DF05	Ribosome maturation factor RimM	4.62e-10	2.82e-38	NA	0.6057
2. PF	A7Z4M2	Ribosome maturation factor RimM	4.97e-08	4.63e-32	NA	0.6002
2. PF	A8G7B1	Ribosome maturation factor RimM	1.27e-08	9.43e-37	NA	0.4629
2. PF	B0BX63	Ribosome maturation factor RimM	2.72e-07	2.90e-30	NA	0.545
2. PF	Q0AA98	Ribosome maturation factor RimM	3.45e-10	1.67e-29	NA	0.5554
2. PF	Q5H9Z8	Ribosome maturation factor RimM	2.33e-09	4.41e-33	NA	0.6197
2. PF	B2SFE3	Ribosome maturation factor RimM	4.24e-08	3.99e-27	NA	0.5547
2. PF	Q7WHM0	Ribosome maturation factor RimM	1.88e-09	2.51e-22	NA	0.5202
2. PF	B9M593	Ribosome maturation factor RimM	7.33e-11	1.29e-29	NA	0.5579
2. PF	A8F1B9	Ribosome maturation factor RimM	2.29e-07	1.04e-28	NA	0.5391
2. PF	Q2J398	Ribosome maturation factor RimM	1.69e-07	3.20e-20	NA	0.5419
2. PF	Q72JU7	Ribosome maturation factor RimM	2.59e-08	2.45e-26	NA	0.5322
2. PF	Q1CLJ4	Ribosome maturation factor RimM	1.47e-11	7.84e-26	NA	0.7233
2. PF	P0A4D3	Ribosome maturation factor RimM	2.01e-08	9.07e-09	NA	0.57
2. PF	B2INF5	Ribosome maturation factor RimM	4.91e-10	4.06e-36	NA	0.5489
2. PF	A3NC06	Ribosome maturation factor RimM	2.39e-09	1.49e-04	NA	0.5383
2. PF	B7VK28	Ribosome maturation factor RimM	3.14e-09	2.96e-25	NA	0.5515
2. PF	A5F9A8	Ribosome maturation factor RimM	1.83e-09	3.30e-22	NA	0.5529
2. PF	A5U6R2	Ribosome maturation factor RimM	1.11e-08	2.90e-30	NA	0.5637
2. PF	A8A3B5	Ribosome maturation factor RimM	5.73e-10	5.50e-22	NA	0.6222
2. PF	Q8UBZ8	Ribosome maturation factor RimM	4.22e-08	3.29e-20	NA	0.5782
2. PF	B7M977	Ribosome maturation factor RimM	8.34e-10	5.50e-22	NA	0.6173
2. PF	A7FW10	Ribosome maturation factor RimM	3.55e-09	1.21e-38	NA	0.5443
2. PF	A0AJP8	Ribosome maturation factor RimM	6.61e-13	5.98e-33	NA	0.6434
2. PF	Q4KHQ7	Ribosome maturation factor RimM	9.21e-13	8.35e-31	NA	0.7337
2. PF	P0A7X8	Ribosome maturation factor RimM	2.95e-10	5.50e-22	NA	0.6261
2. PF	P0A4D4	Ribosome maturation factor RimM	8.88e-08	9.07e-09	NA	0.6016
2. PF	B8F7X4	Ribosome maturation factor RimM	3.09e-10	7.47e-26	NA	0.6164
2. PF	A3MHR8	Ribosome maturation factor RimM	2.32e-09	1.02e-04	NA	0.5432
2. PF	A1VZ67	Ribosome maturation factor RimM	6.53e-09	5.84e-22	NA	0.5402
2. PF	A7NJT6	Ribosome maturation factor RimM	6.22e-11	7.82e-27	NA	0.5202
2. PF	Q39RN7	Ribosome maturation factor RimM	2.32e-10	3.57e-30	NA	0.588
2. PF	Q03RU6	Ribosome maturation factor RimM	5.16e-11	4.28e-35	NA	0.5274
2. PF	Q5GTF3	Ribosome maturation factor RimM	5.36e-09	3.99e-36	NA	0.621
2. PF	A0PQ65	Ribosome maturation factor RimM	1.32e-09	4.16e-32	NA	0.5387
2. PF	C1B2R9	Ribosome maturation factor RimM	5.33e-09	1.35e-25	NA	0.5826
2. PF	Q8XJP6	Ribosome maturation factor RimM	4.51e-10	2.15e-36	NA	0.5607
2. PF	A6V124	Ribosome maturation factor RimM	1.26e-11	3.70e-30	NA	0.6556
2. PF	A1V6J3	Ribosome maturation factor RimM	2.94e-09	1.02e-04	NA	0.5419
2. PF	Q3A2E6	Ribosome maturation factor RimM	1.05e-10	2.90e-30	NA	0.6256
2. PF	B1LPB5	Ribosome maturation factor RimM	1.38e-08	2.75e-22	NA	0.6043
2. PF	B0REN0	Ribosome maturation factor RimM	9.16e-08	4.42e-12	NA	0.5956
2. PF	Q3KHJ3	Ribosome maturation factor RimM	1.43e-10	2.97e-26	NA	0.6335
2. PF	Q2KY81	Ribosome maturation factor RimM	1.97e-09	5.32e-26	NA	0.5419
2. PF	Q9X1Q4	Ribosome maturation factor RimM	2.38e-11	4.12e-28	NA	0.659
2. PF	Q2SY00	Ribosome maturation factor RimM	2.35e-09	1.91e-04	NA	0.5286
2. PF	A5USU0	Ribosome maturation factor RimM	7.19e-11	8.03e-23	NA	0.527
2. PF	Q21CT8	Ribosome maturation factor RimM	2.62e-08	1.14e-20	NA	0.5786
2. PF	P57475	Ribosome maturation factor RimM	3.18e-11	3.45e-22	NA	0.6191
2. PF	A1BGL8	Ribosome maturation factor RimM	7.61e-11	2.66e-37	NA	0.4782
2. PF	Q6A7S6	Ribosome maturation factor RimM	2.90e-08	6.47e-28	NA	0.5795
2. PF	A9R0U4	Ribosome maturation factor RimM	1.01e-10	7.84e-26	NA	0.6583
2. PF	A1R7G4	Ribosome maturation factor RimM	2.90e-08	2.46e-15	NA	0.5268
2. PF	B3R397	Ribosome maturation factor RimM	7.55e-10	6.44e-14	NA	0.5326
2. PF	Q0KD80	Ribosome maturation factor RimM	2.35e-09	1.16e-06	NA	0.544
2. PF	A8FSE8	Ribosome maturation factor RimM	1.14e-08	1.31e-22	NA	0.5982
2. PF	A7MYV0	Ribosome maturation factor RimM	1.74e-09	1.61e-24	NA	0.5684
2. PF	A6WKR7	Ribosome maturation factor RimM	8.71e-09	5.12e-28	NA	0.5834
2. PF	Q88MV5	Ribosome maturation factor RimM	2.32e-10	7.71e-26	NA	0.6105
2. PF	Q9PPJ5	Ribosome maturation factor RimM	4.90e-09	2.49e-21	NA	0.5276
2. PF	A4XXT6	Ribosome maturation factor RimM	4.66e-10	1.32e-26	NA	0.6329
2. PF	A7HBQ0	Ribosome maturation factor RimM	1.36e-09	1.75e-27	NA	0.5919
2. PF	Q3B4A2	Ribosome maturation factor RimM	3.70e-10	2.35e-34	NA	0.5822
2. PF	A4X4H7	Ribosome maturation factor RimM	1.42e-09	1.41e-27	NA	0.5779
2. PF	Q3SNV7	Ribosome maturation factor RimM	1.08e-07	3.15e-20	NA	0.5547
2. PF	C1CSA7	Ribosome maturation factor RimM	1.08e-09	4.06e-36	NA	0.5719
2. PF	C1AG22	Ribosome maturation factor RimM	6.45e-09	2.90e-30	NA	0.5548
2. PF	Q72DU2	Ribosome maturation factor RimM	8.42e-10	7.39e-31	NA	0.539
2. PF	A8GN44	Ribosome maturation factor RimM	2.83e-07	4.68e-26	NA	0.5343
2. PF	Q8R9X3	Ribosome maturation factor RimM	7.88e-13	4.80e-36	NA	0.7019
2. PF	B1XVN2	Ribosome maturation factor RimM	1.67e-09	2.67e-24	NA	0.5182
2. PF	Q1AW75	Ribosome maturation factor RimM	2.01e-08	3.53e-29	NA	0.498
2. PF	Q5YS37	Ribosome maturation factor RimM	2.72e-09	2.22e-28	NA	0.5862
2. PF	Q2P652	Ribosome maturation factor RimM	1.30e-08	4.39e-22	NA	0.454
2. PF	P0A2B5	Ribosome maturation factor RimM	1.37e-08	3.27e-24	NA	0.5995
2. PF	Q7VQF9	Ribosome maturation factor RimM	7.91e-09	4.53e-22	NA	0.5634
2. PF	Q5WZE1	Ribosome maturation factor RimM	7.80e-09	1.21e-29	NA	0.5867
2. PF	B2J3X9	Ribosome maturation factor RimM	4.24e-08	3.57e-05	NA	0.5916
2. PF	A6L991	Ribosome maturation factor RimM	2.46e-09	4.14e-34	NA	0.5013
2. PF	Q57AY3	Ribosome maturation factor RimM	1.44e-07	1.06e-18	NA	0.5949
2. PF	A0K5P6	Ribosome maturation factor RimM	1.01e-09	1.34e-07	NA	0.5436
2. PF	A7GZB2	Ribosome maturation factor RimM	5.88e-09	5.64e-27	NA	0.5114
2. PF	Q5HV69	Ribosome maturation factor RimM	6.36e-09	1.90e-20	NA	0.5399
2. PF	B5ZTH9	Ribosome maturation factor RimM	8.31e-08	1.92e-20	NA	0.5476
2. PF	Q2K381	Ribosome maturation factor RimM	5.61e-08	5.06e-21	NA	0.5561
2. PF	Q6D1T9	Ribosome maturation factor RimM	1.54e-07	1.39e-23	NA	0.6188
2. PF	B6I630	Ribosome maturation factor RimM	7.63e-08	5.50e-22	NA	0.6093
2. PF	A5I4M4	Ribosome maturation factor RimM	3.23e-09	2.49e-39	NA	0.5504
2. PF	Q2YBJ3	Ribosome maturation factor RimM	2.14e-10	4.32e-26	NA	0.5235
2. PF	B3Q855	Ribosome maturation factor RimM	1.02e-07	2.11e-18	NA	0.5639
2. PF	B1JJ90	Ribosome maturation factor RimM	8.83e-11	7.84e-26	NA	0.6627
2. PF	Q0BRH0	Ribosome maturation factor RimM	2.16e-07	4.31e-14	NA	0.5147
2. PF	Q7VKG1	Ribosome maturation factor RimM	4.98e-08	1.50e-26	NA	0.6043
2. PF	Q8NNX5	Ribosome maturation factor RimM	1.77e-09	4.53e-34	NA	0.4612
2. PF	B0UVM7	Ribosome maturation factor RimM	3.44e-11	4.78e-25	NA	0.6588
2. PF	Q1D6I3	Ribosome maturation factor RimM	6.76e-09	7.51e-20	NA	0.5322
2. PF	B8CQI3	Ribosome maturation factor RimM	9.72e-11	3.45e-22	NA	0.6378
2. PF	B8EBP2	Ribosome maturation factor RimM	1.64e-08	5.12e-28	NA	0.6082
2. PF	Q9HXQ0	Ribosome maturation factor RimM	8.67e-10	2.12e-29	NA	0.5874
2. PF	Q886V1	Ribosome maturation factor RimM	4.77e-12	2.74e-31	NA	0.6821
2. PF	B0JU07	Ribosome maturation factor RimM	5.42e-10	7.00e-26	NA	0.5295
2. PF	Q9JVK9	Ribosome maturation factor RimM	5.16e-11	6.16e-26	NA	0.5846
2. PF	Q73FP4	Ribosome maturation factor RimM	1.97e-09	1.47e-33	NA	0.6148
2. PF	Q1JHF7	Ribosome maturation factor RimM	3.96e-11	3.75e-38	NA	0.6518
2. PF	A4VIT6	Ribosome maturation factor RimM	1.36e-09	5.40e-30	NA	0.6401
2. PF	Q82JW2	Ribosome maturation factor RimM	2.28e-08	2.08e-11	NA	0.5461
2. PF	Q7N799	Ribosome maturation factor RimM	1.93e-08	1.18e-22	NA	0.613
2. PF	Q9KUF9	Ribosome maturation factor RimM	1.45e-08	7.33e-25	NA	0.5919
2. PF	C1DDY6	Ribosome maturation factor RimM	5.28e-11	6.99e-25	NA	0.6303
2. PF	A3NXU2	Ribosome maturation factor RimM	3.10e-09	9.97e-05	NA	0.5373
2. PF	Q11CR1	Ribosome maturation factor RimM	2.15e-07	7.51e-08	NA	0.4996
2. PF	Q9RSW1	Ribosome maturation factor RimM	1.31e-07	1.07e-22	NA	0.4646
2. PF	Q1BY03	Ribosome maturation factor RimM	9.98e-10	9.12e-08	NA	0.5263
2. PF	Q2VZV7	Ribosome maturation factor RimM	5.91e-09	8.86e-25	NA	0.5782
2. PF	A9M2D2	Ribosome maturation factor RimM	5.97e-11	7.21e-27	NA	0.5824
2. PF	Q8P1F4	Ribosome maturation factor RimM	1.62e-09	4.37e-38	NA	0.5523
2. PF	A8F3G2	Ribosome maturation factor RimM	9.18e-11	7.66e-31	NA	0.5317
2. PF	A1UR20	Ribosome maturation factor RimM	8.25e-10	8.31e-20	NA	0.6151
2. PF	A8M679	Ribosome maturation factor RimM	1.28e-09	4.55e-27	NA	0.6059
2. PF	A7GG34	Ribosome maturation factor RimM	3.54e-09	1.28e-38	NA	0.5449
2. PF	Q2GIL4	Ribosome maturation factor RimM	4.02e-08	1.19e-35	NA	0.4667
2. PF	A7MEG3	Ribosome maturation factor RimM	1.09e-08	6.70e-21	NA	0.5441
2. PF	Q6NGI4	Ribosome maturation factor RimM	1.43e-09	2.58e-34	NA	0.4554
2. PF	A5EXZ2	Ribosome maturation factor RimM	4.17e-11	2.02e-30	NA	0.6516
2. PF	Q5FA58	Ribosome maturation factor RimM	6.47e-11	7.12e-26	NA	0.5794
2. PF	A2RF49	Ribosome maturation factor RimM	1.22e-09	3.35e-38	NA	0.5943
2. PF	Q21LG3	Ribosome maturation factor RimM	3.47e-10	3.95e-22	NA	0.6188
2. PF	C0RFF9	Ribosome maturation factor RimM	1.38e-07	1.06e-18	NA	0.5888
2. PF	B0BSV9	Ribosome maturation factor RimM	7.93e-11	1.05e-27	NA	0.6463
4. PB	Q2FZ44	Ribosome maturation factor RimM	1.15e-10	1.17e-28	1.54e-05	NA
5. P	Q8XZV8	Ribosome maturation factor RimP	4.31e-02	1.59e-02	NA	NA
5. P	Q0AKL5	Ribosome maturation factor RimM	9.50e-10	1.60e-23	NA	NA
5. P	Q7M7U7	50S ribosomal protein L25	4.00e-01	5.08e-04	NA	NA
5. P	Q4K689	50S ribosomal protein L25	4.52e-01	3.28e-02	NA	NA
5. P	B3E6G0	50S ribosomal protein L25	6.15e-01	4.69e-03	NA	NA
5. P	A4XR55	50S ribosomal protein L25	4.02e-01	8.29e-03	NA	NA
5. P	Q5LNF0	Ribosome maturation factor RimM	2.46e-09	1.48e-28	NA	NA
5. P	P9WH19	Ribosome maturation factor RimM	1.01e-08	2.90e-30	NA	NA
5. P	Q5NXM6	Ribosome maturation factor RimM	2.73e-09	6.39e-29	NA	NA
5. P	A6LHR9	Ribosome maturation factor RimP	4.40e-02	1.36e-02	NA	NA
5. P	A7IIK6	50S ribosomal protein L25	4.21e-01	2.72e-02	NA	NA
5. P	B8DZY2	50S ribosomal protein L25	2.86e-01	1.97e-02	NA	NA
5. P	Q2VZ23	50S ribosomal protein L25	5.38e-01	4.26e-02	NA	NA
5. P	A6L6X0	50S ribosomal protein L25	4.28e-01	2.07e-02	NA	NA
5. P	Q1CSB7	Ribosome maturation factor RimM	1.14e-08	5.51e-25	NA	NA
5. P	A9KSE6	50S ribosomal protein L25	3.33e-01	2.50e-03	NA	NA
5. P	B6YQC3	50S ribosomal protein L25	4.96e-01	4.16e-03	NA	NA
5. P	C6E500	50S ribosomal protein L25	5.27e-01	2.70e-02	NA	NA
5. P	Q9ZJC4	50S ribosomal protein L25	5.29e-01	2.84e-02	NA	NA
5. P	B7V0L7	50S ribosomal protein L25	4.28e-01	1.02e-02	NA	NA
5. P	A6T0Z0	Ribosome maturation factor RimP	4.35e-02	3.14e-02	NA	NA
5. P	Q30TE7	Ribosome maturation factor RimM	5.56e-08	4.24e-30	NA	NA
5. P	C4XHR1	50S ribosomal protein L25	4.76e-01	2.39e-02	NA	NA
5. P	B0BAQ5	50S ribosomal protein L25	5.46e-01	1.06e-02	NA	NA
5. P	Q30TD5	50S ribosomal protein L25	5.19e-01	1.35e-02	NA	NA
5. P	A6L8V4	50S ribosomal protein L25	3.98e-01	2.01e-03	NA	NA
5. P	O83387	50S ribosomal protein L25	5.21e-01	1.36e-02	NA	NA
5. P	A5G0G9	Ribosome maturation factor RimM	3.64e-06	3.33e-30	NA	NA
5. P	Q02G03	50S ribosomal protein L25	4.29e-01	8.75e-03	NA	NA
5. P	Q2KXY5	Ribosome maturation factor RimP	2.18e-02	4.05e-02	NA	NA
5. P	A1BDE9	Ribosome maturation factor RimP	5.08e-02	3.96e-02	NA	NA
5. P	Q5E7F1	Ribosome maturation factor RimM	1.23e-10	6.39e-23	NA	NA
5. P	Q7MXE6	Ribosome maturation factor RimP	4.11e-02	1.79e-02	NA	NA
5. P	Q0K9B7	Ribosome maturation factor RimP	3.69e-02	6.65e-03	NA	NA
5. P	Q39RQ9	50S ribosomal protein L25	5.58e-01	1.21e-03	NA	NA
5. P	B2UAA1	Ribosome maturation factor RimP	4.07e-02	3.29e-03	NA	NA
5. P	Q5HWG0	50S ribosomal protein L25	5.62e-01	3.59e-02	NA	NA
5. P	A5G7R6	50S ribosomal protein L25	4.23e-01	3.16e-03	NA	NA
5. P	P0A7X6	Ribosome maturation factor RimM	1.24e-08	5.50e-22	NA	NA
5. P	A8ESH9	50S ribosomal protein L25	5.10e-01	1.16e-02	NA	NA
5. P	A6GWV6	Ribosome maturation factor RimP	2.33e-02	9.39e-03	NA	NA
5. P	Q8A2A3	Ribosome maturation factor RimP	5.03e-02	4.76e-03	NA	NA
5. P	Q64ZR6	Ribosome maturation factor RimP	4.16e-02	1.67e-03	NA	NA
5. P	Q7VG30	50S ribosomal protein L25	4.69e-01	3.18e-02	NA	NA
5. P	Q0AGY6	50S ribosomal protein L25	4.60e-01	3.04e-02	NA	NA
5. P	B3R1E6	Ribosome maturation factor RimP	3.68e-02	6.75e-03	NA	NA
5. P	Q7W180	50S ribosomal protein L25	4.12e-01	3.56e-02	NA	NA
5. P	O51727	50S ribosomal protein L25	3.87e-01	2.39e-02	NA	NA
5. P	B6EGC0	Ribosome maturation factor RimM	1.26e-10	8.23e-26	NA	NA
5. P	A4G7S9	Ribosome maturation factor RimP	4.40e-02	4.02e-02	NA	NA
5. P	Q67M16	50S ribosomal protein L25 2	3.79e-01	8.69e-03	NA	NA
5. P	A3PN94	Ribosome maturation factor RimM	1.03e-07	7.07e-29	NA	NA
5. P	B0B926	50S ribosomal protein L25	5.67e-01	1.06e-02	NA	NA
5. P	Q9PII8	50S ribosomal protein L25	5.55e-01	3.59e-02	NA	NA
5. P	Q2KYA2	50S ribosomal protein L25	5.07e-01	8.48e-03	NA	NA
5. P	A0LPH1	50S ribosomal protein L25	2.83e-01	4.91e-02	NA	NA
5. P	Q82TQ5	50S ribosomal protein L25	4.75e-01	1.67e-02	NA	NA
5. P	A7I0V6	Ribosome maturation factor RimM	1.04e-08	8.77e-27	NA	NA
5. P	Q3IZ03	Ribosome maturation factor RimM	1.42e-07	4.17e-30	NA	NA
5. P	Q1Q8A5	Ribosome maturation factor RimM	5.40e-08	6.58e-28	NA	NA
5. P	Q9Z6V7	50S ribosomal protein L25	6.19e-01	4.49e-02	NA	NA
5. P	B2UUQ8	Ribosome maturation factor RimM	1.07e-08	2.31e-29	NA	NA
5. P	Q48MW0	50S ribosomal protein L25	3.77e-01	4.66e-02	NA	NA
5. P	Q2GEA0	50S ribosomal protein L25	3.54e-01	3.59e-02	NA	NA
5. P	Q11RT6	50S ribosomal protein L25	3.26e-01	1.36e-03	NA	NA
5. P	Q5L563	50S ribosomal protein L25	5.97e-01	2.41e-02	NA	NA
5. P	A1VDR0	50S ribosomal protein L25	3.37e-01	1.40e-03	NA	NA
5. P	B0JXF5	50S ribosomal protein L25	4.84e-01	2.89e-02	NA	NA
5. P	Q1MQD6	50S ribosomal protein L25	3.35e-01	1.56e-02	NA	NA
5. P	A1S3Z1	Ribosome maturation factor RimM	1.32e-08	1.59e-25	NA	NA
5. P	B3PJN6	50S ribosomal protein L25	4.67e-01	3.00e-02	NA	NA
5. P	A1K9L0	Ribosome maturation factor RimM	8.42e-10	5.04e-28	NA	NA
5. P	Q0C668	Ribosome maturation factor RimM	1.14e-07	1.92e-26	NA	NA
5. P	B5Z9B5	50S ribosomal protein L25	5.26e-01	4.80e-02	NA	NA
5. P	B9LA47	50S ribosomal protein L25	4.68e-01	1.54e-03	NA	NA
5. P	P56078	50S ribosomal protein L25	5.58e-01	2.72e-02	NA	NA
5. P	A5FJF7	Ribosome maturation factor RimP	5.06e-02	1.86e-02	NA	NA
5. P	Q60A15	50S ribosomal protein L25	5.88e-01	3.90e-02	NA	NA
5. P	A1B8V4	Ribosome maturation factor RimM	1.18e-07	1.59e-30	NA	NA
5. P	Q6AJL8	50S ribosomal protein L25	4.71e-01	4.43e-03	NA	NA
5. P	A1AM04	50S ribosomal protein L25	5.19e-01	1.67e-02	NA	NA
5. P	B0T563	Ribosome maturation factor RimM	5.79e-08	1.57e-14	NA	NA
5. P	B8J0S7	50S ribosomal protein L25	2.95e-01	1.93e-03	NA	NA
5. P	A8FKA0	50S ribosomal protein L25	5.55e-01	3.59e-02	NA	NA
5. P	B9M5U4	50S ribosomal protein L25	4.58e-01	1.58e-03	NA	NA
5. P	A7HT07	Ribosome maturation factor RimM	5.59e-08	3.97e-23	NA	NA
5. P	Q7MXK8	50S ribosomal protein L25	5.52e-01	1.71e-02	NA	NA
5. P	B7KCY0	50S ribosomal protein L25	4.34e-01	2.32e-03	NA	NA
5. P	A6Q550	Ribosome maturation factor RimM	4.23e-08	4.06e-21	NA	NA
5. P	Q1CRD8	50S ribosomal protein L25	5.48e-01	3.73e-02	NA	NA
5. P	A6Q771	Ribosome maturation factor RimM	7.18e-08	1.59e-27	NA	NA
5. P	A4WNX8	Ribosome maturation factor RimM	1.21e-07	7.87e-30	NA	NA
5. P	Q46ZN9	Ribosome maturation factor RimP	3.70e-02	3.63e-03	NA	NA
5. P	A8GP85	50S ribosomal protein L25	3.83e-01	2.62e-02	NA	NA
5. P	Q9PLC2	50S ribosomal protein L25	5.84e-01	1.63e-03	NA	NA
5. P	B1XV91	Ribosome maturation factor RimP	6.16e-02	5.28e-03	NA	NA
5. P	Q6MAT1	50S ribosomal protein L25	5.41e-01	5.67e-03	NA	NA
5. P	A8LMB6	Ribosome maturation factor RimM	6.45e-08	4.12e-28	NA	NA
5. P	O84805	50S ribosomal protein L25	5.10e-01	8.03e-03	NA	NA
5. P	Q7WNY3	50S ribosomal protein L25	4.02e-01	3.56e-02	NA	NA
5. P	B7J0N2	50S ribosomal protein L25	2.32e-01	3.93e-02	NA	NA
5. P	A6VC67	50S ribosomal protein L25	4.30e-01	2.18e-02	NA	NA
5. P	Q83FQ8	50S ribosomal protein L25	3.00e-01	1.77e-03	NA	NA
5. P	A6L028	Ribosome maturation factor RimP	4.97e-02	2.07e-03	NA	NA
5. P	A7H564	50S ribosomal protein L25	4.68e-01	3.59e-02	NA	NA
5. P	Q72BR0	50S ribosomal protein L25	3.40e-01	1.40e-03	NA	NA
5. P	B5FAE6	Ribosome maturation factor RimM	8.49e-11	1.21e-22	NA	NA
5. P	Q8K9F5	Ribosome maturation factor RimM	2.58e-10	4.24e-21	NA	NA
5. P	B2IDX8	Ribosome maturation factor RimM	3.67e-06	3.81e-02	NA	NA
5. P	C1DBA9	50S ribosomal protein L25	4.31e-01	4.84e-02	NA	NA
5. P	Q9ZK65	Ribosome maturation factor RimM	1.25e-08	1.44e-23	NA	NA
5. P	B2RHF3	50S ribosomal protein L25	5.16e-01	1.71e-02	NA	NA
5. P	A4SY80	Ribosome maturation factor RimP	5.75e-02	4.09e-03	NA	NA
5. P	Q5LIN3	Ribosome maturation factor RimP	5.59e-02	1.67e-03	NA	NA
5. P	Q64X29	50S ribosomal protein L25	3.94e-01	2.74e-02	NA	NA
5. P	Q28UE7	Ribosome maturation factor RimM	2.90e-07	2.18e-16	NA	NA
5. P	Q65ZY8	50S ribosomal protein L25	2.33e-01	1.57e-02	NA	NA
5. P	B2S2W9	50S ribosomal protein L25	5.23e-01	1.36e-02	NA	NA
5. P	Q30ZH2	50S ribosomal protein L25	4.36e-01	2.62e-03	NA	NA
5. P	Q3KKP2	50S ribosomal protein L25	5.71e-01	2.14e-03	NA	NA
5. P	O34402	Uncharacterized protein YrrD	3.07e-03	3.61e-04	NA	NA
5. P	B2UVP2	50S ribosomal protein L25	5.43e-01	3.04e-02	NA	NA
5. P	B2RHM7	Ribosome maturation factor RimP	4.13e-02	1.56e-02	NA	NA
5. P	A1VY30	50S ribosomal protein L25	5.59e-01	4.56e-02	NA	NA
5. P	A6Q1Y9	50S ribosomal protein L25	4.01e-01	6.54e-04	NA	NA
5. P	Q5LG55	50S ribosomal protein L25	3.98e-01	2.74e-02	NA	NA
5. P	B8DKL6	50S ribosomal protein L25	2.99e-01	2.56e-03	NA	NA
5. P	Q9HVC4	50S ribosomal protein L25	4.30e-01	1.02e-02	NA	NA
5. P	Q1GDC5	Ribosome maturation factor RimM	4.96e-10	1.89e-26	NA	NA
5. P	Q74FE7	50S ribosomal protein L25	5.83e-01	2.69e-03	NA	NA
5. P	Q83HD6	50S ribosomal protein L25	3.71e-01	1.89e-03	NA	NA
5. P	Q17V74	50S ribosomal protein L25	5.37e-01	3.73e-02	NA	NA
5. P	A8EW70	Ribosome maturation factor RimM	4.63e-09	2.01e-20	NA	NA
6. F	Q8YTB1	Probable 16S rRNA-processing protein RimM	1.92e-08	NA	NA	0.5737
6. F	Q13VE9	Ribosome maturation factor RimM	3.44e-09	NA	NA	0.5191
6. F	B2T606	Ribosome maturation factor RimM	1.08e-08	NA	NA	0.5758