Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54743.1

JCVISYN3A_0366

L16-binding dependent 50S subunit-maturation GTPase.
M. mycoides homolog: Q6MTH9.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 77
Unique PROST Go: 17
Unique BLAST Go: 16
Unique Foldseek Go: 7

Total Homologs: 1251
Unique PROST Homologs: 461
Unique BLAST Homologs: 488
Unique Foldseek Homologs: 2

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: ylqF; Ribosome biogenesis GTPase A
Zhang et al. [4]: GO:0042254|ribosome biogenesis
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P75135 (Probable ribosome biogenesis GTPase A) with a FATCAT P-Value: 0 and RMSD of 3.02 angstrom. The sequence alignment identity is 31.0%.
Structural alignment shown in left. Query protein AVX54743.1 colored as red in alignment, homolog P75135 colored as blue. Query protein AVX54743.1 is also shown in right top, homolog P75135 showed in right bottom. They are colored based on secondary structures.

  AVX54743.1 M----SA-EFNWFPGHMNKT---LKDIEARIEMVDVVVEVIDSRAPYSSKN---TTFKKLLKDKPIVYIFSKADIADSKITQQWVDYYVKNENSKVIVLY 89
      P75135 MDTFTSAVKINWFPGHMKKTHDQLKKLASS---LDGVIEVVDARAPTLTQNPEITAY---FTNKPKLTLALKADLAQ---T-------VANSN----ILW 80

  AVX54743.1 NRHTDIVNDL-IN--VINEL-T---AKKREKDKAKGIKNTLINA--L-VIGIPNVGKSTFINRVIKGKN-VKVGNKPGVTRGIQLIHL-NPFINLLDTPG 177
      P75135 G--T-LKQGLQLKRLVIKKLQTLFQAKKNQL-KAKGL---LVHQFRLAVIGMPNVGKSSLINLLL-NKNHLQVANRAGVTKSMSWNQISSEFY-LSDTPG 171

  AVX54743.1 VLPSKLESETVAVNICAINSIKDNVFPKERVAAKLMSYVYNNYDDVIEKYYKINLK--LQKPISVIDSYKIFETIGIEKKWYVTEDI-LDMERILSSFLR 274
      P75135 VFFKRIDEMAVGYKLVLTNVIKREVVPLEDVGAFAFCYLSKHYPQLL-PYEGTDFTEFLHK-FAI--SRKL-----LQKSNQL--NINLACE--L--FVS 256

  AVX54743.1 DLEKGKLGKISFEKVLEVVPEEIQKAINPEDNKQGNDISSLW 316
      P75135 ELINGKYGKLSFE--LD------------------------- 271

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0070129	regulation of mitochondrial translation
1. PBF	GO:0044065	regulation of respiratory system process
1. PBF	GO:0005761	mitochondrial ribosome
1. PBF	GO:0003924	GTPase activity
1. PBF	GO:0042254	ribosome biogenesis
1. PBF	GO:0005525	GTP binding
1. PBF	GO:0042127	regulation of cell population proliferation
1. PBF	GO:0000054	ribosomal subunit export from nucleus
1. PBF	GO:0005730	nucleolus
2. PF	GO:0005739	mitochondrion
2. PF	GO:0030490	maturation of SSU-rRNA
2. PF	GO:0005743	mitochondrial inner membrane
3. BF	GO:0000055	ribosomal large subunit export from nucleus
3. BF	GO:0015030	Cajal body
3. BF	GO:0032297	negative regulation of DNA-dependent DNA replication initiation
3. BF	GO:0051168	nuclear export
3. BF	GO:2000200	regulation of ribosomal subunit export from nucleus
3. BF	GO:0016787	hydrolase activity
3. BF	GO:0030687	preribosome, large subunit precursor
4. PB	GO:0032211	negative regulation of telomere maintenance via telomerase
4. PB	GO:0043022	ribosome binding
4. PB	GO:0000027	ribosomal large subunit assembly
4. PB	GO:0033234	negative regulation of protein sumoylation
4. PB	GO:1904816	positive regulation of protein localization to chromosome, telomeric region
4. PB	GO:0005697	telomerase holoenzyme complex
4. PB	GO:0048444	floral organ morphogenesis
4. PB	GO:0005886	plasma membrane
4. PB	GO:1902895	positive regulation of miRNA transcription
4. PB	GO:0017145	stem cell division
4. PB	GO:0005524	ATP binding
4. PB	GO:0006400	tRNA modification
4. PB	GO:0033235	positive regulation of protein sumoylation
4. PB	GO:0046872	metal ion binding
4. PB	GO:0097216	guanosine tetraphosphate binding
4. PB	GO:0019827	stem cell population maintenance
4. PB	GO:0010077	maintenance of inflorescence meristem identity
4. PB	GO:0032206	positive regulation of telomere maintenance
5. P	GO:0016765	transferase activity, transferring alkyl or aryl (other than methyl) groups
5. P	GO:0070899	mitochondrial tRNA wobble uridine modification
5. P	GO:0043828	tRNA 2-selenouridine synthase activity
5. P	GO:0030488	tRNA methylation
5. P	GO:0000155	phosphorelay sensor kinase activity
5. P	GO:0006109	regulation of carbohydrate metabolic process
5. P	GO:0002098	tRNA wobble uridine modification
5. P	GO:0061668	mitochondrial ribosome assembly
5. P	GO:0005634	nucleus
5. P	GO:0005737	cytoplasm
5. P	GO:0004674	protein serine/threonine kinase activity
5. P	GO:0008976	polyphosphate kinase activity
5. P	GO:0000287	magnesium ion binding
5. P	GO:0009657	plastid organization
5. P	GO:0010322	regulation of isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
5. P	GO:0019843	rRNA binding
5. P	GO:0004712	protein serine/threonine/tyrosine kinase activity
6. F	GO:0005783	endoplasmic reticulum
6. F	GO:0003723	RNA binding
6. F	GO:0006417	regulation of translation
6. F	GO:0015031	protein transport
6. F	GO:0070180	large ribosomal subunit rRNA binding
6. F	GO:0006974	cellular response to DNA damage stimulus
6. F	GO:0005759	mitochondrial matrix
7. B	GO:0000028	ribosomal small subunit assembly
7. B	GO:0000917	division septum assembly
7. B	GO:0015093	ferrous iron transmembrane transporter activity
7. B	GO:0043024	ribosomal small subunit binding
7. B	GO:0048825	cotyledon development
7. B	GO:0070181	small ribosomal subunit rRNA binding
7. B	GO:0016021	integral component of membrane
7. B	GO:0016604	nuclear body
7. B	GO:2000241	regulation of reproductive process
7. B	GO:1901259	chloroplast rRNA processing
7. B	GO:1902326	positive regulation of chlorophyll biosynthetic process
7. B	GO:0042274	ribosomal small subunit biogenesis
7. B	GO:0090070	positive regulation of ribosome biogenesis
7. B	GO:1904143	positive regulation of carotenoid biosynthetic process
7. B	GO:1903104	regulation of insulin receptor signaling pathway involved in determination of adult lifespan
7. B	GO:0042644	chloroplast nucleoid

Uniprot GO Annotations

GO	Description
GO:0005737	cytoplasm
GO:0000166	nucleotide binding
GO:0005525	GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	B7GGD6	Ribosome biogenesis GTPase A	0.00e+00	2.62e-39	3.50e-53	0.8507
1. PBF	Q7ZX41	Guanine nucleotide-binding protein-like 3	2.42e-07	3.37e-03	3.87e-07	0.6031
1. PBF	Q4PS77	Mitochondrial ribosome-associated GTPase 1	1.11e-16	2.66e-28	1.26e-32	0.6911
1. PBF	E3TDS3	Mitochondrial ribosome-associated GTPase 1	0.00e+00	3.86e-27	2.68e-28	0.7054
1. PBF	B6JW87	Mitochondrial GTPase 1	2.54e-12	2.68e-52	6.65e-17	0.6768
1. PBF	Q819W8	Ribosome biogenesis GTPase A	0.00e+00	8.51e-67	3.54e-55	0.8234
1. PBF	O31743	Ribosome biogenesis GTPase A	0.00e+00	1.46e-44	1.40e-54	0.8672
1. PBF	Q3T0J9	Guanine nucleotide-binding protein-like 3-like protein	2.65e-08	5.13e-07	1.17e-17	0.6631
1. PBF	Q17EJ1	Mitochondrial GTPase 1	2.22e-16	6.73e-40	9.65e-24	0.7214
1. PBF	Q6P4W5	Guanine nucleotide-binding protein-like 3	3.21e-06	1.17e-03	1.44e-06	0.6054
1. PBF	Q29AU5	Mitochondrial GTPase 1	2.22e-16	1.89e-32	1.87e-23	0.7114
1. PBF	A9JTX2	Mitochondrial ribosome-associated GTPase 1	0.00e+00	2.04e-35	6.75e-32	0.7098
1. PBF	Q9WZM6	Ribosome biogenesis GTPase A	0.00e+00	1.07e-54	5.93e-35	0.7467
1. PBF	C5D8U8	Ribosome biogenesis GTPase A	0.00e+00	1.64e-39	1.45e-55	0.8667
1. PBF	D5DJL5	Ribosome biogenesis GTPase A	0.00e+00	1.31e-46	3.51e-53	0.841
1. PBF	P75135	Probable ribosome biogenesis GTPase A	0.00e+00	7.94e-38	1.28e-30	0.8016
1. PBF	A8FD69	Ribosome biogenesis GTPase A	0.00e+00	9.55e-47	1.40e-53	0.8801
1. PBF	Q49435	Probable ribosome biogenesis GTPase A	0.00e+00	1.55e-36	2.67e-25	0.8111
1. PBF	E0TTS5	Ribosome biogenesis GTPase A	0.00e+00	1.50e-44	1.22e-54	0.8668
1. PBF	P54453	Uncharacterized protein YqeH	2.54e-03	1.36e-18	3.89e-04	0.6277
1. PBF	Q65JP4	Ribosome biogenesis GTPase A	0.00e+00	1.82e-47	1.25e-53	0.8634
2. PF	Q8TFK7	Genetic interactor of prohibitins 3, mitochondrial	2.77e-02	1.50e-07	NA	0.4716
2. PF	A0Q534	GTPase Der	8.28e-03	1.33e-03	NA	0.2378
2. PF	C8ZGW1	Genetic interactor of prohibitins 3, mitochondrial	3.71e-02	2.73e-10	NA	0.4162
2. PF	A3GEW8	Genetic interactor of prohibitins 3, mitochondrial	3.22e-01	1.85e-05	NA	0.3674
2. PF	E7KI83	Genetic interactor of prohibitins 3, mitochondrial	4.81e-02	3.01e-02	NA	0.4587
2. PF	A7TQC5	Genetic interactor of prohibitins 3, mitochondrial	2.86e-02	4.87e-08	NA	0.4125
2. PF	B3LJN0	Genetic interactor of prohibitins 3, mitochondrial	3.50e-02	6.03e-10	NA	0.3891
2. PF	C7GWH7	Genetic interactor of prohibitins 3, mitochondrial	3.60e-02	6.03e-10	NA	0.4396
2. PF	A6ZP48	Genetic interactor of prohibitins 3, mitochondrial	3.49e-02	2.69e-10	NA	0.4158
2. PF	C4XXL5	Genetic interactor of prohibitins 3, mitochondrial	1.45e-01	5.93e-04	NA	0.3824
2. PF	B5VS87	Genetic interactor of prohibitins 3, mitochondrial	3.52e-02	5.54e-10	NA	0.3685
2. PF	Q75B55	Genetic interactor of prohibitins 3, mitochondrial	3.97e-02	8.56e-09	NA	0.4717
3. BF	Q75DA4	Nucleolar GTP-binding protein 2	1.02e-11	NA	2.98e-12	0.706
3. BF	Q6FWS1	Nucleolar GTP-binding protein 2	4.54e-09	NA	3.04e-11	0.6413
3. BF	A2XGQ1	Nuclear/nucleolar GTPase 2	2.72e-08	NA	1.76e-10	0.6617
3. BF	J9VQ03	Nucleolar GTP-binding protein 2	6.30e-07	NA	8.03e-10	0.6591
3. BF	Q6TGJ8	Nucleolar GTP-binding protein 2	6.90e-07	NA	1.51e-07	0.6454
3. BF	Q5RA07	Guanine nucleotide-binding protein-like 1	3.74e-07	NA	2.13e-07	0.5905
3. BF	Q2YDM7	Large subunit GTPase 1 homolog	2.31e-06	NA	2.70e-11	0.6144
3. BF	Q5TM59	Guanine nucleotide-binding protein-like 1	3.26e-07	NA	1.85e-07	0.5976
3. BF	Q6C036	Nucleolar GTP-binding protein 2	2.34e-08	NA	4.94e-12	0.7106
3. BF	Q7YR35	Guanine nucleotide-binding protein-like 1	3.56e-07	NA	1.93e-07	0.5901
3. BF	Q5ZJD3	Large subunit GTPase 1 homolog	1.79e-04	NA	3.07e-11	0.5975
3. BF	Q4R8D2	Guanine nucleotide-binding protein-like 1	3.83e-07	NA	1.85e-07	0.5607
3. BF	Q7SHR8	Nucleolar GTP-binding protein 2	1.47e-10	NA	1.09e-09	0.6737
3. BF	Q6CSP9	Nucleolar GTP-binding protein 2	1.38e-11	NA	1.95e-10	0.6355
3. BF	Q4R8L2	Large subunit GTPase 1 homolog	2.13e-04	NA	1.02e-10	0.6075
3. BF	P0CS94	Nucleolar GTP-binding protein 2	3.44e-07	NA	9.40e-10	0.657
4. PB	Q6DRP2	Guanine nucleotide-binding protein-like 3	1.80e-07	6.51e-03	6.58e-11	NA
4. PB	B8D8C1	GTPase Der	5.60e-03	4.27e-02	0.007	NA
4. PB	Q10190	Large subunit GTPase 1	1.79e-07	2.48e-02	5.45e-11	NA
4. PB	A1BHZ8	GTPase Der	3.26e-03	1.02e-02	3.03e-04	NA
4. PB	A0KUJ9	GTPase Der	4.69e-03	7.96e-03	0.010	NA
4. PB	B1KX71	GTPase Der	1.11e-02	6.32e-03	0.042	NA
4. PB	B5Z0Y0	GTPase Der	5.57e-03	1.17e-03	0.013	NA
4. PB	B5R578	GTPase Der	5.49e-03	3.27e-04	0.025	NA
4. PB	B7UGV7	GTPase Der	6.19e-03	1.43e-03	0.008	NA
4. PB	Q7VM29	GTPase Der	7.93e-03	1.01e-03	0.009	NA
4. PB	Q8EC36	GTPase Der	4.95e-03	7.80e-03	0.011	NA
4. PB	Q7N702	GTPase Der	1.05e-02	1.67e-02	0.015	NA
4. PB	B7I5H1	GTPase Der	7.87e-03	4.23e-02	2.67e-04	NA
4. PB	Q8EWH6	GTPase Der	1.48e-02	1.51e-03	0.003	NA
4. PB	P40010	Nuclear GTP-binding protein NUG1	9.98e-09	9.42e-03	8.22e-08	NA
4. PB	O74776	Mitochondrial GTPase 1	2.80e-11	5.46e-39	7.85e-17	NA
4. PB	A5VJK4	GTPase Der	2.36e-02	3.60e-02	0.026	NA
4. PB	B2VE93	GTPase Der	6.23e-03	6.26e-03	0.018	NA
4. PB	A5N7W7	GTPase Der	1.28e-02	3.01e-02	0.003	NA
4. PB	Q9ZCP6	GTPase Der	7.79e-02	1.40e-02	8.22e-04	NA
4. PB	B8I442	GTPase Der	1.66e-02	1.84e-02	3.60e-04	NA
4. PB	B1I462	GTPase Der	1.07e-02	4.13e-03	0.011	NA
4. PB	A8EZV9	tRNA modification GTPase MnmE	9.64e-02	1.16e-02	0.006	NA
4. PB	B5RCY8	GTPase Der	5.94e-03	3.98e-04	0.026	NA
4. PB	B2THQ9	GTPase Der	2.42e-02	4.58e-03	0.042	NA
4. PB	Q0AE46	GTPase Der	8.55e-03	3.54e-02	0.003	NA
4. PB	A1TM31	GTPase Der	8.33e-03	5.66e-03	0.036	NA
4. PB	A5GR60	GTPase Der	7.56e-03	4.15e-02	0.004	NA
4. PB	A8HVL5	GTPase Der	1.38e-02	4.57e-02	0.003	NA
4. PB	A8A317	GTPase Der	6.97e-03	1.17e-03	0.013	NA
4. PB	Q9BT17	Mitochondrial ribosome-associated GTPase 1	1.11e-16	6.54e-33	2.27e-33	NA
4. PB	A6WQP3	GTPase Der	5.30e-03	2.15e-02	0.033	NA
4. PB	Q7NBV2	GTPase Der	4.36e-02	1.06e-02	0.014	NA
4. PB	Q8FF59	GTPase Der	7.08e-03	1.01e-03	0.007	NA
4. PB	Q8R9J1	GTPase Der	8.71e-03	4.79e-02	2.18e-04	NA
4. PB	Q5FKF4	GTPase Der	1.01e-02	8.62e-03	2.21e-04	NA
4. PB	C6E0Y6	GTPase Der	7.75e-03	8.62e-03	7.30e-05	NA
4. PB	Q1GHZ2	GTPase Der	1.18e-02	1.72e-03	0.028	NA
4. PB	Q5LR04	GTPase Der	9.18e-03	2.83e-03	0.010	NA
4. PB	Q0HKV5	GTPase Der	4.63e-03	7.96e-03	0.010	NA
4. PB	Q83C83	GTPase Der	9.59e-03	4.39e-03	3.11e-05	NA
4. PB	Q7W6Q0	GTPase Der	1.84e-02	7.34e-03	0.033	NA
4. PB	C4XIQ6	GTPase Der	1.64e-02	1.68e-02	0.009	NA
4. PB	C4ZX86	GTPase Der	6.64e-03	1.17e-03	0.013	NA
4. PB	Q74AX4	GTPase Der	8.41e-03	3.31e-02	2.32e-05	NA
4. PB	Q7VWL4	GTPase Der	2.43e-02	7.34e-03	0.033	NA
4. PB	Q0AB37	GTPase Der	5.64e-03	8.04e-03	8.61e-05	NA
4. PB	B5EE25	GTPase Der	7.65e-03	9.33e-03	8.50e-05	NA
4. PB	A7FW89	GTPase Der	9.91e-03	1.60e-03	0.002	NA
4. PB	O84709	GTPase Der	1.09e-02	7.19e-04	0.017	NA
4. PB	B4T0P5	GTPase Der	9.05e-03	2.90e-04	0.027	NA
4. PB	A9KWW9	GTPase Der	5.27e-03	2.15e-02	0.033	NA
4. PB	B0B8S9	GTPase Der	1.10e-02	4.43e-04	0.019	NA
4. PB	Q21KS9	GTPase Der	1.98e-02	3.44e-02	7.03e-08	NA
4. PB	A1SU43	GTPase Der	7.72e-03	3.85e-02	0.015	NA
4. PB	B0TLI8	GTPase Der	5.00e-03	2.64e-03	0.039	NA
4. PB	A5VYT9	GTPase Der	1.20e-02	3.44e-02	0.009	NA
4. PB	A4WD89	GTPase Der	8.65e-03	1.38e-03	0.009	NA
4. PB	C3LT16	GTPase Der	4.64e-03	1.44e-04	4.54e-04	NA
4. PB	Q8Z4P6	GTPase Der	6.67e-03	3.57e-04	0.027	NA
4. PB	B1JDV4	GTPase Der	1.99e-02	2.32e-02	0.025	NA
4. PB	B3EFY1	GTPase Der	6.57e-03	7.06e-03	8.34e-04	NA
4. PB	Q5E768	GTPase Der	6.84e-03	3.81e-04	1.09e-05	NA
4. PB	P0A6P6	GTPase Der	6.32e-03	1.17e-03	0.013	NA
4. PB	C5BES7	GTPase Der	1.18e-02	1.04e-04	0.014	NA
4. PB	Q0T208	GTPase Der	7.03e-03	1.13e-03	0.011	NA
4. PB	A6SZW6	GTPase Der	7.28e-03	6.71e-03	3.47e-07	NA
4. PB	A4SYD7	GTPase Der	1.22e-02	1.81e-04	5.36e-04	NA
4. PB	Q9ZCI1	tRNA modification GTPase MnmE	9.67e-02	8.61e-04	0.022	NA
4. PB	Q2SRR7	GTPase Der	1.29e-02	8.96e-03	8.78e-04	NA
4. PB	B3E421	GTPase Der	1.08e-02	1.99e-02	2.91e-04	NA
4. PB	Q7U8G2	GTPase Der	9.20e-03	6.58e-03	0.006	NA
4. PB	Q47WC5	GTPase Der	9.36e-03	7.74e-04	0.001	NA
4. PB	B1XAY6	GTPase Der	6.33e-03	1.17e-03	0.013	NA
4. PB	B8F4X7	GTPase Der	7.07e-03	8.25e-04	0.003	NA
4. PB	B0BAF8	GTPase Der	1.13e-02	4.43e-04	0.019	NA
4. PB	Q04AY6	GTPase Der	1.74e-02	4.08e-02	1.13e-05	NA
4. PB	A1RHQ7	GTPase Der	4.91e-03	3.01e-02	0.002	NA
4. PB	Q7NGF9	GTPase Der	1.56e-02	7.13e-03	0.010	NA
4. PB	B3QLF4	GTPase Der	8.93e-03	3.07e-03	3.37e-04	NA
4. PB	A5GJ79	GTPase Der	7.32e-03	1.02e-03	0.011	NA
4. PB	Q9W590	Large subunit GTPase 1 homolog	9.03e-06	2.73e-02	2.47e-05	NA
4. PB	A1APR9	GTPase Der	2.03e-02	1.65e-02	0.001	NA
4. PB	Q5PNI6	GTPase Der	6.02e-03	2.90e-04	0.027	NA
4. PB	B7M7L5	GTPase Der	6.87e-03	1.17e-03	0.013	NA
4. PB	Q8KH12	GTPase Der	1.79e-02	4.08e-02	1.13e-05	NA
4. PB	Q986D9	GTPase Der	2.23e-02	1.57e-02	0.004	NA
4. PB	Q7VDI8	GTPase Der	5.62e-03	8.12e-03	0.005	NA
4. PB	B8D8G4	GTPase Der	6.20e-03	4.52e-02	0.007	NA
4. PB	A8H249	GTPase Der	5.55e-03	4.53e-03	0.017	NA
4. PB	A8GPN6	tRNA modification GTPase MnmE	8.74e-02	6.01e-03	0.033	NA
4. PB	B1XU78	GTPase Der	1.34e-02	1.89e-04	0.001	NA
4. PB	Q88PJ3	GTPase Der	1.21e-02	4.04e-02	0.016	NA
4. PB	Q085U2	GTPase Der	5.26e-03	4.44e-02	3.88e-04	NA
4. PB	Q9VCU5	Mitochondrial ribosome-associated GTPase 1	2.22e-16	1.13e-29	1.20e-23	NA
4. PB	B9E1C8	GTPase Der	1.36e-02	3.01e-02	0.003	NA
4. PB	C1D094	GTPase Der	6.32e-03	6.20e-06	2.48e-04	NA
4. PB	Q5P7B7	GTPase Der	6.39e-03	1.99e-02	0.011	NA
4. PB	B2V5W6	GTPase Der	1.60e-02	7.50e-05	0.022	NA
4. PB	Q1IEH7	GTPase Der	1.06e-02	4.04e-02	0.008	NA
4. PB	Q9M8Z5	Guanine nucleotide-binding protein-like NSN1	6.23e-08	2.53e-03	4.24e-15	NA
4. PB	B4RV85	GTPase Der	5.30e-03	3.97e-05	0.027	NA
4. PB	B2TXT6	GTPase Der	6.08e-03	1.15e-03	0.023	NA
4. PB	A1B4S0	GTPase Der	1.07e-02	1.89e-04	0.050	NA
4. PB	Q9NVN8	Guanine nucleotide-binding protein-like 3-like protein	3.66e-08	2.20e-07	1.58e-17	NA
4. PB	B7VJU2	GTPase Der	6.29e-03	2.66e-05	0.021	NA
4. PB	Q8XJK1	GTPase Der	8.15e-03	2.17e-03	1.79e-04	NA
4. PB	C6DBH0	GTPase Der	7.72e-03	6.85e-05	0.031	NA
4. PB	A3MZC1	GTPase Der	5.53e-03	7.99e-04	0.012	NA
4. PB	A7ZPV4	GTPase Der	6.96e-03	1.17e-03	0.013	NA
4. PB	Q68VZ0	tRNA modification GTPase MnmE	8.92e-02	4.07e-04	0.003	NA
4. PB	C0QT02	GTPase Der	1.11e-02	3.61e-04	0.001	NA
4. PB	Q87S12	GTPase Der	5.60e-03	4.99e-05	0.025	NA
4. PB	C0PYN4	GTPase Der	6.67e-03	5.99e-04	0.016	NA
4. PB	A5I4V0	GTPase Der	1.15e-02	1.60e-03	0.002	NA
4. PB	Q8DKI1	GTPase Der	6.29e-03	1.65e-02	0.002	NA
4. PB	B5FAX6	GTPase Der	7.02e-03	3.81e-04	1.09e-05	NA
4. PB	Q7V8X0	GTPase Der	1.12e-02	1.87e-02	0.002	NA
4. PB	B1XLH8	GTPase Der	1.81e-02	2.73e-02	0.021	NA
4. PB	B2J1L2	GTPase Der	8.38e-03	3.15e-02	0.047	NA
4. PB	Q12PT0	GTPase Der	6.16e-03	2.78e-02	5.80e-04	NA
4. PB	B7MYE6	GTPase Der	7.07e-03	1.03e-03	0.020	NA
4. PB	Q3SL66	GTPase Der	2.08e-02	2.55e-02	0.005	NA
4. PB	A8GT93	GTPase Der	9.98e-03	2.58e-02	1.17e-04	NA
4. PB	Q6PGG6	Guanine nucleotide-binding protein-like 3-like protein	2.53e-08	3.75e-07	3.28e-17	NA
4. PB	Q6MB45	GTPase Der	1.83e-02	1.70e-04	0.002	NA
4. PB	A8LHW1	GTPase Der	7.22e-03	1.23e-02	0.046	NA
4. PB	Q3AQ22	GTPase Der	1.81e-02	1.53e-02	0.008	NA
4. PB	Q58859	Uncharacterized GTP-binding protein MJ1464	1.29e-09	7.09e-09	1.66e-15	NA
4. PB	A8EZN9	GTPase Der	1.34e-02	3.28e-02	5.54e-05	NA
4. PB	A4XHX9	GTPase Der	1.35e-02	8.28e-03	0.002	NA
4. PB	Q8KBK3	GTPase Der	1.54e-02	5.38e-03	6.11e-04	NA
4. PB	B3PDM5	GTPase Der	1.72e-02	5.38e-03	5.47e-04	NA
4. PB	A9KFU3	GTPase Der	9.10e-03	4.39e-03	3.11e-05	NA
4. PB	Q0VNE4	GTPase Der	1.54e-02	3.37e-02	0.001	NA
4. PB	A3D6V5	GTPase Der	4.81e-03	1.89e-02	0.033	NA
4. PB	Q1IWI7	GTPase Der	5.11e-03	3.27e-05	0.001	NA
4. PB	B3EMI7	GTPase Der	7.08e-03	2.21e-03	0.008	NA
4. PB	B9KZ43	GTPase Der	1.06e-02	4.44e-03	5.01e-05	NA
4. PB	Q3AZ65	GTPase Der	7.62e-03	1.59e-03	0.004	NA
4. PB	A5D1U6	GTPase Der	5.11e-03	4.74e-02	0.001	NA
4. PB	O51881	GTPase Der	9.37e-03	2.68e-02	0.024	NA
4. PB	A8YV35	GTPase Der	1.16e-02	1.67e-02	5.53e-04	NA
4. PB	B9M914	GTPase Der	1.25e-02	3.74e-02	1.13e-04	NA
4. PB	B1IWF0	GTPase Der	6.95e-03	1.17e-03	0.013	NA
4. PB	B0K8N3	GTPase Der	4.76e-03	1.16e-02	0.003	NA
4. PB	B6IZN3	GTPase Der	9.08e-03	4.53e-03	3.25e-05	NA
4. PB	P44536	GTPase Der	7.40e-03	4.16e-04	0.038	NA
4. PB	Q39T85	GTPase Der	1.94e-02	2.48e-02	1.60e-05	NA
4. PB	A8AD75	GTPase Der	1.03e-02	6.39e-04	0.033	NA
4. PB	Q0SS66	GTPase Der	8.51e-03	2.17e-03	1.79e-04	NA
4. PB	Q3M929	GTPase Der	1.87e-02	1.53e-02	0.048	NA
4. PB	Q8CI11	Guanine nucleotide-binding protein-like 3	1.02e-06	6.05e-05	4.74e-07	NA
4. PB	B7N699	GTPase Der	7.07e-03	9.57e-04	0.013	NA
4. PB	B8CKR5	GTPase Der	4.90e-03	6.26e-03	0.043	NA
4. PB	B1IIN2	GTPase Der	8.90e-03	4.22e-03	0.041	NA
4. PB	B7JC34	GTPase Der	7.80e-03	1.22e-03	0.013	NA
4. PB	Q4K6V3	GTPase Der	1.05e-02	1.19e-02	0.042	NA
4. PB	Q8YZH7	GTPase Der	7.17e-03	3.06e-02	0.049	NA
4. PB	A1S859	GTPase Der	7.24e-03	1.59e-02	0.013	NA
4. PB	Q6LU45	GTPase Der	4.19e-03	1.38e-03	2.22e-05	NA
4. PB	B5EJF7	GTPase Der	5.61e-03	1.22e-03	0.013	NA
4. PB	Q68W59	GTPase Der	1.06e-02	7.27e-03	6.74e-05	NA
4. PB	Q7NS92	GTPase Der	8.63e-03	1.40e-02	8.33e-04	NA
4. PB	B1KLB1	GTPase Der	7.12e-03	3.07e-03	0.016	NA
4. PB	Q7MNE7	GTPase Der	4.97e-03	1.05e-04	2.87e-04	NA
4. PB	O82497	DAR GTPase 2, mitochondrial	4.33e-15	2.16e-45	2.45e-19	NA
4. PB	Q0TEX4	GTPase Der	6.24e-03	1.01e-03	0.007	NA
4. PB	Q28QC6	GTPase Der	1.27e-02	1.33e-02	0.001	NA
4. PB	A1WUL5	GTPase Der	1.67e-02	2.17e-02	0.040	NA
4. PB	Q2RIV4	GTPase Der	6.88e-03	3.24e-02	5.03e-06	NA
4. PB	Q6D280	GTPase Der	7.02e-03	5.16e-04	0.037	NA
4. PB	A9NDV6	GTPase Der	1.07e-02	4.39e-03	3.11e-05	NA
4. PB	P47571	GTPase Der	2.06e-02	2.95e-02	3.42e-07	NA
4. PB	A7MZE5	GTPase Der	5.68e-03	4.11e-05	0.001	NA
4. PB	A6VV10	GTPase Der	7.92e-03	2.53e-02	0.001	NA
4. PB	Q3KKZ1	GTPase Der	1.02e-02	7.11e-04	0.017	NA
4. PB	B7LCQ1	GTPase Der	6.19e-03	1.17e-03	0.013	NA
4. PB	Q2WBH0	tRNA modification GTPase MnmE	7.24e-02	1.23e-03	0.046	NA
4. PB	B6EGZ1	GTPase Der	5.70e-03	1.44e-03	3.05e-06	NA
4. PB	Q7URJ8	GTPase Der	7.11e-03	1.14e-02	0.008	NA
4. PB	P0A6P5	GTPase Der	6.41e-03	1.17e-03	0.013	NA
4. PB	B4SED0	GTPase Der	5.17e-03	2.19e-03	2.49e-05	NA
4. PB	Q6MTJ6	GTPase Der	9.98e-03	4.91e-03	5.15e-04	NA
4. PB	A8GHW1	GTPase Der	8.61e-03	3.69e-04	0.040	NA
4. PB	Q8DF02	GTPase Der	4.76e-03	8.78e-05	4.63e-04	NA
4. PB	B1X0B0	GTPase Der	5.63e-03	3.12e-02	0.008	NA
4. PB	B8CWY9	GTPase Der	1.81e-02	2.41e-02	5.40e-04	NA
4. PB	B7MHZ6	GTPase Der	6.63e-03	1.03e-03	0.020	NA
4. PB	Q811S9	Guanine nucleotide-binding protein-like 3	1.68e-06	3.97e-05	1.11e-04	NA
4. PB	Q8MT06	Guanine nucleotide-binding protein-like 3 homolog	1.37e-07	5.80e-04	1.05e-17	NA
4. PB	A9N205	GTPase Der	5.95e-03	2.97e-04	0.027	NA
4. PB	Q9BVP2	Guanine nucleotide-binding protein-like 3	1.26e-07	3.75e-05	7.30e-10	NA
4. PB	A9BE09	GTPase Der	7.18e-03	5.27e-03	0.009	NA
4. PB	A3DE77	GTPase Der	1.46e-02	2.34e-02	5.04e-04	NA
4. PB	Q3A4Q5	GTPase Der	8.32e-03	3.57e-02	5.13e-04	NA
4. PB	Q0HX53	GTPase Der	5.31e-03	8.04e-03	0.012	NA
4. PB	Q3K7C0	GTPase Der	1.15e-02	2.08e-02	0.036	NA
4. PB	B8E9T1	GTPase Der	5.17e-03	2.15e-02	0.033	NA
4. PB	Q8R2R6	Mitochondrial ribosome-associated GTPase 1	0.00e+00	1.90e-31	1.69e-30	NA
4. PB	B0BUT3	GTPase Der	1.12e-02	2.78e-02	2.16e-04	NA
4. PB	A1VNF8	GTPase Der	1.15e-02	4.52e-02	0.048	NA
4. PB	Q169E2	GTPase Der	1.48e-02	1.27e-03	0.044	NA
4. PB	A5F3E6	GTPase Der	4.93e-03	1.44e-04	4.54e-04	NA
4. PB	B7LKC7	GTPase Der	6.91e-03	1.27e-03	0.012	NA
4. PB	Q6F1R7	GTPase Der	6.57e-03	1.77e-02	0.037	NA
4. PB	Q21086	Guanine nucleotide-binding protein-like 3 homolog	5.50e-08	3.70e-07	1.96e-14	NA
4. PB	Q9KTW7	GTPase Der	5.11e-03	1.44e-04	4.54e-04	NA
4. PB	Q3ICZ9	GTPase Der	4.53e-03	2.75e-03	0.001	NA
4. PB	Q0TPJ9	GTPase Der	7.41e-03	2.17e-03	1.79e-04	NA
4. PB	Q82XU6	GTPase Der	1.01e-02	7.49e-03	0.003	NA
4. PB	Q8Y026	GTPase Der	3.22e-03	7.34e-03	0.003	NA
4. PB	Q7WHN4	GTPase Der	2.10e-02	7.34e-03	0.033	NA
4. PB	Q3SR12	GTPase Der	2.35e-02	1.01e-02	0.027	NA
4. PB	B0K3E4	GTPase Der	4.45e-03	1.70e-02	0.003	NA
4. PB	Q3AI13	GTPase Der	6.93e-03	8.25e-04	0.004	NA
4. PB	P74120	GTPase Der	2.10e-02	1.50e-02	0.006	NA
4. PB	Q15R60	GTPase Der	6.53e-03	1.93e-03	0.026	NA
4. PB	B7NQW0	GTPase Der	6.92e-03	1.01e-03	0.007	NA
4. PB	B6I583	GTPase Der	6.60e-03	1.17e-03	0.013	NA
4. PB	A9IK66	GTPase Der	6.79e-03	3.34e-03	0.009	NA
4. PB	B6J7Q3	GTPase Der	1.10e-02	4.39e-03	3.11e-05	NA
4. PB	A4G4K6	GTPase Der	6.86e-03	1.93e-02	1.02e-05	NA
4. PB	B1LNG6	GTPase Der	7.04e-03	9.57e-04	0.013	NA
4. PB	A9B567	GTPase Der	1.44e-02	9.33e-03	1.84e-08	NA
4. PB	Q3AAU6	GTPase Der	1.77e-02	6.99e-03	1.35e-04	NA
4. PB	B2G718	GTPase Der	1.12e-02	3.60e-02	0.026	NA
4. PB	A4WUI6	GTPase Der	6.48e-03	3.21e-02	0.003	NA
4. PB	Q9RS19	GTPase Der	4.89e-03	7.09e-05	1.94e-04	NA
4. PB	Q58803	Uncharacterized protein MJ1408	1.02e-01	4.36e-02	0.002	NA
4. PB	B5BAY9	GTPase Der	1.01e-02	2.90e-04	0.027	NA
4. PB	Q8L607	Short integuments 2, mitochondrial	2.22e-15	1.08e-42	5.08e-23	NA
4. PB	Q03151	Mitochondrial GTPase 1	4.53e-10	1.59e-34	6.46e-10	NA
4. PB	A5EI59	GTPase Der	2.04e-02	3.58e-03	2.71e-04	NA
4. PB	Q9KCD4	GTPase Der	8.66e-03	1.43e-02	0.003	NA
4. PB	A6LSI6	GTPase Der	1.43e-02	1.65e-02	0.011	NA
4. PB	Q21W32	GTPase Der	9.93e-03	4.97e-02	0.014	NA
4. PB	B4S433	GTPase Der	8.82e-03	1.29e-02	4.14e-05	NA
4. PB	B0TFW3	GTPase Der	5.18e-03	6.85e-03	1.16e-05	NA
4. PB	A4Y8T6	GTPase Der	5.08e-03	2.84e-02	0.003	NA
4. PB	A7HYV8	GTPase Der	1.29e-02	4.27e-02	6.46e-05	NA
4. PB	Q9XCI8	GTPase Der	1.02e-02	2.90e-04	0.027	NA
4. PB	B0BTQ8	GTPase Der	5.42e-03	7.99e-04	0.017	NA
4. PB	Q1LLJ5	GTPase Der	8.62e-03	1.19e-02	0.002	NA
4. PB	Q57LJ0	GTPase Der	6.63e-03	5.99e-04	0.016	NA
4. PB	B7KHD2	GTPase Der	6.56e-03	1.80e-02	0.039	NA
4. PB	B3H0R7	GTPase Der	4.79e-03	7.58e-04	0.012	NA
4. PB	A4SDB8	GTPase Der	1.86e-02	3.85e-03	0.002	NA
4. PB	Q9TLX6	Probable tRNA modification GTPase MnmE	1.04e-01	9.42e-03	0.002	NA
4. PB	P57662	GTPase Der	7.49e-03	4.52e-02	0.007	NA
4. PB	Q3B5U3	GTPase Der	6.49e-03	2.92e-02	0.005	NA
5. P	Q4A8X1	GTPase Obg	1.61e-01	3.37e-03	NA	NA
5. P	Q88PM7	tRNA 2-selenouridine synthase	1.97e-01	8.79e-03	NA	NA
5. P	Q7VFY6	GTPase Der	1.66e-02	1.59e-03	NA	NA
5. P	A4IRC7	GTPase Obg	1.67e-01	3.62e-03	NA	NA
5. P	A5VYQ1	tRNA 2-selenouridine synthase	1.64e-01	1.22e-02	NA	NA
5. P	Q11CN2	tRNA modification GTPase MnmE	1.03e-01	8.36e-03	NA	NA
5. P	P94478	GTPase HflX	1.52e-02	5.85e-08	NA	NA
5. P	Q5WSF0	tRNA modification GTPase MnmE	1.54e-01	2.23e-02	NA	NA
5. P	D3FTV4	GTPase HflX	2.51e-02	3.57e-06	NA	NA
5. P	A6LEP5	GTPase Der	1.72e-02	6.26e-03	NA	NA
5. P	Q99TK9	GTPase Obg	1.55e-01	1.36e-04	NA	NA
5. P	B1H0I4	GTPase Obg	1.39e-01	8.52e-04	NA	NA
5. P	A1AXX6	tRNA modification GTPase MnmE	6.80e-02	3.21e-02	NA	NA
5. P	B8ZPS8	GTPase Obg	1.95e-01	5.01e-03	NA	NA
5. P	A6KXK1	GTPase Der	1.13e-02	3.67e-02	NA	NA
5. P	B3PMC1	GTPase Obg	1.26e-01	7.27e-03	NA	NA
5. P	A5CFM7	tRNA modification GTPase MnmE	1.22e-01	6.32e-03	NA	NA
5. P	Q8FK67	tRNA 2-selenouridine synthase	1.10e-01	7.64e-03	NA	NA
5. P	A1UQU6	tRNA modification GTPase MnmE	6.17e-02	1.44e-03	NA	NA
5. P	Q4AAV4	GTPase Obg	1.78e-01	5.72e-03	NA	NA
5. P	A3DBS5	GTPase Obg	8.61e-02	1.65e-05	NA	NA
5. P	Q8DYL0	GTPase Obg	1.12e-01	8.79e-03	NA	NA
5. P	Q5HNQ7	GTPase Obg	1.40e-01	5.34e-05	NA	NA
5. P	Q0TNI5	GTPase Obg	8.35e-02	4.11e-04	NA	NA
5. P	A9IZY1	tRNA modification GTPase MnmE	7.42e-02	9.08e-04	NA	NA
5. P	A1JKS6	GTPase Der	9.21e-03	8.89e-04	NA	NA
5. P	B1IX32	tRNA modification GTPase MnmE	8.01e-02	4.74e-02	NA	NA
5. P	Q668A3	GTPase Der	7.36e-03	8.43e-04	NA	NA
5. P	Q88VG4	GTPase Obg	1.40e-01	2.08e-03	NA	NA
5. P	B0S3Z4	GTPase Obg	1.21e-01	1.24e-04	NA	NA
5. P	A0Q125	GTPase Der	1.14e-02	2.53e-02	NA	NA
5. P	A4XJS8	GTPase Obg	4.95e-02	1.15e-03	NA	NA
5. P	Q8DUU2	GTPase Obg	9.02e-02	1.01e-02	NA	NA
5. P	Q0BND2	GTPase Der	7.39e-02	2.95e-03	NA	NA
5. P	Q08622	Genetic interactor of prohibitins 3, mitochondrial	3.50e-02	2.81e-10	NA	NA
5. P	B3WCP4	HPr kinase/phosphorylase	1.77e-01	3.14e-03	NA	NA
5. P	Q8E465	GTPase Obg	1.10e-01	8.79e-03	NA	NA
5. P	Q38WT4	GTPase Obg	1.70e-01	8.88e-05	NA	NA
5. P	A6QHI6	GTPase Obg	1.36e-01	1.36e-04	NA	NA
5. P	A0Q1T4	GTPase Obg	6.35e-02	1.11e-04	NA	NA
5. P	A8FFS8	GTPase Obg	1.56e-01	2.88e-05	NA	NA
5. P	Q21CM0	tRNA modification GTPase MnmE	7.38e-02	6.13e-03	NA	NA
5. P	Q73LW4	GTPase Obg	3.03e-01	1.38e-02	NA	NA
5. P	Q8DEC6	GTPase Obg	2.00e-01	4.27e-02	NA	NA
5. P	Q72HR4	GTPase Obg	1.06e-01	3.58e-05	NA	NA
5. P	B9WEX6	Genetic interactor of prohibitins 3, mitochondrial	2.20e-01	1.90e-05	NA	NA
5. P	A6QB70	GTPase Obg	6.39e-02	4.97e-02	NA	NA
5. P	A4VI54	GTPase Obg	3.32e-01	1.01e-02	NA	NA
5. P	Q5NFD2	GTPase Der	5.15e-03	1.55e-03	NA	NA
5. P	A0L4B2	GTPase HflX	2.13e-02	3.15e-10	NA	NA
5. P	P25519	GTPase HflX	2.10e-02	7.33e-06	NA	NA
5. P	Q48LZ0	GTPase Der	1.11e-02	1.80e-02	NA	NA
5. P	B1JSA4	GTPase Der	7.90e-03	5.10e-04	NA	NA
5. P	B7NF24	tRNA modification GTPase MnmE	1.73e-01	4.57e-02	NA	NA
5. P	P25522	tRNA modification GTPase MnmE	7.02e-02	4.74e-02	NA	NA
5. P	A6W352	GTPase Obg	3.74e-01	5.49e-03	NA	NA
5. P	Q07UP2	tRNA modification GTPase MnmE	6.42e-02	2.70e-02	NA	NA
5. P	Q65GM7	GTPase Obg	1.69e-01	9.37e-04	NA	NA
5. P	B6JD21	GTPase Obg	6.96e-02	3.18e-02	NA	NA
5. P	B9JER1	GTPase Obg	8.84e-02	4.00e-02	NA	NA
5. P	Q3IYH3	tRNA modification GTPase MnmE	9.27e-02	4.36e-02	NA	NA
5. P	Q8CNZ7	GTPase Obg	1.24e-01	2.75e-05	NA	NA
5. P	Q97JL4	GTPase Obg	5.01e-02	7.11e-04	NA	NA
5. P	B2RIY7	GTPase Obg	3.56e-01	2.08e-02	NA	NA
5. P	Q6YPG5	Putative nitric oxide synthase	1.43e-03	5.33e-03	NA	NA
5. P	P75309	GTPase Der	1.33e-02	1.16e-02	NA	NA
5. P	A5VYC6	GTPase Obg	3.27e-01	5.60e-03	NA	NA
5. P	Q30RE2	tRNA 2-selenouridine synthase	1.10e-01	2.04e-03	NA	NA
5. P	Q1JLA1	GTPase Obg	1.40e-01	1.80e-03	NA	NA
5. P	Q8EWL0	GTPase Obg	1.17e-01	2.15e-02	NA	NA
5. P	Q6DHF7	GTP-binding protein 10	2.69e-01	2.33e-03	NA	NA
5. P	B7IIV2	GTPase Obg	1.21e-01	3.11e-03	NA	NA
5. P	B4RK02	HPr kinase/phosphorylase	3.23e-01	9.08e-04	NA	NA
5. P	Q9Z762	GTPase Der	1.94e-02	1.91e-03	NA	NA
5. P	Q3K6K9	GTPase Obg	3.35e-01	9.90e-03	NA	NA
5. P	A5IIK3	tRNA modification GTPase MnmE	1.44e-01	2.41e-02	NA	NA
5. P	B0TBW1	GTPase Obg	1.47e-01	9.78e-04	NA	NA
5. P	B1LA53	GTPase Obg	4.53e-02	4.44e-03	NA	NA
5. P	Q83PL3	tRNA modification GTPase MnmE	1.42e-01	4.83e-02	NA	NA
5. P	B9EAF7	HPr kinase/phosphorylase	1.15e-01	3.47e-02	NA	NA
5. P	C0Z6Q2	HPr kinase/phosphorylase	1.86e-01	3.67e-02	NA	NA
5. P	Q892N8	GTPase Obg	8.20e-02	7.83e-04	NA	NA
5. P	B8GW34	tRNA modification GTPase MnmE	8.81e-02	2.66e-03	NA	NA
5. P	C4LC41	GTPase Der	4.58e-03	1.08e-03	NA	NA
5. P	C5CXH0	GTPase Der	9.23e-03	7.64e-03	NA	NA
5. P	Q8ZCT9	GTPase Der	8.14e-03	5.10e-04	NA	NA
5. P	Q7UJI3	tRNA modification GTPase MnmE	9.54e-02	7.58e-04	NA	NA
5. P	A5I666	GTPase Obg	4.55e-02	1.73e-04	NA	NA
5. P	Q8P0I6	GTPase Obg	2.13e-01	3.01e-03	NA	NA
5. P	C1DEA4	GTPase Obg	3.27e-01	7.88e-03	NA	NA
5. P	A4XY28	GTPase Der	8.11e-03	1.80e-02	NA	NA
5. P	B7ME26	tRNA 2-selenouridine synthase	1.19e-01	4.70e-02	NA	NA
5. P	Q5LYR4	GTPase Obg	1.55e-01	2.86e-03	NA	NA
5. P	P57812	GTPase Der	1.01e-02	1.27e-04	NA	NA
5. P	A7ZIR0	tRNA 2-selenouridine synthase	1.08e-01	4.04e-02	NA	NA
5. P	Q9WXV3	GTPase Obg	4.65e-02	2.14e-03	NA	NA
5. P	Q9KVY5	tRNA modification GTPase MnmE	8.28e-02	1.48e-02	NA	NA
5. P	B9DSH7	GTPase Obg	1.65e-01	1.23e-03	NA	NA
5. P	B5XZP4	tRNA modification GTPase MnmE	8.89e-02	2.86e-02	NA	NA
5. P	A9VIR5	GTPase Obg	1.29e-01	8.52e-04	NA	NA
5. P	P61323	HPr kinase/phosphorylase	1.45e-01	1.40e-02	NA	NA
5. P	A8A6G8	tRNA modification GTPase MnmE	2.81e-01	4.70e-02	NA	NA
5. P	Q04KK7	GTPase Obg	2.88e-01	4.88e-02	NA	NA
5. P	Q72ZY5	GTPase Obg	1.24e-01	2.04e-03	NA	NA
5. P	B2V3Z1	GTPase Der	2.48e-02	3.51e-03	NA	NA
5. P	A9BK05	GTPase Obg	4.64e-02	1.02e-04	NA	NA
5. P	A8Z2H2	GTPase Obg	1.01e-01	1.36e-04	NA	NA
5. P	B7GIR2	GTPase Obg	1.56e-01	4.02e-04	NA	NA
5. P	Q817U6	GTPase Obg	1.33e-01	2.86e-03	NA	NA
5. P	Q2S9T3	GTPase Obg	1.26e-01	2.70e-02	NA	NA
5. P	C0ZAL7	GTPase Obg	1.34e-01	3.07e-03	NA	NA
5. P	Q661B2	GTPase Der	1.62e-02	2.13e-02	NA	NA
5. P	B1X9T5	tRNA modification GTPase MnmE	9.46e-02	4.74e-02	NA	NA
5. P	B2S3Y1	GTPase Obg	2.79e-01	1.25e-02	NA	NA
5. P	Q9KUS8	GTPase Obg/CgtA	2.55e-01	2.72e-03	NA	NA
5. P	Q21DG1	tRNA modification GTPase MnmE	8.72e-02	3.24e-02	NA	NA
5. P	A8GUF3	tRNA modification GTPase MnmE	1.18e-01	5.77e-03	NA	NA
5. P	B9DJN0	HPr kinase/phosphorylase	1.16e-01	3.67e-02	NA	NA
5. P	Q92SA6	ADP-polyphosphate phosphotransferase 1	1.75e-01	4.27e-02	NA	NA
5. P	Q3K046	GTPase Obg	1.52e-01	8.79e-03	NA	NA
5. P	B6I3T9	tRNA modification GTPase MnmE	9.97e-02	4.74e-02	NA	NA
5. P	Q4ZYK5	tRNA 2-selenouridine synthase	2.05e-01	3.47e-02	NA	NA
5. P	B9DNV9	GTPase Der	7.84e-03	4.15e-02	NA	NA
5. P	Q8EWA5	HPr kinase/phosphorylase	9.10e-02	1.64e-03	NA	NA
5. P	Q9JV91	HPr kinase/phosphorylase	2.74e-01	7.19e-04	NA	NA
5. P	B3QZ96	GTPase Der	1.22e-02	1.24e-02	NA	NA
5. P	B1HVB2	GTPase Obg	1.43e-01	2.45e-03	NA	NA
5. P	Q7MAX1	tRNA modification GTPase MnmE	1.11e-01	2.89e-02	NA	NA
5. P	Q82Y30	HPr kinase/phosphorylase	1.22e-01	1.34e-02	NA	NA
5. P	B2SF94	GTPase Der	8.81e-03	2.83e-03	NA	NA
5. P	B0S8M8	HPr kinase/phosphorylase	2.21e-01	1.33e-02	NA	NA
5. P	Q99Z94	GTPase Obg	2.16e-01	2.19e-03	NA	NA
5. P	Q7A584	GTPase Obg	1.10e-01	1.36e-04	NA	NA
5. P	Q09700	Uncharacterized protein C2F7.09c	2.24e-02	1.51e-09	NA	NA
5. P	A7H029	GTPase Obg	2.18e-01	2.76e-02	NA	NA
5. P	A3QCG6	GTPase Der	4.43e-03	1.47e-02	NA	NA
5. P	Q03YT6	GTPase Obg	5.47e-01	6.19e-03	NA	NA
5. P	Q5WHS8	GTPase Obg	1.44e-01	3.51e-03	NA	NA
5. P	B5E4J4	GTPase Obg	1.75e-01	6.85e-03	NA	NA
5. P	C5DY82	Genetic interactor of prohibitins 3, mitochondrial	6.23e-02	4.05e-08	NA	NA
5. P	Q9UTE7	tRNA modification GTPase mss1, mitochondrial	1.35e-01	5.95e-03	NA	NA
5. P	B1JF57	GTPase Obg	3.44e-01	5.38e-03	NA	NA
5. P	P75215	GTPase Obg	1.57e-01	8.79e-03	NA	NA
5. P	A9M392	HPr kinase/phosphorylase	2.45e-01	1.12e-03	NA	NA
5. P	Q2YT86	GTPase Obg	1.42e-01	3.46e-04	NA	NA
5. P	Q1RF31	tRNA 2-selenouridine synthase	1.09e-01	4.70e-02	NA	NA
5. P	B7N958	tRNA 2-selenouridine synthase	1.18e-01	3.06e-02	NA	NA
5. P	B7UV78	tRNA 2-selenouridine synthase	1.53e-01	3.09e-02	NA	NA
5. P	Q02GB1	GTPase Obg	3.48e-01	2.21e-03	NA	NA
5. P	Q11QK1	GTPase Der	9.08e-03	1.44e-03	NA	NA
5. P	A6VBV3	GTPase Obg	3.09e-01	6.85e-03	NA	NA
5. P	Q043W1	GTPase Obg	6.61e-02	4.31e-02	NA	NA
5. P	Q1CK87	GTPase Der	8.81e-03	5.10e-04	NA	NA
5. P	B5Y805	GTPase Obg	8.01e-02	1.08e-05	NA	NA
5. P	B1XT35	GTPase Obg	2.55e-01	3.81e-03	NA	NA
5. P	C3L0M1	GTPase Der	1.08e-02	5.77e-03	NA	NA
5. P	B0KPF4	tRNA 2-selenouridine synthase	1.81e-01	8.96e-03	NA	NA
5. P	Q9I7M2	GTP-binding protein 10 homolog	2.50e-01	9.33e-03	NA	NA
5. P	Q92KW1	tRNA modification GTPase MnmE	9.93e-02	1.50e-02	NA	NA
5. P	B1N057	GTPase Obg	2.08e-01	1.91e-03	NA	NA
5. P	Q4V399	Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial	8.02e-03	3.20e-04	NA	NA
5. P	C1FSU2	GTPase Der	1.11e-02	3.97e-03	NA	NA
5. P	B8I179	GTPase Obg	8.22e-02	1.44e-04	NA	NA
5. P	A4VUC8	GTPase Obg	1.68e-01	3.54e-02	NA	NA
5. P	A7N0X8	tRNA modification GTPase MnmE	6.56e-02	3.31e-02	NA	NA
5. P	Q980M3	GTPase HflX	3.59e-02	6.13e-03	NA	NA
5. P	Q6BMA8	Genetic interactor of prohibitins 3, mitochondrial	1.07e-01	1.99e-05	NA	NA
5. P	A1W581	GTPase Der	1.12e-02	7.13e-03	NA	NA
5. P	B2S3I2	HPr kinase/phosphorylase	2.09e-01	2.21e-02	NA	NA
5. P	Q3AF51	GTPase Obg	2.20e-01	1.04e-02	NA	NA
5. P	A0KJ48	GTPase Der	6.23e-03	6.05e-05	NA	NA
5. P	B7VID5	GTPase Obg	2.22e-01	3.28e-02	NA	NA
5. P	C4ZD63	GTPase Der	5.41e-03	1.53e-02	NA	NA
5. P	A2RE30	GTPase Obg	1.40e-01	1.44e-03	NA	NA
5. P	A1RY30	GTPase HflX	3.08e-02	4.23e-06	NA	NA
5. P	Q2NQ72	tRNA modification GTPase MnmE	7.13e-02	3.71e-02	NA	NA
5. P	Q0AWJ4	GTPase Obg	1.85e-01	1.74e-03	NA	NA
5. P	Q8EPQ0	GTPase Obg	1.79e-01	4.05e-03	NA	NA
5. P	A8G8Z4	GTPase Obg	1.96e-01	4.00e-02	NA	NA
5. P	A9IFF9	GTPase Obg	2.73e-01	4.27e-02	NA	NA
5. P	Q1AVU3	GTPase Obg	3.21e-02	3.31e-05	NA	NA
5. P	A7MGU7	GTPase Der	1.09e-02	5.54e-03	NA	NA
5. P	Q66GP9	NO-associated protein 1, chloroplastic/mitochondrial	5.25e-03	1.51e-02	NA	NA
5. P	B0KMF6	GTPase Obg	3.40e-01	6.78e-03	NA	NA
5. P	A4SMM2	tRNA 2-selenouridine synthase	1.33e-01	2.61e-03	NA	NA
5. P	Q98QK8	GTPase Obg	1.08e-01	2.58e-02	NA	NA
5. P	A5FP49	GTPase Obg	4.51e-02	2.21e-03	NA	NA
5. P	A4D1E9	GTP-binding protein 10	2.19e-01	4.93e-05	NA	NA
5. P	Q5HFB9	GTPase Obg	1.05e-01	1.00e-04	NA	NA
5. P	B9E021	GTPase Obg	4.68e-02	1.70e-04	NA	NA
5. P	Q81LF0	GTPase Obg	1.55e-01	3.14e-03	NA	NA
5. P	Q2NIK0	GTPase Obg	8.25e-02	1.52e-04	NA	NA
5. P	Q2N6I9	tRNA modification GTPase MnmE	8.39e-02	1.43e-02	NA	NA
5. P	B2TUS2	tRNA modification GTPase MnmE	8.42e-02	4.74e-02	NA	NA
5. P	A6TCD0	GTPase Der	6.86e-03	2.36e-04	NA	NA
5. P	C4Z0C8	GTPase Der	1.00e-02	1.01e-02	NA	NA
5. P	B9DNE7	GTPase Obg	1.27e-01	7.26e-04	NA	NA
5. P	Q03QP2	GTPase Obg	1.95e-01	3.17e-03	NA	NA
5. P	B0C1P2	GTPase Der	1.18e-02	3.40e-02	NA	NA
5. P	Q83NP1	GTPase Obg	2.12e-01	1.22e-02	NA	NA
5. P	Q1JBB7	GTPase Obg	2.25e-01	1.80e-03	NA	NA
5. P	Q8Y6Z3	GTPase Obg	2.01e-01	2.89e-02	NA	NA
5. P	A6U2B2	GTPase Obg	1.24e-01	1.36e-04	NA	NA
5. P	A0ALG7	HPr kinase/phosphorylase	2.14e-01	4.57e-02	NA	NA
5. P	B3WE52	GTPase Obg	1.58e-01	1.60e-02	NA	NA
5. P	Q5JGB4	GTPase HflX	2.58e-02	1.23e-09	NA	NA
5. P	B7HQJ8	GTPase Obg	1.33e-01	2.83e-03	NA	NA
5. P	A7NAB1	GTPase Der	5.00e-03	2.95e-03	NA	NA
5. P	Q9PLM3	GTPase Der	4.76e-02	8.20e-03	NA	NA
5. P	C1A8T3	GTPase Der	2.47e-02	8.79e-03	NA	NA
5. P	A9R7Z8	GTPase Der	8.33e-03	5.10e-04	NA	NA
5. P	C4QZZ7	Genetic interactor of prohibitins 3, mitochondrial	3.86e-02	2.51e-05	NA	NA
5. P	Q4ZX19	GTPase Der	1.26e-02	2.19e-02	NA	NA
5. P	Q1LU74	GTPase Der	2.74e-03	1.33e-03	NA	NA
5. P	Q3MHG6	GTP-binding protein 10	1.92e-01	1.32e-05	NA	NA
5. P	Q8RBA5	GTPase Obg	1.31e-01	1.83e-03	NA	NA
5. P	Q9Z873	GTPase HflX	1.94e-02	5.59e-05	NA	NA
5. P	P52640	Small ribosomal subunit biogenesis GTPase RsgA	9.39e-03	3.65e-04	NA	NA
5. P	Q5L4W4	GTPase Der	1.54e-02	2.26e-04	NA	NA
5. P	A9AXD9	GTPase Obg	1.20e-01	4.57e-02	NA	NA
5. P	Q2RKZ8	GTPase Obg	1.49e-01	2.34e-02	NA	NA
5. P	A4YJT5	tRNA modification GTPase MnmE	1.32e-01	3.98e-04	NA	NA
5. P	A4IXH0	GTPase Der	7.19e-03	2.48e-03	NA	NA
5. P	B0KPJ1	GTPase Der	2.34e-02	2.89e-02	NA	NA
5. P	B9LC30	GTPase Obg	2.58e-01	2.98e-03	NA	NA
5. P	A9BMU9	GTPase Der	8.30e-03	2.04e-02	NA	NA
5. P	A9A623	GTPase HflX	1.07e-02	7.94e-05	NA	NA
5. P	Q4A6N4	GTPase Obg	1.04e-01	2.04e-02	NA	NA
5. P	Q5ADV5	Genetic interactor of prohibitins 3, mitochondrial	2.08e-01	2.37e-05	NA	NA
5. P	B9IZ16	GTPase Obg	1.45e-01	4.44e-03	NA	NA
5. P	Q67SC6	GTPase Obg	1.60e-01	1.02e-04	NA	NA
5. P	A4TMT3	GTPase Der	7.75e-03	5.10e-04	NA	NA
5. P	B0JFL6	GTPase Der	1.94e-02	7.49e-03	NA	NA
5. P	B1M0E0	tRNA modification GTPase MnmE	5.20e-02	2.27e-02	NA	NA
5. P	Q5F5D9	GTPase Obg	2.75e-01	1.52e-03	NA	NA
5. P	A5IKX2	GTPase Obg	3.53e-02	4.22e-03	NA	NA
5. P	P0DB52	GTPase Obg	1.71e-01	3.04e-03	NA	NA
5. P	A1A8G9	tRNA 2-selenouridine synthase	9.57e-02	4.70e-02	NA	NA
5. P	B0T6E0	tRNA modification GTPase MnmE	1.14e-01	6.78e-03	NA	NA
5. P	B7HE73	GTPase Obg	1.36e-01	2.75e-03	NA	NA
5. P	Q5XBM1	GTPase Obg	1.31e-01	3.07e-03	NA	NA
5. P	Q9RE09	HPr kinase/phosphorylase	1.93e-01	3.14e-03	NA	NA
5. P	A0M5P1	GTPase Der	1.56e-02	4.79e-02	NA	NA
5. P	Q0I442	GTPase HflX	4.97e-02	1.27e-06	NA	NA
5. P	B2V0A8	GTPase Obg	9.35e-02	2.08e-03	NA	NA
5. P	Q2JS78	GTPase Obg	4.17e-01	1.02e-02	NA	NA
5. P	B3QZT1	GTPase Obg	9.13e-02	2.11e-04	NA	NA
5. P	C5MHQ6	Genetic interactor of prohibitins 3, mitochondrial	8.66e-02	4.44e-06	NA	NA
5. P	Q8DK79	Small ribosomal subunit biogenesis GTPase RsgA	1.76e-02	6.06e-06	NA	NA
5. P	A8YUC7	HPr kinase/phosphorylase	9.19e-02	4.81e-03	NA	NA
5. P	Q7MYX6	GTPase Obg	3.12e-01	1.44e-02	NA	NA
5. P	Q7MW55	GTPase Obg	2.36e-01	2.08e-02	NA	NA
5. P	Q6HD85	GTPase Obg	1.35e-01	3.93e-03	NA	NA
5. P	B4EZS9	GTPase Der	9.40e-03	1.25e-03	NA	NA
5. P	A9I3Z9	tRNA 2-selenouridine synthase	2.08e-01	4.04e-02	NA	NA
5. P	A0RJ47	GTPase Obg	1.22e-01	3.93e-03	NA	NA
5. P	B2G5Z2	HPr kinase/phosphorylase	1.01e-01	2.27e-02	NA	NA
5. P	Q2A515	GTPase Der	8.93e-03	2.95e-03	NA	NA
5. P	Q3SWH5	tRNA modification GTPase MnmE	8.22e-02	1.16e-03	NA	NA
5. P	B7LJH5	tRNA 2-selenouridine synthase	1.13e-01	4.52e-02	NA	NA
5. P	Q02XY2	GTPase Obg	2.45e-01	5.01e-03	NA	NA
5. P	Q6G1K8	tRNA modification GTPase MnmE	9.01e-02	1.69e-03	NA	NA
5. P	B9MRB8	GTPase Obg	4.66e-02	1.76e-03	NA	NA
5. P	Q97QW8	GTPase Obg	1.74e-01	6.85e-03	NA	NA
5. P	A4W0M2	GTPase Obg	1.73e-01	2.78e-02	NA	NA
5. P	Q49Y82	GTPase Obg	1.01e-01	3.10e-04	NA	NA
5. P	Q9K081	HPr kinase/phosphorylase	3.20e-01	7.19e-04	NA	NA
5. P	B7UMH3	tRNA modification GTPase MnmE	9.30e-02	4.65e-02	NA	NA
5. P	B2UPE7	GTPase HflX	1.45e-02	1.10e-03	NA	NA
5. P	A7GGA7	GTPase Der	1.04e-02	2.77e-03	NA	NA
5. P	A7Z781	GTPase Obg	1.59e-01	3.34e-03	NA	NA
5. P	Q6G8S5	GTPase Obg	1.55e-01	1.36e-04	NA	NA
5. P	P20964	GTPase Obg	2.16e-01	9.27e-04	NA	NA
5. P	B2K9P6	GTPase Der	8.20e-03	8.43e-04	NA	NA
5. P	A6UEE9	tRNA modification GTPase MnmE	1.11e-01	3.71e-02	NA	NA
5. P	Q7A0Q3	GTPase Obg	1.04e-01	1.36e-04	NA	NA
5. P	A9WK62	GTPase Obg	2.16e-01	2.98e-03	NA	NA
5. P	B7V0A9	GTPase Obg	3.40e-01	2.21e-03	NA	NA
5. P	A2RJQ6	GTPase Obg	2.72e-01	7.49e-03	NA	NA
5. P	Q7MP92	GTPase Obg	2.32e-01	3.15e-02	NA	NA
5. P	A1KWG2	GTPase Obg	2.65e-01	2.80e-03	NA	NA
5. P	Q0TKD8	tRNA 2-selenouridine synthase	1.48e-01	4.57e-02	NA	NA
5. P	A9KMF5	GTPase Obg	1.27e-01	1.92e-05	NA	NA
5. P	B2TK70	GTPase Obg	9.80e-02	4.94e-04	NA	NA
5. P	P0DB53	GTPase Obg	9.55e-02	3.04e-03	NA	NA
5. P	Q7MT48	GTPase Der	1.20e-02	1.10e-02	NA	NA
5. P	A5D410	GTPase Obg	1.16e-01	9.18e-04	NA	NA
5. P	O83724	GTPase Obg	2.78e-01	1.25e-02	NA	NA
5. P	C1ETN7	GTPase Obg	1.32e-01	3.93e-03	NA	NA
5. P	Q6FYB8	tRNA modification GTPase MnmE	6.04e-02	2.86e-03	NA	NA
5. P	Q5M3C8	GTPase Obg	2.15e-01	2.86e-03	NA	NA
5. P	Q6YRC6	GTPase Obg	1.31e-01	1.21e-03	NA	NA
5. P	A4G8R4	GTPase Obg	2.02e-01	2.55e-02	NA	NA
5. P	A9NF57	GTPase Obg	2.06e-01	4.35e-03	NA	NA
5. P	Q5SHE9	GTPase Obg	8.95e-02	3.02e-05	NA	NA
5. P	A6TG09	tRNA modification GTPase MnmE	8.98e-02	3.47e-02	NA	NA
5. P	Q9JXE5	GTPase Obg	3.08e-01	4.39e-03	NA	NA
5. P	Q3BLZ9	tRNA modification GTPase MnmE	4.90e-02	2.76e-02	NA	NA
5. P	Q8RAS5	GTPase HflX	2.68e-02	1.91e-04	NA	NA
5. P	A7GWZ2	GTPase Der	1.64e-02	1.37e-02	NA	NA
5. P	A8MHK8	GTPase Obg	4.32e-02	7.88e-03	NA	NA
5. P	B0SR57	HPr kinase/phosphorylase	2.23e-01	1.33e-02	NA	NA
5. P	Q6MTG9	GTPase Obg	1.62e-01	7.42e-04	NA	NA
5. P	A7HJZ8	GTPase Obg	8.94e-02	1.06e-03	NA	NA
5. P	Q0BWA8	tRNA modification GTPase MnmE	1.07e-01	2.78e-02	NA	NA
5. P	Q83MU8	GTPase Obg	1.63e-01	2.35e-03	NA	NA
5. P	B2IQ29	GTPase Obg	2.79e-01	4.88e-02	NA	NA
5. P	B8GA36	GTPase Obg	2.03e-01	4.72e-03	NA	NA
5. P	E7QKV3	Genetic interactor of prohibitins 3, mitochondrial	NA	8.67e-10	NA	NA
5. P	Q6F0U3	GTPase Obg	1.51e-01	7.49e-03	NA	NA
5. P	Q1JGD5	GTPase Obg	1.62e-01	2.45e-03	NA	NA
5. P	B8CXZ0	GTPase Obg	9.51e-02	2.49e-06	NA	NA
5. P	A5VIG4	HPr kinase/phosphorylase	9.95e-02	2.27e-02	NA	NA
5. P	B1ILY5	GTPase Obg	4.42e-02	2.57e-04	NA	NA
5. P	Q3ZAJ2	GTPase Obg	9.58e-02	8.34e-04	NA	NA
5. P	A4T0N1	tRNA modification GTPase MnmE	1.56e-01	4.08e-02	NA	NA
5. P	A7GHK2	GTPase Obg	4.74e-02	1.85e-04	NA	NA
5. P	Q7CW97	GTPase Obg	7.29e-02	2.92e-02	NA	NA
5. P	Q4K5T8	GTPase Obg	3.77e-01	7.80e-03	NA	NA
5. P	Q03JJ8	GTPase Obg	1.36e-01	2.86e-03	NA	NA
5. P	Q1IW72	GTPase Obg	7.95e-02	2.01e-03	NA	NA
5. P	Q5U528	GTP-binding protein 10	2.40e-01	2.21e-02	NA	NA
5. P	Q5M8V6	GTP-binding protein 10	1.87e-01	1.57e-02	NA	NA
5. P	O83600	HPr kinase/phosphorylase	1.81e-01	1.45e-02	NA	NA
5. P	Q8RGV7	GTPase Der	1.43e-02	5.99e-04	NA	NA
5. P	A4SNZ8	GTPase Der	6.92e-03	1.03e-04	NA	NA
5. P	Q5X0M3	tRNA modification GTPase MnmE	1.57e-01	4.15e-02	NA	NA
5. P	Q18B27	GTPase Obg	8.52e-02	4.58e-03	NA	NA
5. P	B7L851	tRNA modification GTPase MnmE	1.25e-01	4.70e-02	NA	NA
5. P	A8F478	GTPase Obg	7.11e-02	9.27e-04	NA	NA
5. P	B8HQE1	GTPase Der	1.27e-02	1.31e-02	NA	NA
5. P	Q4ZYK1	GTPase Obg	2.94e-01	1.72e-02	NA	NA
5. P	A2SHB1	GTPase Der	1.32e-02	2.89e-03	NA	NA
5. P	Q886Y6	GTPase Der	9.84e-03	1.40e-02	NA	NA
5. P	Q928B0	HPr kinase/phosphorylase	2.00e-01	4.12e-02	NA	NA
5. P	A5DDR3	Genetic interactor of prohibitins 3, mitochondrial	1.77e-01	9.99e-04	NA	NA
5. P	Q6KHM2	GTPase Obg	1.94e-01	1.11e-04	NA	NA
5. P	A4YUE1	GTPase Der	1.93e-01	1.38e-03	NA	NA
5. P	C0MDB4	GTPase Obg	2.21e-01	6.38e-03	NA	NA
5. P	A5E047	Genetic interactor of prohibitins 3, mitochondrial	1.75e-01	7.64e-03	NA	NA
5. P	A5ITG8	GTPase Obg	8.61e-02	1.36e-04	NA	NA
5. P	C0MBS1	GTPase Obg	2.23e-01	2.53e-02	NA	NA
5. P	Q3K9R2	tRNA 2-selenouridine synthase	2.28e-01	4.77e-03	NA	NA
5. P	Q48NL2	GTPase Obg	3.49e-01	1.72e-02	NA	NA
5. P	B8FUR9	GTPase Obg	1.01e-01	6.12e-04	NA	NA
5. P	Q1GP64	tRNA modification GTPase MnmE	9.42e-02	7.99e-04	NA	NA
5. P	Q24SP0	GTPase Obg	1.14e-01	7.19e-04	NA	NA
5. P	Q05473	MIOREX complex component 8	1.35e-01	9.42e-03	NA	NA
5. P	A7X361	GTPase Obg	1.01e-01	1.36e-04	NA	NA
5. P	A7FXU6	GTPase Obg	3.84e-02	1.73e-04	NA	NA
5. P	Q5KWP5	GTPase Obg	1.57e-01	1.13e-02	NA	NA
5. P	Q3AFV0	GTPase HflX	2.85e-02	5.63e-09	NA	NA
5. P	P0CAX2	tRNA modification GTPase MnmE	9.40e-02	2.66e-03	NA	NA
5. P	B3ETF1	GTPase Der	1.03e-02	1.32e-02	NA	NA
5. P	Q89WP4	tRNA modification GTPase MnmE	8.60e-02	1.41e-02	NA	NA
5. P	B1XXK9	GTPase Der	1.13e-02	1.10e-03	NA	NA
5. P	Q6GG60	GTPase Obg	9.89e-02	9.19e-05	NA	NA
5. P	B8DHL1	GTPase Obg	2.10e-01	2.48e-02	NA	NA
5. P	Q2FG83	GTPase Obg	1.50e-01	1.36e-04	NA	NA
5. P	C1F407	GTPase HflX	1.08e-01	3.85e-04	NA	NA
5. P	Q8DPV8	GTPase Obg	2.00e-01	4.88e-02	NA	NA
5. P	A5E8G7	tRNA modification GTPase MnmE	1.28e-01	3.51e-03	NA	NA
5. P	C1DNN5	tRNA 2-selenouridine synthase	2.00e-01	3.74e-02	NA	NA
5. P	Q14GT5	GTPase Der	6.06e-03	1.55e-03	NA	NA
5. P	A7FFZ3	GTPase Der	7.43e-03	5.10e-04	NA	NA
5. P	B5XLZ0	GTPase Obg	8.69e-02	1.80e-03	NA	NA
5. P	Q9HVL8	GTPase Obg	3.33e-01	2.21e-03	NA	NA
5. P	Q1WT46	GTPase Obg	1.33e-01	4.99e-04	NA	NA
5. P	Q8XIJ2	GTPase Obg	1.04e-01	4.11e-04	NA	NA
5. P	Q0SR54	GTPase Obg	9.11e-02	4.11e-04	NA	NA
5. P	Q2FXT1	GTPase Obg	1.31e-01	1.36e-04	NA	NA
5. P	Q71ZD3	GTPase Obg	1.93e-01	2.89e-02	NA	NA
5. P	A1KSZ9	HPr kinase/phosphorylase	2.60e-01	1.40e-03	NA	NA
5. P	Q1QRZ0	tRNA modification GTPase MnmE	1.21e-01	1.59e-04	NA	NA
5. P	Q0A4L6	tRNA modification GTPase MnmE	7.79e-02	8.28e-03	NA	NA
5. P	B1VAF2	GTPase Obg	1.61e-01	4.99e-04	NA	NA
5. P	A9H253	GTPase HflX	4.53e-02	6.33e-05	NA	NA
5. P	A0KKE6	tRNA 2-selenouridine synthase	1.36e-01	3.01e-02	NA	NA
5. P	Q602A7	GTPase Obg	2.01e-01	6.99e-03	NA	NA
5. P	Q9KDK0	GTPase Obg	1.94e-01	1.71e-03	NA	NA
5. P	A6TQJ6	GTPase Obg	3.77e-02	3.89e-04	NA	NA
5. P	O51461	GTPase Der	2.63e-02	3.57e-02	NA	NA
5. P	A0AIY6	GTPase Obg	2.04e-01	2.68e-02	NA	NA
5. P	A8FT74	GTPase Der	6.22e-03	1.40e-03	NA	NA
5. P	B1KZR3	GTPase Obg	4.32e-02	6.32e-04	NA	NA
5. P	B7JQ26	GTPase Obg	1.29e-01	3.97e-03	NA	NA
5. P	Q04EZ8	GTPase Obg	1.68e-01	2.12e-03	NA	NA
5. P	A9M061	GTPase Obg	1.76e-01	3.93e-03	NA	NA
5. P	Q58526	GTPase HflX	2.24e-02	2.52e-09	NA	NA
5. P	Q03AM8	HPr kinase/phosphorylase	1.92e-01	3.14e-03	NA	NA
5. P	B9MFY0	GTPase Der	1.54e-02	1.14e-02	NA	NA
5. P	A3PNS7	tRNA modification GTPase MnmE	9.05e-02	1.23e-02	NA	NA
5. P	D9R4W7	GTPase HflX	6.24e-02	4.39e-06	NA	NA
5. P	Q31GV5	tRNA 2-selenouridine synthase	9.16e-02	1.89e-02	NA	NA
5. P	B7M559	tRNA modification GTPase MnmE	8.25e-02	4.74e-02	NA	NA
5. P	A1TWI4	tRNA modification GTPase MnmE	1.48e-01	4.15e-02	NA	NA
5. P	Q1RKJ6	tRNA modification GTPase MnmE	1.13e-01	8.53e-03	NA	NA
5. P	Q48SX8	GTPase Obg	2.12e-01	3.77e-03	NA	NA
5. P	B1IBL9	GTPase Obg	1.62e-01	6.71e-03	NA	NA
5. P	B4U3Q7	GTPase Obg	2.98e-01	6.26e-03	NA	NA
5. P	Q5WDH1	HPr kinase/phosphorylase	9.27e-02	2.61e-03	NA	NA
5. P	A6LQR9	GTPase Obg	1.03e-01	8.04e-03	NA	NA
5. P	B0JW21	Small ribosomal subunit biogenesis GTPase RsgA	5.97e-03	2.20e-07	NA	NA
5. P	Q1C5J2	GTPase Der	8.18e-03	5.10e-04	NA	NA
5. P	A6LSK4	Small ribosomal subunit biogenesis GTPase RsgA	9.62e-03	2.46e-02	NA	NA
5. P	B4RQP4	GTPase Obg	3.06e-01	1.52e-03	NA	NA
5. P	Q5LU04	NDP-polyphosphate phosphotransferase 2	1.31e-01	1.37e-02	NA	NA
5. P	A1WE12	GTPase Der	1.04e-02	3.64e-02	NA	NA
5. P	Q85FG3	Probable tRNA modification GTPase MnmE	1.18e-01	2.06e-02	NA	NA
5. P	A5UZ80	GTPase Obg	2.49e-01	2.27e-02	NA	NA
5. P	B6YQB9	GTPase Der	1.53e-02	1.53e-02	NA	NA
5. P	Q2NS44	GTPase Der	5.27e-03	4.67e-03	NA	NA
5. P	Q256C5	GTPase Der	3.72e-02	1.83e-03	NA	NA
5. P	Q0SYP6	tRNA modification GTPase MnmE	1.03e-01	4.83e-02	NA	NA
5. P	A6H294	GTPase HflX	1.47e-02	5.60e-07	NA	NA
5. P	B5YEQ1	GTPase Obg	1.16e-01	5.80e-04	NA	NA
5. P	Q9RY66	GTPase Obg	7.44e-02	6.46e-04	NA	NA
5. P	Q634A3	GTPase Obg	1.41e-01	3.93e-03	NA	NA
5. P	Q5ZR82	tRNA modification GTPase MnmE	2.23e-01	2.78e-02	NA	NA
5. P	Q2SRV9	GTPase Obg	3.61e-01	7.42e-04	NA	NA
5. P	Q821L7	GTPase Der	4.71e-02	9.42e-03	NA	NA
5. P	A5IYU8	GTPase Obg	1.89e-01	1.89e-02	NA	NA
5. P	A6LJZ0	GTPase Obg	5.86e-02	1.50e-04	NA	NA
5. P	Q88Q08	GTPase Obg	3.49e-01	5.60e-03	NA	NA
5. P	B1YJR9	GTPase Obg	2.27e-01	2.29e-05	NA	NA
5. P	A4XYL2	GTPase Obg	3.45e-01	2.19e-03	NA	NA
5. P	Q87SU2	GTPase Obg	2.56e-01	4.36e-02	NA	NA
5. P	Q31UW0	tRNA modification GTPase MnmE	8.66e-02	4.74e-02	NA	NA
5. P	Q039J3	GTPase Obg	1.26e-01	1.34e-02	NA	NA
5. P	Q1J652	GTPase Obg	1.44e-01	2.75e-03	NA	NA
5. P	P47624	GTPase Obg	2.17e-01	1.19e-02	NA	NA
5. P	A1IPH6	GTPase Obg	2.70e-01	4.35e-03	NA	NA
5. P	C4YPB0	Genetic interactor of prohibitins 3, mitochondrial	1.86e-01	2.48e-05	NA	NA
5. P	B7IGK8	GTPase Obg	4.10e-02	9.05e-03	NA	NA
5. P	Q5FL72	HPr kinase/phosphorylase	9.23e-02	9.80e-03	NA	NA
5. P	Q1IF13	GTPase Obg	3.75e-01	4.77e-03	NA	NA
5. P	Q5L4W0	tRNA modification GTPase MnmE	1.01e-01	2.27e-02	NA	NA
5. P	A6WX76	tRNA modification GTPase MnmE	1.17e-01	1.14e-02	NA	NA
5. P	A7HZI3	GTPase Der	2.71e-02	4.88e-02	NA	NA
5. P	Q8RHS8	GTPase Obg	6.71e-02	3.41e-03	NA	NA
5. P	Q7NB30	GTPase Obg	1.37e-01	2.95e-03	NA	NA
5. P	Q9CF94	GTPase Obg	2.21e-01	4.36e-02	NA	NA
5. P	Q8NM65	Polyphosphate kinase PPK2B	1.16e-01	4.61e-02	NA	NA
5. P	A4XV44	tRNA 2-selenouridine synthase	1.17e-01	3.31e-02	NA	NA
5. P	Q5F9S6	HPr kinase/phosphorylase	2.67e-01	9.08e-04	NA	NA
5. P	C5DEU6	Genetic interactor of prohibitins 3, mitochondrial	2.03e-02	1.56e-08	NA	NA
5. P	Q3ZW89	GTPase Obg	8.09e-02	2.21e-03	NA	NA
5. P	Q92BH7	GTPase Obg	1.98e-01	3.18e-02	NA	NA
5. P	B0TYD1	tRNA modification GTPase MnmE	1.77e-01	4.52e-02	NA	NA
5. P	C4ZYY4	tRNA modification GTPase MnmE	8.75e-02	4.74e-02	NA	NA
5. P	Q834V4	GTPase Obg	1.75e-01	5.66e-03	NA	NA
5. P	Q6CLQ8	Genetic interactor of prohibitins 3, mitochondrial	1.47e-02	3.56e-08	NA	NA
5. P	B8E0B2	GTPase Obg	1.34e-01	1.78e-03	NA	NA
5. P	A7NRU6	GTPase Obg	2.35e-01	8.04e-03	NA	NA
5. P	A8YV14	GTPase Obg	5.37e-02	3.03e-02	NA	NA
5. P	Q2J357	tRNA modification GTPase MnmE	1.05e-01	2.60e-02	NA	NA
5. P	Q4L6Y9	GTPase Obg	1.24e-01	1.31e-05	NA	NA
5. P	A6H103	GTPase Der	1.63e-02	3.47e-02	NA	NA
5. P	E0RQS7	GTPase HflX	1.90e-02	1.16e-07	NA	NA
5. P	Q03F34	GTPase Obg	1.54e-01	1.67e-03	NA	NA
5. P	Q2K2S0	tRNA modification GTPase MnmE	1.64e-01	6.99e-03	NA	NA
6. F	Q8SUT1	Guanine nucleotide-binding protein-like 3-like protein	7.73e-11	NA	NA	0.5988
6. F	Q2RK09	Small ribosomal subunit biogenesis GTPase RsgA	1.01e-02	NA	NA	0.335
7. B	C5D3F4	GTPase Der	8.41e-03	NA	0.027	NA
7. B	A8Z5X0	tRNA modification GTPase MnmE	3.87e-01	NA	0.035	NA
7. B	A0LJ92	GTPase Der	1.25e-02	NA	3.87e-05	NA
7. B	B3CR58	GTPase Der	9.26e-03	NA	6.07e-04	NA
7. B	A1APR8	GTPase Era	5.64e-02	NA	4.94e-04	NA
7. B	Q9KD52	GTPase Era	5.13e-02	NA	0.010	NA
7. B	Q0SRG1	GTPase Era	3.62e-02	NA	0.018	NA
7. B	A8GM60	Probable GTP-binding protein EngB	6.86e-02	NA	0.005	NA
7. B	B1L9N6	tRNA modification GTPase MnmE	1.44e-01	NA	0.015	NA
7. B	Q2SR47	tRNA modification GTPase MnmE	1.56e-01	NA	0.019	NA
7. B	Q8TYT5	Probable GTP-binding protein EngB	2.87e-02	NA	0.004	NA
7. B	Q48U21	Probable GTP-binding protein EngB	8.07e-02	NA	0.012	NA
7. B	B1YR40	GTPase Der	4.75e-03	NA	3.91e-06	NA
7. B	A9WHH9	GTPase Der	1.50e-02	NA	1.43e-04	NA
7. B	Q6LXQ9	Probable GTP-binding protein EngB	3.40e-02	NA	1.15e-05	NA
7. B	B8I736	GTPase Era	2.95e-02	NA	0.033	NA
7. B	Q9PQM5	Probable GTP-binding protein EngB	8.95e-02	NA	0.002	NA
7. B	O25396	Fe(2+) transporter FeoB	7.95e-02	NA	0.020	NA
7. B	Q9H089	Large subunit GTPase 1 homolog	2.56e-06	NA	2.81e-11	NA
7. B	A2BPL9	GTPase Der	5.69e-03	NA	0.010	NA
7. B	P64084	GTPase Era	3.95e-02	NA	0.013	NA
7. B	Q5WEP2	Probable GTP-binding protein EngB	5.14e-02	NA	0.006	NA
7. B	A4SGR9	tRNA modification GTPase MnmE	1.46e-01	NA	0.014	NA
7. B	Q038T2	GTPase Era	9.17e-02	NA	0.016	NA
7. B	A0AJ07	Probable GTP-binding protein EngB	4.19e-02	NA	0.023	NA
7. B	C3P591	GTPase Der	1.42e-02	NA	0.044	NA
7. B	B0RT56	GTPase Der	1.13e-02	NA	4.29e-05	NA
7. B	A4XN51	tRNA modification GTPase MnmE	1.84e-01	NA	0.026	NA
7. B	B1ZWP5	tRNA modification GTPase MnmE	2.32e-01	NA	0.006	NA
7. B	A4YWC7	GTPase Era	2.54e-02	NA	0.031	NA
7. B	A6U2E1	Probable GTP-binding protein EngB	6.98e-02	NA	0.041	NA
7. B	Q2FG63	Probable GTP-binding protein EngB	7.10e-02	NA	0.041	NA
7. B	B5ZYX3	GTPase Der	1.79e-02	NA	0.021	NA
7. B	B3Q9V3	GTPase Der	9.40e-03	NA	2.10e-04	NA
7. B	Q9PG37	GTPase Der	4.87e-03	NA	0.002	NA
7. B	B6J4J8	GTPase Era	5.10e-02	NA	0.030	NA
7. B	Q4L6I0	GTPase Der	1.50e-02	NA	0.029	NA
7. B	Q8P979	GTPase Der	3.56e-03	NA	4.29e-05	NA
7. B	A5G693	GTPase Era	3.52e-02	NA	2.74e-05	NA
7. B	B1AJ22	GTPase Der	8.56e-03	NA	0.026	NA
7. B	Q2YTB6	Probable GTP-binding protein EngB	6.60e-02	NA	0.041	NA
7. B	A5ITJ8	Probable GTP-binding protein EngB	6.76e-02	NA	0.041	NA
7. B	Q8EW66	GTPase Era	1.82e-02	NA	0.002	NA
7. B	B1YJV8	Probable GTP-binding protein EngB	5.17e-02	NA	0.013	NA
7. B	Q7V2S6	GTPase Der	6.45e-03	NA	0.003	NA
7. B	A0RBV9	GTPase Der	1.41e-02	NA	0.044	NA
7. B	Q9PB97	GTPase Era	4.18e-02	NA	0.005	NA
7. B	P64058	GTPase Der	1.55e-02	NA	0.042	NA
7. B	B7GH28	Probable GTP-binding protein EngB	8.44e-02	NA	0.004	NA
7. B	Q6G8Q2	Probable GTP-binding protein EngB	6.76e-02	NA	0.041	NA
7. B	B4SSW8	GTPase Der	1.37e-02	NA	0.002	NA
7. B	B1AI04	tRNA modification GTPase MnmE	1.22e-01	NA	0.008	NA
7. B	Q1RH06	Probable GTP-binding protein EngB	4.73e-02	NA	0.046	NA
7. B	Q9C923	Nuclear/nucleolar GTPase 2	9.36e-08	NA	6.60e-10	NA
7. B	B0U3D9	GTPase Era	4.93e-02	NA	0.005	NA
7. B	Q1J740	Probable GTP-binding protein EngB	8.13e-02	NA	0.029	NA
7. B	Q7U344	tRNA modification GTPase MnmE	7.58e-02	NA	0.007	NA
7. B	Q3AC25	Small ribosomal subunit biogenesis GTPase RsgA	3.09e-03	NA	0.014	NA
7. B	A8MG70	GTPase Era	2.90e-02	NA	0.015	NA
7. B	A6USY3	Probable GTP-binding protein EngB	4.44e-02	NA	0.001	NA
7. B	Q5H1R1	GTPase Era	3.47e-02	NA	0.008	NA
7. B	P64071	Probable GTP-binding protein EngB	7.09e-02	NA	0.041	NA
7. B	A5IIT6	GTPase Era	2.87e-02	NA	0.023	NA
7. B	Q92UK6	GTPase Der	1.69e-02	NA	0.012	NA
7. B	B9L7G9	GTPase Der	2.26e-02	NA	0.014	NA
7. B	Q5WHD9	GTPase Era	3.66e-02	NA	0.006	NA
7. B	Q603B5	GTPase Der	1.30e-02	NA	1.74e-05	NA
7. B	Q9SHS8	GTPase LSG1-1	7.86e-09	NA	1.43e-08	NA
7. B	Q6LW56	tRNA modification GTPase MnmE	1.14e-01	NA	0.004	NA
7. B	Q9WZV1	GTPase Era	2.59e-02	NA	0.013	NA
7. B	P0A3C1	GTPase Era	2.28e-02	NA	0.002	NA
7. B	Q8Y6X3	Probable GTP-binding protein EngB	4.11e-02	NA	0.023	NA
7. B	A5D451	Probable GTP-binding protein EngB	6.20e-02	NA	0.014	NA
7. B	Q3K0K1	Probable GTP-binding protein EngB	1.37e-01	NA	0.022	NA
7. B	A8ZU05	GTPase Der	1.54e-02	NA	4.35e-06	NA
7. B	Q4UKB0	GTPase Era	2.96e-02	NA	0.011	NA
7. B	Q6MEP0	Probable GTP-binding protein EngB	7.41e-02	NA	0.012	NA
7. B	B1MYE3	GTPase Era	3.60e-02	NA	0.019	NA
7. B	Q058F5	tRNA modification GTPase MnmE	8.51e-02	NA	0.030	NA
7. B	Q1QD14	GTPase Der	1.47e-02	NA	7.17e-04	NA
7. B	Q2RFI8	tRNA modification GTPase MnmE	1.49e-01	NA	0.009	NA
7. B	A5IC36	GTPase Der	1.31e-02	NA	0.003	NA
7. B	C0MA50	Probable GTP-binding protein EngB	8.01e-02	NA	0.028	NA
7. B	Q4UK70	tRNA modification GTPase MnmE	9.96e-02	NA	0.008	NA
7. B	Q6NY89	Large subunit GTPase 1 homolog	1.59e-06	NA	1.01e-09	NA
7. B	A9NFM5	Probable GTP-binding protein EngB	6.03e-02	NA	0.028	NA
7. B	Q4UNC2	Probable GTP-binding protein EngB	7.58e-02	NA	0.004	NA
7. B	Q1JC92	Probable GTP-binding protein EngB	8.33e-02	NA	0.020	NA
7. B	B7IDZ1	Probable GTP-binding protein EngB	8.50e-04	NA	0.016	NA
7. B	A6M3M5	tRNA modification GTPase MnmE	2.68e-01	NA	0.037	NA
7. B	Q74JL6	GTPase Der	1.02e-02	NA	6.32e-04	NA
7. B	A6TXE5	tRNA modification GTPase MnmE	1.01e-01	NA	0.003	NA
7. B	Q9K8F7	Probable GTP-binding protein EngB	5.17e-02	NA	0.018	NA
7. B	B9KRT2	GTPase Der	7.23e-03	NA	2.08e-04	NA
7. B	Q4UUM0	GTPase Der	9.78e-03	NA	4.29e-05	NA
7. B	Q63DM8	GTPase Der	8.50e-03	NA	0.044	NA
7. B	Q8RHA2	tRNA modification GTPase MnmE	2.10e-01	NA	0.005	NA
7. B	Q2FY06	GTPase Era	3.71e-02	NA	0.015	NA
7. B	Q5HNY0	GTPase Era	3.85e-02	NA	0.013	NA
7. B	A1TZQ4	GTPase Der	1.59e-02	NA	1.85e-04	NA
7. B	Q5HNN0	Probable GTP-binding protein EngB	6.91e-02	NA	0.019	NA
7. B	Q633X5	Probable GTP-binding protein EngB	6.43e-02	NA	0.001	NA
7. B	Q5ZV99	GTPase Der	1.29e-02	NA	0.003	NA
7. B	B1MYB5	GTPase Der	1.74e-02	NA	0.001	NA
7. B	Q81SW9	GTPase Der	1.83e-02	NA	0.044	NA
7. B	Q5FKR5	Probable GTP-binding protein EngB	7.47e-02	NA	0.043	NA
7. B	A7Z7A9	Probable GTP-binding protein EngB	4.99e-02	NA	0.013	NA
7. B	Q9A088	Probable GTP-binding protein EngB	8.11e-02	NA	0.020	NA
7. B	Q49Y10	GTPase Era	3.91e-02	NA	0.003	NA
7. B	A6U239	GTPase Era	3.58e-02	NA	0.013	NA
7. B	B7HQM9	Probable GTP-binding protein EngB	6.20e-02	NA	0.001	NA
7. B	Q6HL51	GTPase Der	1.35e-02	NA	0.044	NA
7. B	A1KT93	GTPase Der	1.85e-02	NA	0.020	NA
7. B	Q7M901	tRNA modification GTPase MnmE	6.59e-02	NA	0.023	NA
7. B	Q9EWW8	GTPase Der	1.48e-02	NA	2.64e-04	NA
7. B	B8CXI2	GTPase Era	2.28e-02	NA	0.019	NA
7. B	A8Z2J4	Probable GTP-binding protein EngB	6.91e-02	NA	0.041	NA
7. B	Q11KI3	GTPase Der	1.27e-02	NA	0.002	NA
7. B	C3P9F4	Probable GTP-binding protein EngB	5.20e-02	NA	0.001	NA
7. B	Q3JCW1	GTPase Der	1.23e-02	NA	1.44e-05	NA
7. B	B2SXS6	GTPase Der	9.28e-03	NA	2.88e-05	NA
7. B	Q5HF99	Probable GTP-binding protein EngB	6.54e-02	NA	0.041	NA
7. B	A8F732	tRNA modification GTPase MnmE	1.12e-01	NA	4.59e-04	NA
7. B	Q9C6I8	Nucleolar GTP-binding protein 1	3.00e-01	NA	0.008	NA
7. B	A7GN41	GTPase Der	1.08e-02	NA	0.011	NA
7. B	A2RF16	Probable GTP-binding protein EngB	8.09e-02	NA	0.029	NA
7. B	P53145	Large subunit GTPase 1	6.65e-07	NA	1.70e-10	NA
7. B	C1CSI8	Probable GTP-binding protein EngB	8.62e-02	NA	0.032	NA
7. B	C1CLR7	Probable GTP-binding protein EngB	8.00e-02	NA	0.035	NA
7. B	A7GTE8	Probable GTP-binding protein EngB	6.53e-02	NA	0.007	NA
7. B	B8I8N7	Probable GTP-binding protein EngB	5.50e-02	NA	0.013	NA
7. B	Q5KWK2	Probable GTP-binding protein EngB	6.66e-02	NA	0.022	NA
7. B	C5D5L1	Probable GTP-binding protein EngB	7.41e-02	NA	0.009	NA
7. B	Q0BW92	tRNA modification GTPase MnmE	2.37e-01	NA	0.010	NA
7. B	Q6HD57	Probable GTP-binding protein EngB	6.47e-02	NA	0.001	NA
7. B	B0BV57	tRNA modification GTPase MnmE	7.85e-02	NA	0.012	NA
7. B	B5E6L1	Probable GTP-binding protein EngB	9.54e-02	NA	0.033	NA
7. B	Q8EPM2	Probable GTP-binding protein EngB	6.32e-02	NA	4.71e-04	NA
7. B	Q031W8	GTPase Era	2.37e-02	NA	0.002	NA
7. B	Q1JHC1	Probable GTP-binding protein EngB	8.51e-02	NA	0.020	NA
7. B	Q1IHC2	tRNA modification GTPase MnmE	8.15e-02	NA	0.005	NA
7. B	A8Z4A6	GTPase Era	3.81e-02	NA	0.013	NA
7. B	Q03SA1	GTPase Der	1.04e-02	NA	0.002	NA
7. B	Q1G9W6	GTPase Era	5.46e-02	NA	0.048	NA
7. B	Q3UM18	Large subunit GTPase 1 homolog	1.26e-04	NA	7.52e-11	NA
7. B	B0V4V6	GTPase Der	9.31e-03	NA	2.97e-04	NA
7. B	C1CFF1	Probable GTP-binding protein EngB	8.83e-02	NA	0.033	NA
7. B	Q8CS80	Probable GTP-binding protein EngB	6.71e-02	NA	0.019	NA
7. B	A8G3A3	GTPase Der	7.47e-03	NA	0.011	NA
7. B	O14236	Nucleolar GTP-binding protein 2	2.75e-08	NA	7.62e-10	NA
7. B	Q5KXT0	GTPase Der	8.60e-03	NA	0.032	NA
7. B	Q9V288	Probable GTP-binding protein EngB	1.14e-01	NA	0.042	NA
7. B	A8I264	tRNA modification GTPase MnmE	1.15e-01	NA	2.23e-04	NA
7. B	C3L700	Probable GTP-binding protein EngB	6.15e-02	NA	0.001	NA
7. B	Q9SJF1	GTPase LSG1-2	2.13e-08	NA	1.13e-05	NA
7. B	B1AIQ5	Probable GTP-binding protein EngB	6.12e-02	NA	0.002	NA
7. B	B7HHQ7	GTPase Der	1.39e-02	NA	0.044	NA
7. B	Q8UD28	GTPase Der	1.46e-02	NA	0.003	NA
7. B	A9N941	GTPase Era	5.11e-02	NA	0.016	NA
7. B	Q73AZ1	GTPase Der	8.12e-03	NA	0.044	NA
7. B	Q46ZI7	GTPase Der	4.30e-03	NA	1.20e-04	NA
7. B	Q68XY6	GTPase Era	4.67e-02	NA	0.017	NA
7. B	P0DA92	Probable GTP-binding protein EngB	8.23e-02	NA	0.021	NA
7. B	B0RX26	GTPase Era	3.56e-02	NA	0.004	NA
7. B	B2UMV5	GTPase Der	1.19e-02	NA	0.023	NA
7. B	Q30TK8	GTPase Der	2.92e-02	NA	0.010	NA
7. B	Q1RHA4	GTPase Era	4.51e-02	NA	0.002	NA
7. B	Q5FGZ3	Probable GTP-binding protein EngB	1.49e-03	NA	4.94e-04	NA
7. B	Q31CE7	GTPase Der	6.99e-03	NA	0.010	NA
7. B	Q1RK21	GTPase Der	1.12e-02	NA	1.14e-05	NA
7. B	P64070	Probable GTP-binding protein EngB	6.67e-02	NA	0.041	NA
7. B	Q03F63	GTPase Era	4.21e-02	NA	0.008	NA
7. B	Q5HB81	Probable GTP-binding protein EngB	2.27e-03	NA	4.98e-04	NA
7. B	B7JGY9	GTPase Der	1.46e-02	NA	0.044	NA
7. B	B8GAY7	GTPase Der	1.26e-02	NA	5.36e-05	NA
7. B	A3M215	GTPase Der	1.42e-02	NA	2.97e-04	NA
7. B	Q833M8	Probable GTP-binding protein EngB	4.82e-02	NA	0.030	NA
7. B	Q8DZ11	Probable GTP-binding protein EngB	1.35e-01	NA	0.022	NA
7. B	Q3MBM5	tRNA modification GTPase MnmE	1.99e-01	NA	0.001	NA
7. B	Q2IXA7	GTPase Der	1.70e-02	NA	0.003	NA
7. B	B0S3V2	tRNA modification GTPase MnmE	1.62e-01	NA	0.037	NA
7. B	A3DHY8	tRNA modification GTPase MnmE	9.71e-02	NA	0.043	NA
7. B	Q4UMV9	GTPase Der	2.01e-02	NA	1.19e-04	NA
7. B	Q3BTW0	GTPase Der	1.45e-02	NA	7.26e-05	NA
7. B	Q182C3	GTPase Era	7.36e-02	NA	0.023	NA
7. B	O74791	GTPase grn1	2.90e-13	NA	8.71e-09	NA
7. B	Q5XCL9	Probable GTP-binding protein EngB	8.09e-02	NA	0.029	NA
7. B	Q9JZY1	GTPase Der	1.69e-02	NA	0.022	NA
7. B	A9AH00	GTPase Der	8.25e-03	NA	4.28e-06	NA
7. B	O44411	Nucleolar GTP-binding protein 1	1.48e-01	NA	0.006	NA
7. B	Q24VA2	GTPase Der	1.16e-02	NA	0.019	NA
7. B	Q895X8	GTPase Der	7.83e-03	NA	0.014	NA
7. B	B8ZLT0	Probable GTP-binding protein EngB	8.75e-02	NA	0.032	NA
7. B	Q817Q5	Probable GTP-binding protein EngB	6.17e-02	NA	8.64e-04	NA
7. B	Q9WYA4	tRNA modification GTPase MnmE	1.06e-01	NA	0.016	NA
7. B	A5CDT2	GTPase Der	2.42e-02	NA	5.65e-04	NA
7. B	Q119L7	GTPase Der	1.20e-02	NA	0.017	NA
7. B	B8DHJ0	Probable GTP-binding protein EngB	3.76e-02	NA	0.023	NA
7. B	A7X2W5	GTPase Era	3.97e-02	NA	0.013	NA
7. B	Q9U6A9	Nucleolar GTP-binding protein 1	3.20e-01	NA	0.013	NA
7. B	Q8XIU8	GTPase Era	3.75e-02	NA	0.018	NA
7. B	Q1JM76	Probable GTP-binding protein EngB	8.10e-02	NA	0.020	NA
7. B	C6E2H7	GTPase Era	3.66e-02	NA	0.008	NA
7. B	Q0BEX1	GTPase Der	5.32e-03	NA	1.26e-06	NA
7. B	B4RKD2	GTPase Der	8.04e-03	NA	0.023	NA
7. B	Q2FGF6	GTPase Era	3.72e-02	NA	0.013	NA
7. B	Q1MDD6	GTPase Der	1.44e-02	NA	0.025	NA
7. B	C3MG60	GTPase Der	1.69e-02	NA	0.025	NA
7. B	A6TSJ8	GTPase Era	4.42e-02	NA	0.040	NA
7. B	A4IQA2	GTPase Der	8.80e-03	NA	8.12e-04	NA
7. B	A7X395	Probable GTP-binding protein EngB	6.65e-02	NA	0.041	NA
7. B	Q879S5	tRNA modification GTPase MnmE	1.56e-01	NA	0.040	NA
7. B	Q57986	Fe(2+) transporter FeoB	8.68e-02	NA	0.011	NA
7. B	Q04A20	GTPase Era	5.47e-02	NA	0.048	NA
7. B	Q99LH1	Nucleolar GTP-binding protein 2	1.77e-09	NA	9.58e-09	NA
7. B	Q92JC9	Probable GTP-binding protein EngB	8.39e-02	NA	0.005	NA
7. B	Q8W4I6	GTP-binding protein BRASSINAZOLE INSENSITIVE PALE GREEN 2, chloroplastic	6.59e-02	NA	0.012	NA
7. B	P0DA93	Probable GTP-binding protein EngB	8.02e-02	NA	0.021	NA
7. B	Q5QYB3	GTPase Der	6.81e-03	NA	0.049	NA
7. B	B2KB94	GTPase Era	3.20e-02	NA	0.028	NA
7. B	Q7V491	tRNA modification GTPase MnmE	8.04e-02	NA	0.026	NA
7. B	P36916	Guanine nucleotide-binding protein-like 1	3.36e-07	NA	1.94e-08	NA
7. B	Q2K5L2	GTPase Der	1.37e-02	NA	0.043	NA
7. B	A4JEN6	GTPase Der	5.27e-03	NA	4.90e-06	NA
7. B	Q5P9B1	tRNA modification GTPase MnmE	7.42e-02	NA	0.017	NA
7. B	Q1D5X5	GTPase Der	7.18e-03	NA	2.25e-07	NA
7. B	P9WNL2	GTPase Der	2.51e-02	NA	0.042	NA
7. B	A3PJF0	GTPase Der	7.64e-03	NA	2.08e-04	NA
7. B	Q828Y7	GTPase Der	2.48e-02	NA	6.82e-05	NA
7. B	Q87B41	GTPase Der	4.25e-03	NA	8.52e-04	NA
7. B	Q13823	Nucleolar GTP-binding protein 2	2.14e-09	NA	6.06e-09	NA
7. B	B7HEA1	Probable GTP-binding protein EngB	6.47e-02	NA	8.64e-04	NA
7. B	B6IZ00	GTPase Era	5.45e-02	NA	0.009	NA
7. B	B2A470	tRNA modification GTPase MnmE	5.60e-02	NA	0.021	NA
7. B	C1EN01	GTPase Der	1.40e-02	NA	0.044	NA
7. B	Q6GGD3	GTPase Era	3.78e-02	NA	0.013	NA
7. B	A8F2P7	tRNA modification GTPase MnmE	9.09e-02	NA	0.013	NA
7. B	P36915	Guanine nucleotide-binding protein-like 1	3.77e-07	NA	8.95e-07	NA
7. B	Q97ID7	GTPase Der	1.37e-02	NA	0.024	NA
7. B	Q6ND14	tRNA modification GTPase MnmE	1.24e-01	NA	0.041	NA
7. B	Q7VE01	tRNA modification GTPase MnmE	9.41e-02	NA	0.001	NA
7. B	Q5X522	GTPase Der	1.29e-02	NA	0.003	NA
7. B	Q9ZE30	GTPase Era	4.80e-02	NA	0.026	NA
7. B	Q07LA7	GTPase Der	1.59e-02	NA	0.041	NA
7. B	Q54KS4	Guanine nucleotide-binding protein-like 3 homolog	1.50e-10	NA	9.77e-14	NA
7. B	A8LYU3	GTPase Der	1.34e-02	NA	0.034	NA
7. B	Q2Y6F9	GTPase Der	7.30e-03	NA	0.006	NA
7. B	Q7U3V6	tRNA modification GTPase MnmE	7.46e-02	NA	0.015	NA
7. B	A1URU0	GTPase Der	1.14e-02	NA	0.001	NA
7. B	A3PBA9	GTPase Der	8.75e-03	NA	0.010	NA
7. B	A1KJD0	GTPase Der	2.11e-02	NA	0.042	NA
7. B	Q92BF6	Probable GTP-binding protein EngB	4.09e-02	NA	0.024	NA
7. B	B2I605	GTPase Era	4.77e-02	NA	0.007	NA
7. B	B5XL04	Probable GTP-binding protein EngB	8.50e-02	NA	0.020	NA
7. B	B7UWJ2	GTPase Der	1.35e-02	NA	0.014	NA
7. B	Q12AC2	GTPase Der	1.06e-02	NA	0.009	NA
7. B	P64073	Probable GTP-binding protein EngB	8.77e-02	NA	0.033	NA
7. B	A0RJ86	Probable GTP-binding protein EngB	6.12e-02	NA	0.001	NA
7. B	A9VIU3	Probable GTP-binding protein EngB	6.23e-02	NA	0.001	NA
7. B	Q831T9	GTPase Era	4.49e-02	NA	0.014	NA
7. B	A3CMV2	Probable GTP-binding protein EngB	7.13e-02	NA	0.028	NA
7. B	P38424	Probable GTP-binding protein EngB	5.05e-02	NA	0.016	NA
7. B	A1AV43	tRNA modification GTPase MnmE	1.30e-01	NA	0.002	NA
7. B	A8FFV6	Probable GTP-binding protein EngB	4.79e-02	NA	0.005	NA
7. B	Q6G900	GTPase Era	3.75e-02	NA	0.013	NA
7. B	Q8PKY6	GTPase Der	4.42e-03	NA	7.45e-05	NA
7. B	A5IT95	GTPase Era	3.77e-02	NA	0.013	NA
7. B	Q135K8	GTPase Der	5.94e-02	NA	5.29e-04	NA
7. B	B8H630	GTPase Era	2.93e-02	NA	0.020	NA
7. B	A8MKR9	tRNA modification GTPase MnmE	9.44e-02	NA	0.003	NA
7. B	Q3AGU7	tRNA modification GTPase MnmE	6.58e-02	NA	0.003	NA
7. B	Q72ZV7	Probable GTP-binding protein EngB	6.17e-02	NA	0.001	NA
7. B	Q8E4L9	Probable GTP-binding protein EngB	1.36e-01	NA	0.024	NA
7. B	C3L9F4	GTPase Der	1.43e-02	NA	0.044	NA
7. B	Q38WW3	GTPase Der	1.00e-02	NA	0.002	NA
7. B	A3MK70	GTPase Der	1.06e-02	NA	4.07e-07	NA
7. B	Q10LF7	Nuclear/nucleolar GTPase 2	2.17e-08	NA	1.67e-10	NA
7. B	B0VKR4	GTPase Der	1.05e-02	NA	3.78e-04	NA
7. B	Q2SDW8	GTPase Der	9.71e-03	NA	1.35e-05	NA
7. B	Q92R46	GTPase Era	2.55e-02	NA	0.013	NA
7. B	A7ZAW1	tRNA modification GTPase MnmE	8.73e-02	NA	0.029	NA
7. B	P58071	GTPase Era	2.93e-02	NA	0.020	NA
7. B	Q97CW2	tRNA modification GTPase MnmE	1.40e-01	NA	0.004	NA
7. B	Q4A647	tRNA modification GTPase MnmE	2.35e-01	NA	0.005	NA
7. B	B2A1E8	Probable GTP-binding protein EngB	7.37e-02	NA	0.008	NA
7. B	Q8UGK1	GTPase Era	2.24e-02	NA	0.010	NA
7. B	Q88VS0	GTPase Era	1.43e-02	NA	0.041	NA
7. B	B9FI63	GTPase ERA-like, chloroplastic	7.83e-02	NA	0.038	NA
7. B	C0QLA5	Probable GTP-binding protein EngB	1.33e-01	NA	0.003	NA
7. B	Q57768	Probable GTP-binding protein EngB	4.36e-02	NA	1.30e-04	NA
7. B	C3PPD1	GTPase Der	1.04e-02	NA	3.53e-04	NA
7. B	B0KBA1	Probable GTP-binding protein EngB	5.24e-02	NA	1.15e-05	NA
7. B	O67679	Probable GTP-binding protein EngB	9.04e-04	NA	0.002	NA
7. B	B3PVJ6	GTPase Der	1.51e-02	NA	0.040	NA
7. B	Q4FTW3	GTPase Der	1.50e-02	NA	8.97e-04	NA
7. B	C1C8F9	Probable GTP-binding protein EngB	8.75e-02	NA	0.033	NA
7. B	B2JIU7	GTPase Der	1.09e-02	NA	2.00e-04	NA
7. B	A5EKL6	GTPase Era	2.78e-02	NA	0.048	NA
7. B	Q9V411	Nucleolar GTP-binding protein 1	1.43e-01	NA	0.017	NA
7. B	A8GUZ8	GTPase Era	2.95e-02	NA	0.002	NA
7. B	A8GTM1	tRNA modification GTPase MnmE	7.77e-02	NA	0.012	NA
7. B	Q92GE8	tRNA modification GTPase MnmE	8.31e-02	NA	0.012	NA
7. B	A8EXI4	GTPase Era	2.58e-02	NA	0.015	NA
7. B	B8FVH0	Probable GTP-binding protein EngB	1.81e-02	NA	0.021	NA
7. B	B7HL14	GTPase Der	1.41e-02	NA	0.044	NA
7. B	Q87C05	GTPase Era	4.30e-02	NA	0.007	NA
7. B	Q6AGF6	GTPase Der	3.06e-02	NA	0.001	NA
7. B	Q39T84	GTPase Era	2.19e-02	NA	4.53e-05	NA
7. B	Q92GU2	GTPase Der	1.12e-02	NA	3.44e-04	NA
7. B	C4L4J3	Probable GTP-binding protein EngB	6.07e-02	NA	0.006	NA
7. B	A8MH56	GTPase Der	7.38e-03	NA	0.004	NA
7. B	C4K2K1	GTPase Der	1.14e-02	NA	3.29e-04	NA
7. B	Q9PQA7	GTPase Der	9.91e-03	NA	0.026	NA
7. B	Q3BVV5	GTPase Era	3.52e-02	NA	0.008	NA
7. B	A8AXB8	Probable GTP-binding protein EngB	8.28e-02	NA	0.030	NA
7. B	Q6KHV1	Probable GTP-binding protein EngB	3.06e-03	NA	0.003	NA
7. B	C5CIV1	GTPase Der	7.06e-03	NA	8.54e-04	NA
7. B	B2IR86	Probable GTP-binding protein EngB	1.03e-01	NA	0.032	NA
7. B	A2S2A6	GTPase Der	4.91e-03	NA	4.07e-07	NA
7. B	Q8DUH9	Probable GTP-binding protein EngB	7.89e-02	NA	0.011	NA
7. B	Q04JI0	Probable GTP-binding protein EngB	9.42e-02	NA	0.033	NA
7. B	Q46H20	GTPase Der	1.18e-02	NA	0.010	NA
7. B	B9JZQ5	GTPase Der	1.30e-02	NA	0.045	NA
7. B	C0QA05	GTPase Der	4.90e-02	NA	6.46e-04	NA
7. B	Q0C441	GTPase Der	2.71e-02	NA	0.047	NA
7. B	Q8VZ74	GTPase ERA-like, chloroplastic	8.12e-02	NA	0.008	NA
7. B	A9IQH4	GTPase Der	1.82e-02	NA	0.004	NA
7. B	A2C0J7	GTPase Der	1.98e-02	NA	0.009	NA
7. B	Q2YT12	GTPase Era	3.74e-02	NA	0.013	NA
7. B	B1JT88	GTPase Der	8.67e-03	NA	1.70e-06	NA
7. B	C1ANY6	GTPase Der	1.51e-02	NA	0.042	NA
7. B	A1K3Z3	GTPase Der	1.36e-02	NA	4.40e-05	NA
7. B	B9IVM6	GTPase Der	1.46e-02	NA	0.044	NA
7. B	A7IIE4	GTPase Der	5.18e-02	NA	0.003	NA
7. B	B3E422	GTPase Era	4.23e-02	NA	0.003	NA
7. B	A6QHB0	GTPase Era	3.73e-02	NA	0.013	NA
7. B	B3WEL1	GTPase Era	9.22e-02	NA	0.019	NA
7. B	Q49884	GTPase Der	1.32e-02	NA	0.033	NA
7. B	Q2GGM7	Probable GTP-binding protein EngB	8.03e-04	NA	8.09e-04	NA
7. B	B2I7V0	GTPase Der	6.28e-03	NA	8.52e-04	NA
7. B	C5BLV6	GTPase Der	1.69e-02	NA	0.004	NA
7. B	Q3J2Y1	GTPase Der	6.76e-03	NA	2.08e-04	NA
7. B	B6JGG2	GTPase Era	2.07e-02	NA	0.019	NA
7. B	Q5WWG8	GTPase Der	1.18e-02	NA	0.003	NA
7. B	Q65GJ7	Probable GTP-binding protein EngB	4.75e-02	NA	0.006	NA
7. B	B7IIY0	Probable GTP-binding protein EngB	5.89e-02	NA	8.88e-04	NA
7. B	A4J3P1	GTPase Der	5.65e-03	NA	0.001	NA
7. B	Q81LC2	Probable GTP-binding protein EngB	5.92e-02	NA	0.001	NA
7. B	Q63US9	GTPase Der	7.44e-03	NA	4.07e-07	NA
7. B	P64085	GTPase Era	3.65e-02	NA	0.013	NA
7. B	Q8NQK6	GTPase Der	2.30e-02	NA	0.011	NA
7. B	A9KHA0	Probable GTP-binding protein EngB	5.73e-02	NA	0.004	NA
7. B	B3DXK2	GTPase Der	7.95e-03	NA	0.016	NA
7. B	B2I3F0	GTPase Der	1.07e-02	NA	2.97e-04	NA
7. B	B9DNB9	Probable GTP-binding protein EngB	5.48e-02	NA	0.039	NA
7. B	Q92JA9	GTPase Era	4.19e-02	NA	0.014	NA
7. B	Q7NAD9	tRNA modification GTPase MnmE	9.00e-02	NA	0.001	NA
7. B	A9KFA1	GTPase Era	5.21e-02	NA	0.030	NA
7. B	B0S273	Probable GTP-binding protein EngB	7.45e-02	NA	0.001	NA
7. B	Q1WTU6	GTPase Era	1.40e-02	NA	0.008	NA
7. B	C3PMD9	Probable GTP-binding protein EngB	7.43e-02	NA	0.005	NA
7. B	B2A4M9	GTPase Der	3.31e-02	NA	0.005	NA
7. B	Q13X32	GTPase Der	6.45e-03	NA	2.90e-05	NA
7. B	Q39FR3	GTPase Der	9.20e-03	NA	1.60e-06	NA
7. B	B7JQ62	Probable GTP-binding protein EngB	6.13e-02	NA	0.001	NA
7. B	Q6F1A9	Probable GTP-binding protein EngB	5.16e-02	NA	0.006	NA
7. B	A9KLX9	tRNA modification GTPase MnmE	1.54e-01	NA	0.013	NA
7. B	Q6MG06	Guanine nucleotide-binding protein-like 1	4.09e-07	NA	1.65e-07	NA
7. B	Q24SK9	Probable GTP-binding protein EngB	2.06e-02	NA	0.021	NA
7. B	A8GPH5	GTPase Der	1.26e-02	NA	1.93e-04	NA
7. B	O69162	GTPase Era	2.25e-02	NA	0.013	NA
7. B	Q65I15	GTPase Der	9.61e-03	NA	0.048	NA
7. B	B4EAW5	GTPase Der	5.48e-03	NA	1.28e-06	NA
7. B	Q0TNU5	GTPase Era	3.69e-02	NA	0.016	NA
7. B	B5YFX9	GTPase Der	2.53e-02	NA	0.043	NA
7. B	Q8SVJ8	Nucleolar GTP-binding protein 1	2.95e-01	NA	0.002	NA
7. B	Q47BS0	GTPase Der	1.15e-02	NA	0.005	NA
7. B	Q6GG32	Probable GTP-binding protein EngB	6.93e-02	NA	0.043	NA
7. B	B8GTN1	GTPase Der	6.42e-03	NA	8.43e-05	NA
7. B	B7H065	GTPase Der	1.44e-02	NA	2.97e-04	NA
7. B	B1HTJ0	GTPase Era	2.61e-02	NA	0.001	NA
7. B	Q2P4M0	GTPase Era	4.34e-02	NA	0.008	NA
7. B	Q8G6A8	GTPase Der	1.18e-02	NA	0.009	NA
7. B	B0U489	GTPase Der	3.61e-03	NA	0.002	NA
7. B	A2BV51	GTPase Der	7.18e-03	NA	0.003	NA
7. B	A9NE34	tRNA modification GTPase MnmE	1.27e-01	NA	0.002	NA
7. B	A7HK07	tRNA modification GTPase MnmE	1.58e-01	NA	1.13e-04	NA
7. B	A5G692	GTPase Der	1.96e-02	NA	3.96e-06	NA
7. B	Q6MPP2	Probable GTP-binding protein EngB	1.31e-03	NA	0.002	NA
7. B	Q8PB51	GTPase Era	3.59e-02	NA	0.004	NA
7. B	B3R1J8	GTPase Der	5.54e-03	NA	9.62e-05	NA
7. B	Q9JV01	GTPase Der	1.72e-02	NA	0.021	NA
7. B	Q3AVY3	tRNA modification GTPase MnmE	8.10e-02	NA	0.001	NA
7. B	Q6MTV5	Probable GTP-binding protein EngB	6.75e-02	NA	0.043	NA
7. B	Q8RC22	Probable GTP-binding protein EngB	7.08e-02	NA	5.67e-05	NA
7. B	A8GUK6	Probable GTP-binding protein EngB	8.84e-02	NA	0.046	NA
7. B	B2FNR1	GTPase Der	1.29e-02	NA	0.004	NA
7. B	Q67NS9	GTPase Der	1.38e-02	NA	0.014	NA
7. B	Q8H1F6	DAR GTPase 3, chloroplastic	0.00e+00	NA	5.68e-30	NA
7. B	Q1QMP4	GTPase Der	2.35e-02	NA	0.010	NA
7. B	C0MEW6	Probable GTP-binding protein EngB	8.15e-02	NA	0.034	NA
7. B	Q39PQ9	tRNA modification GTPase MnmE	1.57e-01	NA	0.039	NA
7. B	P53742	Nucleolar GTP-binding protein 2	5.02e-12	NA	2.95e-11	NA
7. B	Q1CT35	GTPase Der	2.05e-02	NA	0.040	NA
7. B	C4K4J2	GTPase Der	7.04e-03	NA	7.15e-04	NA
7. B	Q8PMU9	GTPase Era	3.24e-02	NA	0.008	NA
7. B	A6U7A9	GTPase Era	2.23e-02	NA	0.005	NA
7. B	Q6G0H5	GTPase Der	1.28e-02	NA	0.006	NA
7. B	Q2GA15	GTPase Der	1.66e-02	NA	6.11e-04	NA
7. B	B8G2P9	GTPase Der	1.04e-02	NA	0.018	NA
7. B	P51836	GTPase Era	5.19e-02	NA	0.016	NA
7. B	P42182	GTPase Era	2.08e-02	NA	0.003	NA
7. B	A5WGA8	GTPase Der	1.54e-02	NA	3.78e-05	NA
7. B	Q9PRC7	tRNA modification GTPase MnmE	1.66e-01	NA	0.008	NA
7. B	Q6G5J7	GTPase Der	1.32e-02	NA	0.013	NA
7. B	Q6N586	GTPase Der	8.95e-03	NA	2.10e-04	NA
7. B	A1TA72	GTPase Der	2.00e-02	NA	0.030	NA
7. B	Q5HP70	GTPase Der	8.33e-03	NA	0.042	NA
7. B	Q67J33	tRNA modification GTPase MnmE	1.38e-01	NA	0.037	NA
7. B	B9IZ44	Probable GTP-binding protein EngB	6.61e-02	NA	0.001	NA
7. B	Q8FTK5	GTPase Der	2.30e-02	NA	0.009	NA
7. B	A1R5C7	GTPase Der	1.10e-02	NA	0.018	NA
7. B	Q49XS9	GTPase Der	8.82e-03	NA	0.036	NA
7. B	Q8EUV6	tRNA modification GTPase MnmE	3.41e-01	NA	0.005	NA
7. B	Q6MUE7	tRNA modification GTPase MnmE	1.56e-01	NA	0.016	NA
7. B	Q892S2	GTPase Era	3.38e-02	NA	0.011	NA
7. B	Q8NW73	Probable GTP-binding protein EngB	7.08e-02	NA	0.030	NA
7. B	A3NA49	GTPase Der	8.59e-03	NA	4.07e-07	NA
7. B	C1ETR5	Probable GTP-binding protein EngB	5.98e-02	NA	0.001	NA
7. B	B3Q8A8	tRNA modification GTPase MnmE	6.32e-02	NA	0.025	NA
7. B	Q2P2T5	GTPase Der	3.53e-03	NA	1.16e-04	NA
7. B	Q899S2	tRNA modification GTPase MnmE	1.26e-01	NA	0.026	NA
7. B	Q4USF8	GTPase Era	3.66e-02	NA	0.004	NA
7. B	B5ZB76	Probable GTP-binding protein EngB	6.41e-02	NA	0.006	NA
7. B	Q03WN4	GTPase Der	2.00e-02	NA	5.89e-04	NA
7. B	Q0ICK8	GTPase Der	9.45e-03	NA	0.004	NA
7. B	A4IRG9	Probable GTP-binding protein EngB	6.83e-02	NA	0.014	NA
7. B	B9M913	GTPase Era	3.20e-02	NA	1.44e-04	NA
7. B	P64086	GTPase Era	3.72e-02	NA	0.013	NA
7. B	O87407	GTPase Der	8.01e-03	NA	0.021	NA
7. B	A5FIZ1	Probable GTP-binding protein EngB	3.37e-02	NA	0.001	NA
7. B	B2U9V3	GTPase Der	6.43e-03	NA	0.001	NA
7. B	A2CDC4	tRNA modification GTPase MnmE	7.56e-02	NA	0.048	NA
7. B	Q8CP62	GTPase Der	1.41e-02	NA	0.042	NA
7. B	Q8YN91	tRNA modification GTPase MnmE	1.08e-01	NA	0.001	NA
7. B	Q5HFJ3	GTPase Era	3.81e-02	NA	0.013	NA
7. B	Q1MS56	GTPase Der	1.29e-02	NA	3.99e-04	NA
7. B	Q9ZLF3	Fe(2+) transporter FeoB	8.06e-02	NA	0.011	NA
7. B	Q491W2	Probable GTP-binding protein EngB	9.38e-02	NA	0.031	NA
7. B	Q81FR5	GTPase Der	8.20e-03	NA	0.044	NA
7. B	A0K7T2	GTPase Der	8.59e-03	NA	1.70e-06	NA
7. B	Q5BJT6	Large subunit GTPase 1 homolog	2.35e-06	NA	5.53e-12	NA
7. B	Q8CP21	GTPase Era	3.83e-02	NA	0.013	NA
7. B	P9WNL3	GTPase Der	1.60e-02	NA	0.042	NA
7. B	B0CBB0	tRNA modification GTPase MnmE	7.48e-02	NA	0.004	NA
7. B	P64072	Probable GTP-binding protein EngB	9.45e-02	NA	0.033	NA
7. B	Q4L6R7	GTPase Era	4.04e-02	NA	0.008	NA
7. B	B9DU74	Probable GTP-binding protein EngB	8.33e-02	NA	0.019	NA
7. B	Q2FXQ8	Probable GTP-binding protein EngB	6.82e-02	NA	0.041	NA
7. B	A5U372	GTPase Der	1.52e-02	NA	0.042	NA
7. B	B1ICY8	Probable GTP-binding protein EngB	9.24e-02	NA	0.031	NA
7. B	Q9C3Z4	Nucleolar GTP-binding protein 2	NA	NA	1.37e-07	NA
7. B	B8FM51	GTPase Der	1.85e-02	NA	1.37e-04	NA
7. B	B9LBT6	GTPase Der	1.13e-02	NA	1.43e-04	NA
7. B	Q985A5	GTPase Era	2.08e-02	NA	0.004	NA
7. B	Q8P1C8	Probable GTP-binding protein EngB	8.06e-02	NA	0.019	NA
7. B	Q71ZB0	Probable GTP-binding protein EngB	4.09e-02	NA	0.023	NA
7. B	B5ZBZ8	GTPase Era	2.86e-02	NA	0.025	NA
7. B	C0ZCB6	GTPase Der	7.81e-03	NA	0.001	NA
7. B	B1AJD1	GTPase Era	4.08e-02	NA	0.032	NA
7. B	Q1BGX0	GTPase Der	5.88e-03	NA	1.70e-06	NA
7. B	P0A3C2	GTPase Era	2.34e-02	NA	0.002	NA
7. B	C1AB49	Probable GTP-binding protein EngB	6.10e-02	NA	0.027	NA
7. B	Q9PPZ9	GTPase Era	2.93e-02	NA	0.032	NA
7. B	A6TS39	GTPase Der	1.16e-02	NA	0.015	NA
7. B	B2GC35	GTPase Der	2.28e-02	NA	0.032	NA
7. B	A3NVW6	GTPase Der	9.21e-03	NA	4.07e-07	NA
7. B	A9BHV0	Probable GTP-binding protein EngB	4.50e-02	NA	0.023	NA
7. B	A8GXR7	GTPase Der	1.63e-02	NA	1.15e-05	NA
7. B	A9BHZ7	tRNA modification GTPase MnmE	1.36e-01	NA	0.001	NA
7. B	Q8RGM1	GTPase Era	5.54e-02	NA	0.004	NA
7. B	Q1LTY0	Probable GTP-binding protein EngB	6.79e-03	NA	0.001	NA
7. B	A6QHK7	Probable GTP-binding protein EngB	7.51e-02	NA	0.041	NA
7. B	A8GM80	GTPase Era	3.19e-02	NA	0.012	NA
7. B	B0K530	Probable GTP-binding protein EngB	5.24e-02	NA	1.15e-05	NA
7. B	C1KVK5	Probable GTP-binding protein EngB	4.21e-02	NA	0.023	NA
7. B	Q9P9U3	tRNA modification GTPase MnmE	1.40e-01	NA	0.036	NA
7. B	A5FIR0	GTPase Der	1.40e-02	NA	0.002	NA