Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54744.1
JCVISYN3A_0371
Flippase A.
M. mycoides homolog: Q6MTH4.
TIGRfam Classification: 2=Generic.
Category: Essential.
Statistics
Total GO Annotation: 583
Unique PROST Go: 48
Unique BLAST Go: 349
Unique Foldseek Go: 3
Total Homologs: 3728
Unique PROST Homologs: 2
Unique BLAST Homologs: 3289
Unique Foldseek Homologs: 6
Literature
Danchin and Fang [1]: putative lipid transporter, flippase; belongs to membrane rafts|may be important for the formation of lipid rafts in the membrane
Yang and Tsui [2]: ATP-binding/permease protein CydC
Antczak et al. [3]: Transmembrane Anion/Proteins/mRNA/Other transporter, ABC-type, ATP-binding
Zhang et al. [4]: GO:0035639|purine ribonucleoside triphosphate binding
Bianchi et al. [5]: Lipid Flippase Like
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q4PH16
(Iron-sulfur clusters transporter ATM1, mitochondrial) with a FATCAT P-Value: 0 and RMSD of 3.38 angstrom. The sequence alignment identity is 27.0%.
Structural alignment shown in left. Query protein AVX54744.1 colored as red in alignment, homolog Q4PH16 colored as blue.
Query protein AVX54744.1 is also shown in right top, homolog Q4PH16 showed in right bottom. They are colored based on secondary structures.
AVX54744.1 -----------------------------------------------------------------------------MKVKNNFDHFYK------P--MT 15 Q4PH16 MRVAIRRLPWQATDARHRTIGLVSTNRLPSRIQPRSISSTSIAALVYHSRNSLRTNIFDIAATPSSRYGSSQRFYQHMAADRDGDHVPKHQAKMLPGSAS 100 AVX54744.1 DEEI-------K-----ADRK--------SFNRGRKSF--INVI-WKHMK--INKKWAIGLLITA--IFSALFAAL--NPLLMQQLQFAVEFEKT---HQ 83 Q4PH16 DKIIAAASPASKSASSPAQKKQPDGDDPLNLNSREKTVKEQRLVDWAIIKKLIQYVWPKGDFGTKQRVVLAL-ALLIGGKLLNVQVPF---FFKTIVDRL 196 AVX54744.1 N-FSNSWGLSWKVILAIWIVILVITAILTY-IANLFG----NELGKKI--EISLRNELTR--K-----LITTDIHYYSNKKTGEILTKVVSD--TQIIGM 166 Q4PH16 NDVVNA-PLDMSNPNTVWVV--AGSAVLGYGLARV-GAAAFSELRNAVFANVAQRS-IRRVAKSVFTHLLALDLGWHLTRQTGG-LTRAI-DRGTK--GI 287 AVX54744.1 QASVIPNIIFTAFFTMVFTLITLFITTSLYIGLFFISLFLMF-GIL-F--GLSF-----LPMRKLV-FNLRKIITDINGDVTD-RINTIKLIK-ANGTEE 254 Q4PH16 ------SFLLT---SIVFHI----VPTALEIS--------MVCGILSYKCGPSFAAVTAITMAAYAWFTIR---T------TSWR--T-RFRKEANAADN 354 AVX54744.1 YEKTRFVQIHD--VYYK--KY----K-QISYFQSVMISILFFAINTVQILMTLIALWLYKNDI--TTLKTILGPMLICA-G-----MLIGP-IM--QLLR 334 Q4PH16 RAATTSV---DSLLNYEAVKYFNNEKHEIAKYDAALAD---YEKSSIKVATSLAALNSGQNAIFSTSL-TVM--MLLAAQGVTNGTMTVGDLVMVNQLVF 445 AVX54744.1 AI------IGMVQASTSAQRIDEITD-AT--QLIN-NHSL--DKKGIRIHKIEGN-LVFKNVNFSY-PDKPENVILPNFNLVLEKG-KSYAFVGQTGAGK 419 Q4PH16 QLSLPLNFLGTVY---RELR-QSLVDMETMFNLENVNVAVKEDKNAPPL-KVSGGEIRFENVTFGYHPDRP---IFRNISFTVPAGYKT-AFVGPSGCGK 536 AVX54744.1 STISKLLLRFYDPTSGEVLINDNINIKDVFLPSYLNHIGYVEQD-PSVLLG-TVFDNLRYVKPSATDEEIILACKKAELHDLVTTWPEQYNTILGERGFI 517 Q4PH16 STIFRLLFRFYEPQSGKIYI-DGQDITKVSLESLRRHIGVVPQDTP--LFNDDIRHNIRYGRLDASDEDVEKAARAAKVDQIVLNLPEGYSTKVGERGLM 633 AVX54744.1 LSGGQKQRLVIARMFLKNPDILILDEATSALDNVVEKE----IQAKLEELMQGRTSITIAHRLSTIRNVDQIIVLAPKKGIIQIGTFKELVKKPGEFKDL 613 Q4PH16 ISGGEKQRLAVARLLLKNPSVLFFDEATSALDSYTETELMRNIHATL--LADKKTAIFVAHRLRTISDSDFIIVL-QGGGVKEQGTHDQLMDSKGLYWDL 730 AVX54744.1 YEA----GFSKYDA-------------------- 623 Q4PH16 WQAQSTVGVG-HGAGANEHLQDLERDQNSSTTPM 763
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0033162 | melanosome membrane |
1. PBF | GO:0015441 | ABC-type beta-glucan transporter activity |
1. PBF | GO:0043214 | ABC-type bacteriocin transporter activity |
1. PBF | GO:0140466 | iron-sulfur cluster export from the mitochondrion |
1. PBF | GO:0055085 | transmembrane transport |
1. PBF | GO:0140481 | ABC-type iron-sulfur cluster transporter activity |
1. PBF | GO:0015440 | ABC-type peptide transporter activity |
1. PBF | GO:0005886 | plasma membrane |
1. PBF | GO:0032585 | multivesicular body membrane |
1. PBF | GO:0042626 | ATPase-coupled transmembrane transporter activity |
1. PBF | GO:0006778 | porphyrin-containing compound metabolic process |
1. PBF | GO:0015462 | ABC-type protein transporter activity |
1. PBF | GO:0043213 | bacteriocin transport |
1. PBF | GO:0010312 | detoxification of zinc ion |
1. PBF | GO:0046906 | tetrapyrrole binding |
1. PBF | GO:0071996 | glutathione transmembrane import into vacuole |
1. PBF | GO:0015433 | ABC-type peptide antigen transporter activity |
1. PBF | GO:0036249 | cadmium ion import into vacuole |
1. PBF | GO:0140603 | obsolete ATP hydrolysis activity |
1. PBF | GO:0015031 | protein transport |
1. PBF | GO:0042883 | cysteine transport |
1. PBF | GO:1904680 | peptide transmembrane transporter activity |
1. PBF | GO:0031901 | early endosome membrane |
1. PBF | GO:0042825 | TAP complex |
1. PBF | GO:0005524 | ATP binding |
1. PBF | GO:0030256 | type I protein secretion system complex |
1. PBF | GO:0035351 | heme transmembrane transport |
1. PBF | GO:0033228 | cysteine export across plasma membrane |
1. PBF | GO:0070455 | positive regulation of heme biosynthetic process |
1. PBF | GO:0046872 | metal ion binding |
1. PBF | GO:0042168 | heme metabolic process |
1. PBF | GO:0036020 | endolysosome membrane |
1. PBF | GO:0090374 | oligopeptide export from mitochondrion |
1. PBF | GO:0030253 | protein secretion by the type I secretion system |
1. PBF | GO:0016021 | integral component of membrane |
1. PBF | GO:0034040 | ATPase-coupled lipid transmembrane transporter activity |
1. PBF | GO:0005737 | cytoplasm |
1. PBF | GO:0008559 | ABC-type xenobiotic transporter activity |
1. PBF | GO:0015833 | peptide transport |
1. PBF | GO:0006879 | cellular iron ion homeostasis |
1. PBF | GO:0031998 | regulation of fatty acid beta-oxidation |
1. PBF | GO:0046979 | TAP2 binding |
1. PBF | GO:0005576 | extracellular region |
1. PBF | GO:0046978 | TAP1 binding |
1. PBF | GO:1903232 | melanosome assembly |
1. PBF | GO:0030420 | establishment of competence for transformation |
1. PBF | GO:0005789 | endoplasmic reticulum membrane |
1. PBF | GO:0034775 | glutathione transmembrane transport |
1. PBF | GO:0008234 | cysteine-type peptidase activity |
1. PBF | GO:0015437 | lipopolysaccharide floppase activity |
1. PBF | GO:0036246 | phytochelatin 2 import into vacuole |
1. PBF | GO:0033013 | tetrapyrrole metabolic process |
1. PBF | GO:0098849 | cellular detoxification of cadmium ion |
1. PBF | GO:0140359 | ABC-type transporter activity |
1. PBF | GO:0055072 | iron ion homeostasis |
1. PBF | GO:0062157 | mitochondrial ATP-gated potassium channel complex |
1. PBF | GO:0015421 | ABC-type oligopeptide transporter activity |
1. PBF | GO:0002479 | antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent |
1. PBF | GO:0044604 | ABC-type phytochelatin transporter activity |
2. PF | GO:0016226 | iron-sulfur cluster assembly |
2. PF | GO:0005743 | mitochondrial inner membrane |
2. PF | GO:0008233 | peptidase activity |
2. PF | GO:0015772 | oligosaccharide transport |
2. PF | GO:0006811 | ion transport |
2. PF | GO:0042287 | MHC protein binding |
2. PF | GO:0006508 | proteolysis |
3. BF | GO:0006695 | cholesterol biosynthetic process |
3. BF | GO:0015108 | chloride transmembrane transporter activity |
3. BF | GO:0005887 | integral component of plasma membrane |
3. BF | GO:0030301 | cholesterol transport |
3. BF | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
3. BF | GO:0015721 | bile acid and bile salt transport |
3. BF | GO:1902476 | chloride transmembrane transport |
3. BF | GO:0071716 | leukotriene transport |
3. BF | GO:0015106 | bicarbonate transmembrane transporter activity |
3. BF | GO:0050891 | multicellular organismal water homeostasis |
3. BF | GO:0099038 | ceramide floppase activity |
3. BF | GO:0106138 | Sec61 translocon complex binding |
3. BF | GO:1990961 | xenobiotic detoxification by transmembrane export across the plasma membrane |
3. BF | GO:0000324 | fungal-type vacuole |
3. BF | GO:0005260 | intracellularly ATP-gated chloride channel activity |
3. BF | GO:0120189 | positive regulation of bile acid secretion |
3. BF | GO:0055038 | recycling endosome membrane |
3. BF | GO:0033285 | ATPase-coupled monocarboxylic acid transmembrane transporter activity |
3. BF | GO:0006904 | vesicle docking involved in exocytosis |
3. BF | GO:0045332 | phospholipid translocation |
3. BF | GO:1990962 | xenobiotic transport across blood-brain barrier |
3. BF | GO:1904251 | regulation of bile acid metabolic process |
3. BF | GO:0015431 | ABC-type glutathione S-conjugate transporter activity |
3. BF | GO:0015432 | ABC-type bile acid transporter activity |
3. BF | GO:0060081 | membrane hyperpolarization |
3. BF | GO:0030165 | PDZ domain binding |
3. BF | GO:0034976 | response to endoplasmic reticulum stress |
3. BF | GO:0071320 | cellular response to cAMP |
3. BF | GO:0099039 | sphingolipid translocation |
3. BF | GO:0034707 | chloride channel complex |
3. BF | GO:0035377 | transepithelial water transport |
3. BF | GO:0048240 | sperm capacitation |
3. BF | GO:1902943 | positive regulation of voltage-gated chloride channel activity |
3. BF | GO:0046581 | intercellular canaliculus |
3. BF | GO:0046865 | terpenoid transport |
3. BF | GO:0032376 | positive regulation of cholesterol transport |
3. BF | GO:1901557 | response to fenofibrate |
3. BF | GO:0016853 | isomerase activity |
3. BF | GO:0055091 | phospholipid homeostasis |
3. BF | GO:0005254 | chloride channel activity |
3. BF | GO:0006855 | xenobiotic transmembrane transport |
3. BF | GO:0015125 | bile acid transmembrane transporter activity |
3. BF | GO:0051454 | intracellular pH elevation |
3. BF | GO:1902161 | positive regulation of cyclic nucleotide-gated ion channel activity |
3. BF | GO:0015722 | canalicular bile acid transport |
3. BF | GO:0016324 | apical plasma membrane |
3. BF | GO:0015611 | ABC-type D-ribose transporter activity |
3. BF | GO:0046618 | xenobiotic export |
3. BF | GO:0008206 | bile acid metabolic process |
3. BF | GO:0034634 | glutathione transmembrane transporter activity |
3. BF | GO:0000770 | peptide pheromone export |
3. BF | GO:0005769 | early endosome |
3. BF | GO:0015126 | canalicular bile acid transmembrane transporter activity |
3. BF | GO:0045921 | positive regulation of exocytosis |
3. BF | GO:0019869 | chloride channel inhibitor activity |
3. BF | GO:0017144 | |
3. BF | GO:0090554 | phosphatidylcholine floppase activity |
3. BF | GO:0140328 | floppase activity |
3. BF | GO:1903413 | cellular response to bile acid |
3. BF | GO:0008281 | sulfonylurea receptor activity |
3. BF | GO:0046691 | intracellular canaliculus |
3. BF | GO:0042908 | xenobiotic transport |
3. BF | GO:1904322 | cellular response to forskolin |
3. BF | GO:0061092 | positive regulation of phospholipid translocation |
3. BF | GO:0015701 | bicarbonate transport |
4. PB | GO:0005324 | long-chain fatty acid transporter activity |
4. PB | GO:0042824 | MHC class I peptide loading complex |
4. PB | GO:0005778 | peroxisomal membrane |
4. PB | GO:0046980 | tapasin binding |
4. PB | GO:0055092 | sterol homeostasis |
4. PB | GO:0002489 | antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent |
4. PB | GO:0032000 | positive regulation of fatty acid beta-oxidation |
4. PB | GO:0015886 | heme transport |
4. PB | GO:0042288 | MHC class I protein binding |
4. PB | GO:1990535 | neuron projection maintenance |
4. PB | GO:0015562 | efflux transmembrane transporter activity |
4. PB | GO:0000038 | very long-chain fatty acid metabolic process |
4. PB | GO:0031288 | sorocarp morphogenesis |
4. PB | GO:0042758 | long-chain fatty acid catabolic process |
4. PB | GO:0019885 | antigen processing and presentation of endogenous peptide antigen via MHC class I |
4. PB | GO:0043217 | myelin maintenance |
4. PB | GO:0005779 | integral component of peroxisomal membrane |
4. PB | GO:0047617 | acyl-CoA hydrolase activity |
4. PB | GO:0010217 | cellular aluminum ion homeostasis |
4. PB | GO:1900407 | regulation of cellular response to oxidative stress |
4. PB | GO:1903427 | negative regulation of reactive oxygen species biosynthetic process |
4. PB | GO:0042605 | peptide antigen binding |
4. PB | GO:2001280 | positive regulation of unsaturated fatty acid biosynthetic process |
4. PB | GO:0005774 | vacuolar membrane |
4. PB | GO:0036113 | very long-chain fatty-acyl-CoA catabolic process |
4. PB | GO:0015607 | ABC-type fatty-acyl-CoA transporter activity |
4. PB | GO:0002485 | antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent |
4. PB | GO:1900016 | negative regulation of cytokine production involved in inflammatory response |
4. PB | GO:0005765 | lysosomal membrane |
4. PB | GO:0006635 | fatty acid beta-oxidation |
4. PB | GO:0046967 | cytosol to endoplasmic reticulum transport |
4. PB | GO:0042760 | very long-chain fatty acid catabolic process |
4. PB | GO:0042270 | protection from natural killer cell mediated cytotoxicity |
4. PB | GO:0046968 | peptide antigen transport |
4. PB | GO:0044847 | iron acquisition from host |
4. PB | GO:0042884 | microcin transport |
4. PB | GO:0002591 | positive regulation of antigen processing and presentation of peptide antigen via MHC class I |
4. PB | GO:1990748 | cellular detoxification |
4. PB | GO:0007031 | peroxisome organization |
4. PB | GO:1903331 | positive regulation of iron-sulfur cluster assembly |
4. PB | GO:0015916 | fatty-acyl-CoA transport |
4. PB | GO:0075139 | response to host iron concentration |
4. PB | GO:0015439 | ABC-type heme transporter activity |
4. PB | GO:0051900 | regulation of mitochondrial depolarization |
4. PB | GO:0071995 | phytochelatin import into vacuole |
4. PB | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
4. PB | GO:0009235 | cobalamin metabolic process |
4. PB | GO:1902602 | aluminum ion transmembrane transport |
4. PB | GO:0015910 | long-chain fatty acid import into peroxisome |
4. PB | GO:0002481 | antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent |
4. PB | GO:1902497 | iron-sulfur cluster transmembrane transport |
4. PB | GO:0023029 | MHC class Ib protein binding |
5. P | GO:0031307 | integral component of mitochondrial outer membrane |
5. P | GO:0071585 | detoxification of cadmium ion |
5. P | GO:0055089 | fatty acid homeostasis |
5. P | GO:0002237 | response to molecule of bacterial origin |
5. P | GO:0034204 | lipid translocation |
5. P | GO:0010044 | response to aluminum ion |
5. P | GO:0005777 | peroxisome |
5. P | GO:0046985 | positive regulation of hemoglobin biosynthetic process |
5. P | GO:0002082 | regulation of oxidative phosphorylation |
5. P | GO:0036109 | alpha-linolenic acid metabolic process |
5. P | GO:0001916 | positive regulation of T cell mediated cytotoxicity |
5. P | GO:0010380 | regulation of chlorophyll biosynthetic process |
5. P | GO:0043588 | skin development |
5. P | GO:0030497 | fatty acid elongation |
5. P | GO:0071805 | potassium ion transmembrane transport |
5. P | GO:0005739 | mitochondrion |
5. P | GO:0031966 | mitochondrial membrane |
5. P | GO:0034514 | mitochondrial unfolded protein response |
5. P | GO:0015889 | cobalamin transport |
5. P | GO:0045454 | cell redox homeostasis |
5. P | GO:0042803 | protein homodimerization activity |
5. P | GO:0070453 | regulation of heme biosynthetic process |
5. P | GO:0032592 | integral component of mitochondrial membrane |
5. P | GO:1902001 | fatty acid transmembrane transport |
5. P | GO:0014070 | response to organic cyclic compound |
5. P | GO:0071627 | integral component of fungal-type vacuolar membrane |
5. P | GO:0017000 | antibiotic biosynthetic process |
5. P | GO:0046686 | response to cadmium ion |
5. P | GO:0030670 | phagocytic vesicle membrane |
5. P | GO:0015920 | lipopolysaccharide transport |
5. P | GO:0006518 | peptide metabolic process |
5. P | GO:0043531 | ADP binding |
5. P | GO:0034755 | iron ion transmembrane transport |
5. P | GO:0009941 | chloroplast envelope |
5. P | GO:0005740 | mitochondrial envelope |
5. P | GO:0045648 | positive regulation of erythrocyte differentiation |
5. P | GO:0005782 | peroxisomal matrix |
5. P | GO:0006878 | cellular copper ion homeostasis |
5. P | GO:0015919 | peroxisomal membrane transport |
5. P | GO:0036269 | swimming behavior |
5. P | GO:1990170 | stress response to cadmium ion |
5. P | GO:0015083 | aluminum ion transmembrane transporter activity |
5. P | GO:0006779 | porphyrin-containing compound biosynthetic process |
5. P | GO:0043621 | protein self-association |
5. P | GO:0030176 | integral component of endoplasmic reticulum membrane |
5. P | GO:0005741 | mitochondrial outer membrane |
5. P | GO:0048821 | erythrocyte development |
5. P | GO:0002250 | adaptive immune response |
6. F | GO:0050729 | positive regulation of inflammatory response |
6. F | GO:0019899 | enzyme binding |
6. F | GO:0051087 | chaperone binding |
7. B | GO:1902995 | positive regulation of phospholipid efflux |
7. B | GO:0034188 | apolipoprotein A-I receptor activity |
7. B | GO:0010315 | auxin efflux |
7. B | GO:0014850 | response to muscle activity |
7. B | GO:1903785 | L-valine transmembrane transport |
7. B | GO:0005975 | carbohydrate metabolic process |
7. B | GO:0030145 | manganese ion binding |
7. B | GO:0006824 | cobalt ion transport |
7. B | GO:0140326 | ATPase-coupled intramembrane lipid transporter activity |
7. B | GO:0097254 | renal tubular secretion |
7. B | GO:0007584 | response to nutrient |
7. B | GO:0015438 | ABC-type teichoic acid transporter activity |
7. B | GO:0008272 | sulfate transport |
7. B | GO:0006649 | phospholipid transfer to membrane |
7. B | GO:0031154 | culmination involved in sorocarp development |
7. B | GO:0044873 | lipoprotein localization to membrane |
7. B | GO:0030003 | cellular cation homeostasis |
7. B | GO:0043211 | ABC-type carbohydrate transporter activity |
7. B | GO:0015675 | nickel cation transport |
7. B | GO:0090155 | negative regulation of sphingolipid biosynthetic process |
7. B | GO:0015225 | biotin transmembrane transporter activity |
7. B | GO:0042632 | cholesterol homeostasis |
7. B | GO:0019829 | ATPase-coupled cation transmembrane transporter activity |
7. B | GO:0015612 | ABC-type L-arabinose transporter activity |
7. B | GO:0061135 | endopeptidase regulator activity |
7. B | GO:0042441 | eye pigment metabolic process |
7. B | GO:1902418 | (+)-abscisic acid D-glucopyranosyl ester transmembrane transport |
7. B | GO:0038183 | bile acid signaling pathway |
7. B | GO:0098838 | folate transmembrane transport |
7. B | GO:1901140 | p-coumaryl alcohol transport |
7. B | GO:0008558 | ABC-type guanine transporter activity |
7. B | GO:0032383 | regulation of intracellular cholesterol transport |
7. B | GO:0006727 | ommochrome biosynthetic process |
7. B | GO:0089705 | protein localization to outer membrane |
7. B | GO:0006865 | amino acid transport |
7. B | GO:0007588 | excretion |
7. B | GO:1905601 | negative regulation of receptor-mediated endocytosis involved in cholesterol transport |
7. B | GO:0008514 | organic anion transmembrane transporter activity |
7. B | GO:0009926 | auxin polar transport |
7. B | GO:0015419 | ABC-type sulfate transporter activity |
7. B | GO:0003723 | RNA binding |
7. B | GO:0043481 | anthocyanin accumulation in tissues in response to UV light |
7. B | GO:0015842 | aminergic neurotransmitter loading into synaptic vesicle |
7. B | GO:0006413 | translational initiation |
7. B | GO:0005319 | lipid transporter activity |
7. B | GO:0071806 | protein transmembrane transport |
7. B | GO:0051301 | cell division |
7. B | GO:0009276 | Gram-negative-bacterium-type cell wall |
7. B | GO:0022857 | transmembrane transporter activity |
7. B | GO:0097233 | alveolar lamellar body membrane |
7. B | GO:0044874 | lipoprotein localization to outer membrane |
7. B | GO:0006412 | translation |
7. B | GO:0015416 | ABC-type phosphonate transporter activity |
7. B | GO:0015865 | purine nucleotide transport |
7. B | GO:0010328 | auxin influx transmembrane transporter activity |
7. B | GO:0005730 | nucleolus |
7. B | GO:1901086 | benzylpenicillin metabolic process |
7. B | GO:0016151 | nickel cation binding |
7. B | GO:0006856 | eye pigment precursor transport |
7. B | GO:0015878 | biotin transport |
7. B | GO:0000325 | plant-type vacuole |
7. B | GO:0015127 | bilirubin transmembrane transporter activity |
7. B | GO:0019389 | glucuronoside metabolic process |
7. B | GO:0015807 | L-amino acid transport |
7. B | GO:0120202 | rod photoreceptor disc membrane |
7. B | GO:0015434 | ABC-type cadmium transporter activity |
7. B | GO:0015418 | ABC-type quaternary ammonium compound transporting activity |
7. B | GO:0015625 | ABC-type ferric hydroxamate transporter activity |
7. B | GO:1905075 | positive regulation of tight junction disassembly |
7. B | GO:0070505 | pollen coat |
7. B | GO:0071714 | icosanoid transmembrane transporter activity |
7. B | GO:1902993 | positive regulation of amyloid precursor protein catabolic process |
7. B | GO:0051539 | 4 iron, 4 sulfur cluster binding |
7. B | GO:1901076 | positive regulation of engulfment of apoptotic cell |
7. B | GO:0042986 | positive regulation of amyloid precursor protein biosynthetic process |
7. B | GO:0015918 | sterol transport |
7. B | GO:0001573 | ganglioside metabolic process |
7. B | GO:0000287 | magnesium ion binding |
7. B | GO:0006687 | glycosphingolipid metabolic process |
7. B | GO:1901656 | glycoside transport |
7. B | GO:0034041 | ABC-type sterol transporter activity |
7. B | GO:0080168 | abscisic acid transport |
7. B | GO:0015436 | ABC-type capsular-polysaccharide transporter activity |
7. B | GO:0042882 | L-arabinose transmembrane transport |
7. B | GO:0003677 | DNA binding |
7. B | GO:1900721 | positive regulation of uterine smooth muscle relaxation |
7. B | GO:0008282 | inward rectifying potassium channel |
7. B | GO:0097708 | intracellular vesicle |
7. B | GO:0033700 | phospholipid efflux |
7. B | GO:0032218 | riboflavin transport |
7. B | GO:2000008 | regulation of protein localization to cell surface |
7. B | GO:0010043 | response to zinc ion |
7. B | GO:0009380 | excinuclease repair complex |
7. B | GO:0015614 | ABC-type D-xylose transporter activity |
7. B | GO:1905039 | carboxylic acid transmembrane transport |
7. B | GO:0015893 | |
7. B | GO:0005315 | inorganic phosphate transmembrane transporter activity |
7. B | GO:0016887 | ATP hydrolysis activity |
7. B | GO:0005503 | all-trans retinal binding |
7. B | GO:0042887 | amide transmembrane transporter activity |
7. B | GO:1904479 | negative regulation of intestinal absorption |
7. B | GO:1903805 | L-valine import across plasma membrane |
7. B | GO:0071072 | negative regulation of phospholipid biosynthetic process |
7. B | GO:0033762 | response to glucagon |
7. B | GO:0070633 | transepithelial transport |
7. B | GO:0042953 | lipoprotein transport |
7. B | GO:0098662 | inorganic cation transmembrane transport |
7. B | GO:0046677 | response to antibiotic |
7. B | GO:0010874 | regulation of cholesterol efflux |
7. B | GO:0046898 | response to cycloheximide |
7. B | GO:0046943 | carboxylic acid transmembrane transporter activity |
7. B | GO:0015414 | ABC-type nitrate transporter activity |
7. B | GO:2001225 | regulation of chloride transport |
7. B | GO:0008509 | anion transmembrane transporter activity |
7. B | GO:0030505 | inorganic diphosphate transport |
7. B | GO:0035672 | oligopeptide transmembrane transport |
7. B | GO:0015232 | heme transmembrane transporter activity |
7. B | GO:0006932 | substrate-dependent cell migration, cell contraction |
7. B | GO:0150110 | negative regulation of cholesterol esterification |
7. B | GO:0032217 | riboflavin transmembrane transporter activity |
7. B | GO:0015803 | branched-chain amino acid transport |
7. B | GO:0015412 | ABC-type molybdate transporter activity |
7. B | GO:0005654 | nucleoplasm |
7. B | GO:0031526 | brush border membrane |
7. B | GO:0090555 | phosphatidylethanolamine flippase activity |
7. B | GO:0015723 | bilirubin transport |
7. B | GO:0060049 | regulation of protein glycosylation |
7. B | GO:0001407 | glycerophosphodiester transmembrane transport |
7. B | GO:0090156 | cellular sphingolipid homeostasis |
7. B | GO:0015752 | D-ribose transmembrane transport |
7. B | GO:0008270 | zinc ion binding |
7. B | GO:1901238 | ABC-type tungstate transporter activity |
7. B | GO:0006289 | nucleotide-excision repair |
7. B | GO:0097232 | lamellar body membrane |
7. B | GO:0044857 | plasma membrane raft organization |
7. B | GO:0034436 | glycoprotein transport |
7. B | GO:0042959 | alkanesulfonate transmembrane transporter activity |
7. B | GO:0060919 | auxin influx |
7. B | GO:0090108 | positive regulation of high-density lipoprotein particle assembly |
7. B | GO:0033344 | cholesterol efflux |
7. B | GO:0023061 | signal release |
7. B | GO:0005501 | retinoid binding |
7. B | GO:0140394 | ABC-type azole transporter activity |
7. B | GO:0015087 | cobalt ion transmembrane transporter activity |
7. B | GO:0015694 | mercury ion transport |
7. B | GO:0032384 | negative regulation of intracellular cholesterol transport |
7. B | GO:0008494 | translation activator activity |
7. B | GO:0005304 | L-valine transmembrane transporter activity |
7. B | GO:0015132 | prostaglandin transmembrane transporter activity |
7. B | GO:0031152 | aggregation involved in sorocarp development |
7. B | GO:0015216 | purine nucleotide transmembrane transporter activity |
7. B | GO:0042401 | cellular biogenic amine biosynthetic process |
7. B | GO:1905948 | ABC-type 3',5'-cyclic GMP transmembrane transporter activity |
7. B | GO:1904486 | response to 17alpha-ethynylestradiol |
7. B | GO:1905604 | negative regulation of blood-brain barrier permeability |
7. B | GO:0046623 | sphingolipid floppase activity |
7. B | GO:0140345 | phosphatidylcholine flippase activity |
7. B | GO:0030299 | intestinal cholesterol absorption |
7. B | GO:0140327 | flippase activity |
7. B | GO:0031409 | pigment binding |
7. B | GO:0150172 | regulation of phosphatidylcholine metabolic process |
7. B | GO:0042493 | |
7. B | GO:0002790 | peptide secretion |
7. B | GO:0016020 | membrane |
7. B | GO:0015794 | glycerol-3-phosphate transmembrane transport |
7. B | GO:0042910 | xenobiotic transmembrane transporter activity |
7. B | GO:0005829 | cytosol |
7. B | GO:0033231 | carbohydrate export |
7. B | GO:0033212 | iron import into cell |
7. B | GO:0015633 | ABC-type zinc transporter activity |
7. B | GO:0070730 | cAMP transport |
7. B | GO:0150104 | transport across blood-brain barrier |
7. B | GO:0034375 | high-density lipoprotein particle remodeling |
7. B | GO:0010329 | auxin efflux transmembrane transporter activity |
7. B | GO:0005634 | nucleus |
7. B | GO:1901873 | regulation of post-translational protein modification |
7. B | GO:0070925 | organelle assembly |
7. B | GO:0015430 | ABC-type glycerol-3-phosphate transporter activity |
7. B | GO:1903064 | positive regulation of reverse cholesterol transport |
7. B | GO:0010222 | stem vascular tissue pattern formation |
7. B | GO:0031004 | potassium ion-transporting ATPase complex |
7. B | GO:0070894 | regulation of transposon integration |
7. B | GO:0097234 | epidermal lamellar body membrane |
7. B | GO:0048770 | pigment granule |
7. B | GO:0014045 | establishment of endothelial blood-brain barrier |
7. B | GO:0071403 | cellular response to high density lipoprotein particle stimulus |
7. B | GO:0032367 | intracellular cholesterol transport |
7. B | GO:0055088 | lipid homeostasis |
7. B | GO:0046471 | phosphatidylglycerol metabolic process |
7. B | GO:0005615 | extracellular space |
7. B | GO:0043225 | ATPase-coupled inorganic anion transmembrane transporter activity |
7. B | GO:0048545 | response to steroid hormone |
7. B | GO:0006633 | fatty acid biosynthetic process |
7. B | GO:0042941 | D-alanine transport |
7. B | GO:0015423 | ABC-type maltose transporter activity |
7. B | GO:0003336 | corneocyte desquamation |
7. B | GO:0010588 | cotyledon vascular tissue pattern formation |
7. B | GO:0032940 | secretion by cell |
7. B | GO:0009381 | excinuclease ABC activity |
7. B | GO:1904446 | positive regulation of establishment of Sertoli cell barrier |
7. B | GO:1903898 | negative regulation of PERK-mediated unfolded protein response |
7. B | GO:0043691 | reverse cholesterol transport |
7. B | GO:0103116 | ABC-type D-galactofuranose transporter |
7. B | GO:0055076 | transition metal ion homeostasis |
7. B | GO:0042599 | lamellar body |
7. B | GO:0097327 | response to antineoplastic agent |
7. B | GO:0015164 | glucuronoside transmembrane transporter activity |
7. B | GO:0016323 | basolateral plasma membrane |
7. B | GO:0007049 | cell cycle |
7. B | GO:0010872 | regulation of cholesterol esterification |
7. B | GO:0019534 | toxin transmembrane transporter activity |
7. B | GO:0006829 | zinc ion transport |
7. B | GO:0085042 | periarbuscular membrane |
7. B | GO:0015411 | ABC-type taurine transporter transporter activity |
7. B | GO:0035690 | |
7. B | GO:1990060 | maltose transport complex |
7. B | GO:0031459 | ABC-type glycine betaine transporter activity |
7. B | GO:0010290 | chlorophyll catabolite transmembrane transporter activity |
7. B | GO:0015188 | L-isoleucine transmembrane transporter activity |
7. B | GO:1901529 | positive regulation of anion channel activity |
7. B | GO:0008643 | carbohydrate transport |
7. B | GO:0010496 | intercellular transport |
7. B | GO:0120188 | regulation of bile acid secretion |
7. B | GO:0010875 | positive regulation of cholesterol efflux |
7. B | GO:1903806 | L-isoleucine import across plasma membrane |
7. B | GO:1905460 | negative regulation of vascular associated smooth muscle cell apoptotic process |
7. B | GO:0140306 | lipoprotein releasing activity |
7. B | GO:0097744 | renal urate salt excretion |
7. B | GO:0032368 | regulation of lipid transport |
7. B | GO:0009610 | response to symbiotic fungus |
7. B | GO:0098713 | leucine import across plasma membrane |
7. B | GO:0009507 | chloroplast |
7. B | GO:0042985 | negative regulation of amyloid precursor protein biosynthetic process |
7. B | GO:0046890 | regulation of lipid biosynthetic process |
7. B | GO:0015716 | organic phosphonate transport |
7. B | GO:0080051 | cutin transport |
7. B | GO:0015424 | ABC-type amino acid transporter activity |
7. B | GO:0015415 | ATPase-coupled phosphate ion transmembrane transporter activity |
7. B | GO:0016787 | hydrolase activity |
7. B | GO:0080172 | petal epidermis patterning |
7. B | GO:0098591 | external side of apical plasma membrane |
7. B | GO:0006686 | sphingomyelin biosynthetic process |
7. B | GO:0042888 | molybdenum ion transmembrane transporter activity |
7. B | GO:0005275 | amine transmembrane transporter activity |
7. B | GO:0015594 | ABC-type putrescine transporter activity |
7. B | GO:0099040 | ceramide translocation |
7. B | GO:0070731 | cGMP transport |
7. B | GO:0140357 | heme export from vacuole to cytoplasm |
7. B | GO:0045900 | negative regulation of translational elongation |
7. B | GO:0097208 | alveolar lamellar body |
7. B | GO:0015914 | phospholipid transport |
7. B | GO:0046415 | urate metabolic process |
7. B | GO:0015143 | urate transmembrane transporter activity |
7. B | GO:0090370 | negative regulation of cholesterol efflux |
7. B | GO:0019843 | rRNA binding |
7. B | GO:0090556 | phosphatidylserine floppase activity |
7. B | GO:0030504 | inorganic diphosphate transmembrane transporter activity |
7. B | GO:0010540 | basipetal auxin transport |
7. B | GO:0120020 | cholesterol transfer activity |
7. B | GO:0048225 | suberin network |
7. B | GO:0015847 | putrescine transport |
7. B | GO:1904411 | positive regulation of secretory granule organization |
7. B | GO:0001409 | guanine nucleotide transmembrane transporter activity |
7. B | GO:0003924 | GTPase activity |
7. B | GO:0043231 | intracellular membrane-bounded organelle |
7. B | GO:0010949 | negative regulation of intestinal phytosterol absorption |
7. B | GO:0061843 | Sertoli cell barrier remodeling |
7. B | GO:0015413 | ABC-type nickel transporter activity |
7. B | GO:1903714 | isoleucine transmembrane transport |
7. B | GO:0006869 | lipid transport |
7. B | GO:0005506 | iron ion binding |
7. B | GO:0048581 | negative regulation of post-embryonic development |
7. B | GO:0015711 | organic anion transport |
7. B | GO:0032464 | positive regulation of protein homooligomerization |
7. B | GO:0017004 | cytochrome complex assembly |
7. B | GO:0061855 | negative regulation of neuroblast migration |
7. B | GO:0032782 | bile acid secretion |
7. B | GO:2001140 | positive regulation of phospholipid transport |
7. B | GO:2000077 | negative regulation of type B pancreatic cell development |
7. B | GO:0006684 | sphingomyelin metabolic process |
7. B | GO:0090539 | peptide pheromone export by transmembrane transport |
7. B | GO:0006448 | regulation of translational elongation |
7. B | GO:0038027 | apolipoprotein A-I-mediated signaling pathway |
7. B | GO:0000049 | tRNA binding |
7. B | GO:0006638 | neutral lipid metabolic process |
7. B | GO:0031460 | glycine betaine transport |
7. B | GO:0032310 | prostaglandin secretion |
7. B | GO:0015599 | ATPase-coupled L-glutamine transmembrane transporter activity |
7. B | GO:0042160 | lipoprotein modification |
7. B | GO:0035444 | nickel cation transmembrane transport |
7. B | GO:0006817 | phosphate ion transport |
7. B | GO:0061337 | cardiac conduction |
7. B | GO:0032289 | central nervous system myelin formation |
7. B | GO:0033232 | ABC-type D-methionine transporter activity |
7. B | GO:0005525 | GTP binding |
7. B | GO:0006281 | DNA repair |
7. B | GO:0150094 | amyloid-beta clearance by cellular catabolic process |
7. B | GO:1902417 | (+)-abscisic acid D-glucopyranosyl ester transmembrane transporter activity |
7. B | GO:0097209 | epidermal lamellar body |
7. B | GO:0140341 | phosphatidylethanolamine floppase activity |
7. B | GO:0009245 | lipid A biosynthetic process |
7. B | GO:0015808 | L-alanine transport |
7. B | GO:0043129 | surfactant homeostasis |
7. B | GO:0032805 | positive regulation of low-density lipoprotein particle receptor catabolic process |
7. B | GO:0006357 | regulation of transcription by RNA polymerase II |
7. B | GO:0090740 | integral component of pigment granule membrane |
7. B | GO:1904375 | regulation of protein localization to cell periphery |
7. B | GO:2000032 | regulation of secondary shoot formation |
7. B | GO:1902004 | positive regulation of amyloid-beta formation |
7. B | GO:0015777 | teichoic acid transport |
7. B | GO:0015658 | branched-chain amino acid transmembrane transporter activity |
7. B | GO:0045796 | negative regulation of intestinal cholesterol absorption |
7. B | GO:2000010 | positive regulation of protein localization to cell surface |
7. B | GO:0000329 | fungal-type vacuole membrane |
7. B | GO:0140352 | export from cell |
7. B | GO:0140115 | export across plasma membrane |
7. B | GO:0034380 | high-density lipoprotein particle assembly |
7. B | GO:0102025 | ABC-type thiosulfate transporter activity |
7. B | GO:0015732 | prostaglandin transport |
7. B | GO:0015112 | nitrate transmembrane transporter activity |
7. B | GO:0035435 | phosphate ion transmembrane transport |
7. B | GO:0032379 | positive regulation of intracellular lipid transport |
7. B | GO:0048502 | ABC-type thiamine transporter activity |
7. B | GO:0055052 | ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing |
7. B | GO:0015747 | urate transport |
7. B | GO:0120019 | phosphatidylcholine transfer activity |
7. B | GO:0015192 | L-phenylalanine transmembrane transporter activity |
7. B | GO:0015823 | phenylalanine transport |
7. B | GO:0031088 | platelet dense granule membrane |
7. B | GO:0010345 | suberin biosynthetic process |
7. B | GO:0015190 | L-leucine transmembrane transporter activity |
7. B | GO:0035627 | ceramide transport |
7. B | GO:0015691 | cadmium ion transport |
7. B | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
7. B | GO:0005840 | ribosome |
7. B | GO:0009914 | hormone transport |
7. B | GO:0015408 | ABC-type ferric iron transporter activity |
7. B | GO:0015426 | ATPase-coupled polar amino acid-transporter activity |
7. B | GO:0140347 | N-retinylidene-phosphatidylethanolamine flippase activity |
7. B | GO:0015417 | ABC-type polyamine transporter activity |
7. B | GO:1902991 | regulation of amyloid precursor protein catabolic process |
7. B | GO:0030644 | cellular chloride ion homeostasis |
7. B | GO:1905887 | autoinducer AI-2 transmembrane transport |
7. B | GO:0005548 | phospholipid transporter activity |
7. B | GO:0098657 | import into cell |
7. B | GO:1905598 | negative regulation of low-density lipoprotein receptor activity |
7. B | GO:0020037 | heme binding |
7. B | GO:0015689 | molybdate ion transport |
7. B | GO:0031427 | response to methotrexate |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0055085 | transmembrane transport |
GO:0016021 | integral component of membrane |
GO:0016020 | membrane |
GO:0005524 | ATP binding |
GO:0140359 | ABC-type transporter activity |
GO:0000166 | nucleotide binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | P35598 | Putative ABC transporter ATP-binding protein exp8 | 0.00e+00 | 6.78e-55 | 1.62e-52 | 0.8981 |
1. PBF | Q5NIG3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.81e-65 | 7.94e-55 | 0.8569 |
1. PBF | Q04473 | Toxin RTX-III translocation ATP-binding protein | 0.00e+00 | 1.26e-12 | 1.07e-61 | 0.7615 |
1. PBF | Q71ED1 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 6.41e-57 | 5.98e-46 | 0.8351 |
1. PBF | Q6G868 | Putative multidrug export ATP-binding/permease protein SAS1788 | 0.00e+00 | 1.93e-61 | 3.58e-77 | 0.9019 |
1. PBF | Q5HEQ8 | Putative multidrug export ATP-binding/permease protein SACOL1924 | 0.00e+00 | 1.93e-61 | 3.58e-77 | 0.857 |
1. PBF | P16532 | Leukotoxin translocation ATP-binding protein LktB | 5.55e-16 | 3.26e-12 | 2.25e-63 | 0.7697 |
1. PBF | Q2FFM9 | Putative multidrug export ATP-binding/permease protein SAUSA300_1847 | 0.00e+00 | 1.93e-61 | 3.58e-77 | 0.905 |
1. PBF | Q8EDF0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.90e-56 | 1.08e-60 | 0.8128 |
1. PBF | Q57180 | Uncharacterized ABC transporter ATP-binding protein HI_1051 | 0.00e+00 | 2.89e-63 | 4.28e-58 | 0.8076 |
1. PBF | Q48P40 | ATP-dependent lipid A-core flippase | 0.00e+00 | 4.54e-54 | 4.97e-62 | 0.8298 |
1. PBF | Q92GP9 | Putative export ATP-binding/permease protein RC1073 | 0.00e+00 | 8.02e-59 | 4.46e-49 | 0.9077 |
1. PBF | P75095 | Putative ABC transporter ATP-binding protein MG014 homolog | 0.00e+00 | 2.87e-35 | 1.68e-22 | 0.7514 |
1. PBF | B2GUP8 | Mitochondrial potassium channel ATP-binding subunit | 0.00e+00 | 1.41e-19 | 2.28e-70 | 0.8951 |
1. PBF | Q93FH3 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 3.47e-12 | 3.30e-63 | 0.7569 |
1. PBF | Q13BH6 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 4.64e-60 | 6.64e-54 | 0.7924 |
1. PBF | Q00564 | Lactococcin-A transport/processing ATP-binding protein LcnC | 0.00e+00 | 2.79e-11 | 1.61e-37 | 0.7945 |
1. PBF | Q2J0F4 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 2.34e-58 | 1.67e-56 | 0.8017 |
1. PBF | Q9KQW9 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.26e-55 | 1.59e-53 | 0.8484 |
1. PBF | Q21NS8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.42e-59 | 6.05e-67 | 0.8334 |
1. PBF | Q933E0 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 3.41e-12 | 5.85e-64 | 0.7621 |
1. PBF | Q7W9N7 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.21e-54 | 9.92e-48 | 0.8974 |
1. PBF | Q0HTS8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 4.38e-57 | 1.06e-60 | 0.8051 |
1. PBF | Q8D2U8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.47e-59 | 4.82e-56 | 0.8687 |
1. PBF | Q20Z38 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 5.24e-60 | 6.41e-60 | 0.8145 |
1. PBF | Q9Y8G2 | ABC multidrug transporter atrC | 0.00e+00 | 1.37e-02 | 5.38e-57 | 0.8549 |
1. PBF | Q9JW59 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.74e-58 | 1.40e-56 | 0.8229 |
1. PBF | P0C086 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 3.07e-12 | 3.24e-63 | 0.7597 |
1. PBF | O31708 | Uncharacterized ABC transporter ATP-binding protein YknV | 0.00e+00 | 3.83e-62 | 4.66e-58 | 0.8606 |
1. PBF | Q8XXB6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.11e-59 | 1.17e-53 | 0.9006 |
1. PBF | Q7NZU6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.93e-56 | 8.25e-59 | 0.9011 |
1. PBF | Q8PKS5 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.01e-56 | 1.83e-39 | 0.8792 |
1. PBF | Q8FJB1 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.69e-55 | 2.49e-56 | 0.8888 |
1. PBF | Q4WLN7 | Iron-sulfur clusters transporter atm1, mitochondrial | 0.00e+00 | 1.91e-25 | 1.53e-53 | 0.7993 |
1. PBF | Q14JW6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.81e-65 | 7.94e-55 | 0.8436 |
1. PBF | Q0A4U4 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.29e-57 | 1.69e-54 | 0.8746 |
1. PBF | Q9EXN5 | Probable microcin-H47 secretion/processing ATP-binding protein MchF | 0.00e+00 | 5.58e-06 | 2.32e-27 | 0.7987 |
1. PBF | Q1QH37 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 8.92e-68 | 6.80e-58 | 0.8193 |
1. PBF | P0A2V0 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 1.20e-53 | 4.26e-45 | 0.8325 |
1. PBF | P59653 | Transport/processing ATP-binding protein ComA | 0.00e+00 | 4.41e-11 | 4.12e-43 | 0.8009 |
1. PBF | P63398 | Fatty acid ABC transporter ATP-binding/permease protein | 0.00e+00 | 5.06e-46 | 1.07e-50 | 0.7521 |
1. PBF | P9WQI8 | Hydrophilic compounds import ATP-binding/permease protein BacA | 4.44e-16 | 1.44e-21 | 4.60e-10 | 0.6373 |
1. PBF | Q4UMZ3 | Putative export ATP-binding/permease protein RF_0214 | 0.00e+00 | 1.81e-57 | 7.05e-49 | 0.8816 |
1. PBF | Q8YH20 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 2.49e-45 | 3.91e-50 | 0.8245 |
1. PBF | Q5E0F2 | ATP-dependent lipid A-core flippase | 0.00e+00 | 4.94e-54 | 1.97e-53 | 0.8283 |
1. PBF | Q5RFQ9 | Mitochondrial potassium channel ATP-binding subunit | 0.00e+00 | 9.94e-21 | 4.51e-74 | 0.8804 |
1. PBF | P10089 | Alpha-hemolysin translocation ATP-binding protein HlyB | 0.00e+00 | 1.74e-13 | 4.18e-66 | 0.7601 |
1. PBF | Q2ULH4 | Iron-sulfur clusters transporter atm1, mitochondrial | 0.00e+00 | 4.98e-25 | 3.63e-53 | 0.8293 |
1. PBF | Q55774 | Uncharacterized ABC transporter ATP-binding protein sll0182 | 1.56e-13 | 1.93e-11 | 7.54e-16 | 0.7166 |
1. PBF | Q6F9X0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 9.99e-52 | 5.86e-57 | 0.8706 |
1. PBF | P71082 | Putative multidrug export ATP-binding/permease protein YgaD | 0.00e+00 | 5.77e-59 | 1.05e-75 | 0.8537 |
1. PBF | Q5P2S7 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.21e-54 | 3.36e-54 | 0.8346 |
1. PBF | Q3J7R8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 9.28e-60 | 2.77e-56 | 0.8492 |
1. PBF | Q9X2W0 | Microcin-J25 export ATP-binding/permease protein McjD | 0.00e+00 | 6.45e-47 | 8.22e-30 | 0.7543 |
1. PBF | Q03203 | Nisin transport ATP-binding protein NisT | 0.00e+00 | 1.59e-35 | 1.81e-22 | 0.8531 |
1. PBF | Q46717 | Alpha-hemolysin translocation ATP-binding protein HlyB | 0.00e+00 | 1.81e-14 | 2.29e-58 | 0.766 |
1. PBF | Q3KJ31 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.09e-55 | 8.41e-60 | 0.8343 |
1. PBF | Q9CHL8 | Multidrug resistance ABC transporter ATP-binding and permease protein | 0.00e+00 | 2.26e-65 | 9.74e-63 | 0.8481 |
1. PBF | Q89A96 | Multidrug resistance-like ATP-binding protein MdlB | 0.00e+00 | 2.21e-54 | 4.01e-42 | 0.9226 |
1. PBF | Q8DAV2 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.82e-54 | 7.88e-51 | 0.8329 |
1. PBF | Q87R16 | ATP-dependent lipid A-core flippase | 0.00e+00 | 7.38e-54 | 4.49e-48 | 0.8415 |
1. PBF | Q83D84 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.09e-62 | 6.42e-59 | 0.8157 |
1. PBF | Q93FH2 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 2.23e-12 | 3.55e-63 | 0.7722 |
1. PBF | Q2YU20 | Putative multidrug export ATP-binding/permease protein SAB1799c | 0.00e+00 | 1.16e-60 | 2.93e-76 | 0.7969 |
1. PBF | Q6C6N0 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 2.06e-27 | 6.60e-51 | 0.8431 |
1. PBF | Q7AKE5 | ABC transporter ATP-binding protein RamB | 0.00e+00 | 5.33e-36 | 9.76e-19 | 0.7393 |
1. PBF | Q93FH6 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 2.23e-12 | 3.11e-63 | 0.7629 |
1. PBF | Q21WN9 | ATP-dependent lipid A-core flippase | 0.00e+00 | 6.00e-51 | 2.08e-53 | 0.835 |
1. PBF | Q6G2Z5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 4.19e-47 | 5.99e-51 | 0.7959 |
1. PBF | O88039 | ABC transporter ATP-binding protein RamA | 0.00e+00 | 2.20e-28 | 1.18e-18 | 0.7951 |
1. PBF | P59852 | Lactococcin-G-processing and transport ATP-binding protein LagD | 0.00e+00 | 2.55e-10 | 1.88e-47 | 0.8051 |
1. PBF | Q87VF3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 4.53e-55 | 6.25e-61 | 0.8336 |
1. PBF | Q8ZGA9 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.74e-53 | 2.90e-56 | 0.8786 |
1. PBF | Q0VQP5 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.41e-58 | 2.56e-59 | 0.8403 |
1. PBF | Q4FS42 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.61e-61 | 1.16e-51 | 0.8388 |
1. PBF | Q933I3 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 1.69e-12 | 1.17e-64 | 0.7601 |
1. PBF | P57552 | Multidrug resistance-like ATP-binding protein MdlB | 0.00e+00 | 1.24e-54 | 2.29e-33 | 0.9153 |
1. PBF | Q0HHH4 | ATP-dependent lipid A-core flippase | 0.00e+00 | 4.38e-57 | 1.06e-60 | 0.7905 |
1. PBF | Q5H0H0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 7.67e-58 | 1.68e-41 | 0.9025 |
1. PBF | P47261 | Putative ABC transporter ATP-binding protein MG015 | 0.00e+00 | 1.55e-56 | 1.09e-50 | 0.8683 |
1. PBF | Q12M46 | ATP-dependent lipid A-core flippase | 0.00e+00 | 7.70e-56 | 7.27e-58 | 0.8172 |
1. PBF | Q2KYS6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 8.14e-64 | 1.32e-52 | 0.889 |
1. PBF | Q142P6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.86e-57 | 1.17e-49 | 0.9024 |
1. PBF | Q8FDZ8 | Alpha-hemolysin translocation ATP-binding protein HlyB | 0.00e+00 | 2.38e-13 | 1.45e-66 | 0.7596 |
1. PBF | Q1GZI0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.30e-56 | 2.78e-61 | 0.864 |
1. PBF | P23702 | Leukotoxin export ATP-binding protein LtxB | 0.00e+00 | 4.22e-15 | 4.49e-61 | 0.7645 |
1. PBF | P33951 | ATP-binding protein SyrD | 0.00e+00 | 8.63e-28 | 4.87e-13 | 0.7272 |
1. PBF | Q3BTC8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 9.67e-57 | 2.20e-39 | 0.8891 |
1. PBF | Q4PH16 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 1.01e-15 | 3.36e-50 | 0.8211 |
1. PBF | P97046 | Multidrug resistance ABC transporter ATP-binding and permease protein | 0.00e+00 | 2.48e-65 | 4.43e-62 | 0.86 |
1. PBF | Q60AA3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.02e-62 | 1.12e-61 | 0.8246 |
1. PBF | Q751N2 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 7.16e-30 | 9.14e-44 | 0.8278 |
1. PBF | Q9CJB8 | Lactococcin transport/processing ATP-binding protein LcnC-like | 0.00e+00 | 2.09e-10 | 7.49e-38 | 0.7923 |
1. PBF | P57551 | Multidrug resistance-like ATP-binding protein MdlA | 0.00e+00 | 1.05e-33 | 2.93e-37 | 0.8499 |
1. PBF | P9WQJ0 | Uncharacterized ABC transporter ATP-binding protein MT1311 | 0.00e+00 | 6.32e-37 | 1.33e-38 | 0.8828 |
1. PBF | Q47JR8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.19e-56 | 1.20e-50 | 0.9157 |
1. PBF | Q7ANN4 | Type I secretion system ATP-binding protein PrsD | 2.18e-14 | 2.10e-27 | 2.86e-21 | 0.7642 |
1. PBF | Q6AJW3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.30e-56 | 1.09e-59 | 0.8382 |
1. PBF | Q66CI3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.74e-53 | 2.90e-56 | 0.8941 |
1. PBF | Q7MJ07 | ATP-dependent lipid A-core flippase | 0.00e+00 | 6.97e-54 | 3.73e-51 | 0.8336 |
1. PBF | Q7N6C6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.13e-55 | 1.59e-48 | 0.8786 |
1. PBF | Q5AV01 | ABC transporter atnG | 6.00e-15 | 4.08e-03 | 2.02e-23 | 0.8013 |
1. PBF | P55122 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 4.56e-12 | 2.79e-64 | 0.7578 |
1. PBF | P63359 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.55e-56 | 8.77e-57 | 0.8785 |
1. PBF | Q31YT6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.13e-55 | 3.02e-56 | 0.8348 |
1. PBF | A0R6H7 | Mycobactin import ATP-binding/permease protein IrtB | 0.00e+00 | 1.09e-45 | 1.02e-35 | 0.825 |
1. PBF | Q1CA68 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.74e-53 | 2.90e-56 | 0.8921 |
1. PBF | Q12C33 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.88e-60 | 2.14e-39 | 0.8859 |
1. PBF | Q32E34 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.13e-55 | 3.02e-56 | 0.8262 |
1. PBF | Q57R14 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.55e-56 | 8.77e-57 | 0.8738 |
1. PBF | P0DKX5 | Cyclolysin secretion/processing ATP-binding protein CyaB | 0.00e+00 | 3.93e-13 | 9.68e-47 | 0.8091 |
1. PBF | P0C087 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 3.07e-12 | 3.24e-63 | 0.7606 |
1. PBF | Q0TJD9 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.69e-55 | 2.49e-56 | 0.8873 |
1. PBF | P0AAG7 | Multidrug resistance-like ATP-binding protein MdlB | 0.00e+00 | 2.20e-47 | 8.50e-41 | 0.8731 |
1. PBF | P23596 | Proteases secretion ATP-binding protein PrtD | 2.22e-15 | 1.72e-29 | 3.21e-21 | 0.7654 |
1. PBF | Q2UPC0 | ABC transporter aclQ | 0.00e+00 | 5.70e-14 | 6.42e-60 | 0.8398 |
1. PBF | P54719 | Uncharacterized ABC transporter ATP-binding protein YfiC | 0.00e+00 | 1.94e-63 | 3.77e-61 | 0.8417 |
1. PBF | P08716 | Alpha-hemolysin translocation ATP-binding protein HlyB | 0.00e+00 | 3.87e-13 | 7.61e-66 | 0.7562 |
1. PBF | Q47908 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.41e-64 | 3.93e-50 | 0.8564 |
1. PBF | P68579 | SPbeta prophage-derived sublancin-168-processing and transport ATP-binding protein SunT | 0.00e+00 | 3.57e-06 | 5.68e-20 | 0.8106 |
1. PBF | Q89UT8 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 5.70e-55 | 1.68e-52 | 0.8009 |
1. PBF | Q52402 | Transport ATP-binding protein AarD | 0.00e+00 | 2.92e-37 | 1.78e-25 | 0.8746 |
1. PBF | P63394 | Mycobactin import ATP-binding/permease protein IrtB | 0.00e+00 | 1.12e-45 | 4.38e-38 | 0.8139 |
1. PBF | P70864 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 8.08e-48 | 6.61e-50 | 0.8179 |
1. PBF | Q88D92 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.22e-57 | 8.45e-63 | 0.8365 |
1. PBF | Q9PEE7 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.25e-59 | 4.53e-43 | 0.8697 |
1. PBF | Q31FG2 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.08e-58 | 4.86e-52 | 0.8618 |
1. PBF | Q6N1Y7 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 4.74e-62 | 3.42e-54 | 0.8057 |
1. PBF | Q39E73 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.23e-60 | 8.45e-48 | 0.8972 |
1. PBF | Q4WPP6 | ABC multidrug transporter mdr2 | 0.00e+00 | 8.84e-13 | 1.70e-66 | 0.8635 |
1. PBF | O07549 | Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH | 0.00e+00 | 2.52e-37 | 3.01e-50 | 0.8268 |
1. PBF | Q5PGH0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.54e-57 | 1.14e-56 | 0.8886 |
1. PBF | Q1BUV6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.71e-61 | 3.81e-46 | 0.8835 |
1. PBF | H2LNR5 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 0.00e+00 | 3.03e-19 | 8.59e-53 | 0.7652 |
1. PBF | Q2HIE9 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 3.31e-43 | 1.03e-54 | 0.8036 |
1. PBF | Q10418 | Mesentericin-Y105 transport/processing ATP-binding protein MesD | 0.00e+00 | 1.28e-09 | 5.22e-41 | 0.7916 |
1. PBF | O07550 | Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI | 0.00e+00 | 1.41e-35 | 3.52e-52 | 0.8544 |
1. PBF | Q2SIN5 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.99e-53 | 2.71e-69 | 0.8549 |
1. PBF | Q3IGX5 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.09e-54 | 1.96e-57 | 0.8426 |
1. PBF | Q480N3 | ATP-dependent lipid A-core flippase 2 | 0.00e+00 | 9.72e-56 | 1.93e-47 | 0.8594 |
1. PBF | Q5ZUH9 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.21e-62 | 6.47e-61 | 0.8413 |
1. PBF | Q5WVN2 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.91e-62 | 1.58e-57 | 0.8354 |
1. PBF | Q7RX59 | Iron-sulfur clusters transporter atm1, mitochondrial | 0.00e+00 | 7.39e-23 | 7.69e-52 | 0.8062 |
1. PBF | Q9WYC4 | Uncharacterized ABC transporter ATP-binding protein TM_0288 | 0.00e+00 | 4.00e-58 | 4.90e-68 | 0.829 |
1. PBF | Q2NUA5 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.98e-52 | 8.84e-52 | 0.887 |
1. PBF | Q6GFJ1 | Putative multidrug export ATP-binding/permease protein SAR1956 | 0.00e+00 | 1.93e-61 | 3.58e-77 | 0.8551 |
1. PBF | Q6CX96 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 1.07e-20 | 3.61e-45 | 0.8028 |
1. PBF | Q46Y89 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.93e-56 | 2.65e-54 | 0.9061 |
1. PBF | Q7VR44 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.48e-63 | 4.98e-44 | 0.8777 |
1. PBF | Q4KJB2 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.87e-53 | 6.81e-62 | 0.8341 |
1. PBF | Q2G506 | ATM1-type heavy metal exporter | 0.00e+00 | 4.92e-57 | 1.59e-42 | 0.8108 |
1. PBF | P54718 | Uncharacterized ABC transporter ATP-binding protein YfiB | 0.00e+00 | 5.27e-43 | 1.43e-47 | 0.7964 |
1. PBF | Q0P9C4 | Protein glycosylation K | 0.00e+00 | 6.72e-50 | 3.29e-31 | 0.8304 |
1. PBF | P22520 | Colicin V secretion/processing ATP-binding protein CvaB | 0.00e+00 | 4.72e-06 | 9.60e-27 | 0.7677 |
1. PBF | Q6BXD7 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 6.93e-24 | 1.35e-44 | 0.7773 |
1. PBF | Q1LQD3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.89e-57 | 6.98e-50 | 0.8922 |
1. PBF | Q03024 | Alkaline protease secretion ATP-binding protein AprD | 6.75e-14 | 1.44e-21 | 1.66e-23 | 0.7482 |
1. PBF | Q08D64 | ATP-binding cassette sub-family B member 6 | 0.00e+00 | 4.56e-12 | 2.80e-47 | 0.8577 |
1. PBF | P9WQJ2 | Fatty acid ABC transporter ATP-binding/permease protein | 0.00e+00 | 5.06e-46 | 1.07e-50 | 0.7638 |
1. PBF | Q9JXR3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 7.45e-58 | 1.11e-57 | 0.8066 |
1. PBF | Q5X498 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.36e-63 | 1.67e-58 | 0.8351 |
1. PBF | P18767 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 3.02e-55 | 4.81e-41 | 0.8445 |
1. PBF | Q1QBW0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.86e-64 | 2.08e-52 | 0.7973 |
1. PBF | G7CBF6 | Mycobactin import ATP-binding/permease protein IrtB | 0.00e+00 | 3.13e-46 | 4.55e-38 | 0.8079 |
1. PBF | Q492S9 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.28e-54 | 6.89e-49 | 0.8246 |
1. PBF | P94367 | ATP-binding/permease protein CydD | 0.00e+00 | 2.27e-35 | 3.52e-34 | 0.8661 |
1. PBF | Q8SQI5 | Probable ABC transporter ECU01_0200/ECU01_1410 | 0.00e+00 | 2.17e-42 | 1.19e-18 | 0.7973 |
1. PBF | P45081 | ATP-binding/permease protein CydC | 0.00e+00 | 7.87e-38 | 4.45e-34 | 0.8163 |
1. PBF | Q9CMG7 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.98e-53 | 1.64e-57 | 0.8802 |
1. PBF | P45861 | Uncharacterized ABC transporter ATP-binding protein YwjA | 0.00e+00 | 2.02e-58 | 4.02e-84 | 0.8932 |
1. PBF | Q1RDU4 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.69e-55 | 2.49e-56 | 0.8872 |
1. PBF | Q3JUI6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.77e-59 | 6.14e-50 | 0.89 |
1. PBF | Q1RJ91 | Putative export ATP-binding/permease protein RBE_0492 | 0.00e+00 | 3.83e-56 | 4.80e-50 | 0.8902 |
1. PBF | Q2YQ73 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 6.60e-45 | 5.22e-50 | 0.8382 |
1. PBF | Q9ZNB0 | Uncharacterized ABC transporter ATP-binding protein SCO0742 | 0.00e+00 | 1.65e-46 | 1.39e-37 | 0.8571 |
1. PBF | Q2LVL0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 6.23e-57 | 3.95e-69 | 0.8787 |
1. PBF | Q15UY7 | ATP-dependent lipid A-core flippase | 0.00e+00 | 8.05e-61 | 2.61e-57 | 0.8312 |
1. PBF | Q8G0T8 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 1.76e-45 | 1.58e-50 | 0.8258 |
1. PBF | Q2A1U9 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.49e-66 | 1.80e-53 | 0.8462 |
1. PBF | P9WQJ6 | Mycobactin import ATP-binding/permease protein IrtB | 0.00e+00 | 1.12e-45 | 4.38e-38 | 0.7899 |
1. PBF | P0A2V1 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 1.20e-53 | 4.26e-45 | 0.8446 |
1. PBF | Q3Z3K7 | ATP-dependent lipid A-core flippase | 0.00e+00 | 4.66e-55 | 1.02e-55 | 0.894 |
1. PBF | P75094 | Putative ABC transporter ATP-binding protein MG015 homolog | 0.00e+00 | 1.14e-49 | 1.18e-49 | 0.8836 |
1. PBF | P44407 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.35e-52 | 9.42e-58 | 0.8218 |
1. PBF | P55469 | Uncharacterized ABC transporter ATP-binding protein y4gM | 0.00e+00 | 3.19e-65 | 2.60e-60 | 0.8286 |
1. PBF | Q89A97 | Multidrug resistance-like ATP-binding protein MdlA | 0.00e+00 | 8.65e-41 | 9.83e-39 | 0.8727 |
1. PBF | Q7VL52 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.64e-56 | 5.16e-54 | 0.8336 |
1. PBF | Q6LPK6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 7.54e-52 | 9.65e-57 | 0.8329 |
1. PBF | P37608 | Lacticin-481/lactococcin-DR transport/processing ATP-binding protein lcnDR3 | 0.00e+00 | 1.52e-09 | 1.32e-17 | 0.7179 |
1. PBF | P0CL93 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 2.93e-18 | 6.49e-51 | 0.8274 |
1. PBF | P22638 | Heterocyst differentiation ATP-binding protein HepA | 0.00e+00 | 4.95e-64 | 1.32e-58 | 0.7968 |
1. PBF | Q2P3E7 | ATP-dependent lipid A-core flippase | 0.00e+00 | 7.67e-58 | 1.68e-41 | 0.8863 |
1. PBF | Q4HVU7 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 1.91e-25 | 3.75e-53 | 0.8169 |
1. PBF | Q9RCG7 | Exotoxin translocation ATP-binding protein PaxB | 0.00e+00 | 3.42e-13 | 3.23e-63 | 0.7595 |
1. PBF | Q1QX69 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.11e-54 | 3.85e-63 | 0.861 |
1. PBF | Q8P8W4 | ATP-dependent lipid A-core flippase | 0.00e+00 | 8.77e-59 | 1.12e-41 | 0.8788 |
1. PBF | P71355 | Uncharacterized ABC transporter ATP-binding protein HI_0663 | 0.00e+00 | 1.48e-35 | 2.31e-26 | 0.8038 |
1. PBF | Q4ZZ16 | ATP-dependent lipid A-core flippase | 0.00e+00 | 7.82e-54 | 4.69e-59 | 0.8318 |
1. PBF | P45221 | Uncharacterized ABC transporter ATP-binding protein HI_1467 | 1.11e-16 | 5.64e-28 | 3.30e-08 | 0.7013 |
1. PBF | P33116 | Subtilin transport ATP-binding protein SpaT | 0.00e+00 | 4.99e-34 | 1.15e-28 | 0.8167 |
1. PBF | Q7VWD8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.32e-54 | 1.10e-47 | 0.8503 |
1. PBF | Q47258 | Alpha-hemolysin translocation ATP-binding protein HlyB | 0.00e+00 | 1.46e-13 | 1.19e-65 | 0.7682 |
1. PBF | Q7A0J1 | Putative multidrug export ATP-binding/permease protein MW1806 | 0.00e+00 | 1.93e-61 | 3.58e-77 | 0.8562 |
1. PBF | Q3SFZ6 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.55e-50 | 1.19e-57 | 0.9036 |
1. PBF | Q83LP0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.13e-55 | 5.32e-56 | 0.8887 |
1. PBF | Q93FH0 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 3.21e-12 | 3.89e-63 | 0.7584 |
1. PBF | P0CL92 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 3.43e-18 | 5.94e-51 | 0.8399 |
1. PBF | J9VWU3 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 2.53e-20 | 3.09e-50 | 0.8407 |
1. PBF | Q6FZF2 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 2.65e-47 | 4.28e-49 | 0.7791 |
1. PBF | P0DKX6 | Cyclolysin secretion/processing ATP-binding protein CyaB | 0.00e+00 | 2.10e-13 | 8.62e-47 | 0.8081 |
1. PBF | Q2K342 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 5.12e-56 | 2.38e-46 | 0.8139 |
1. PBF | Q8K985 | Multidrug resistance-like ATP-binding protein MdlA | 0.00e+00 | 5.63e-45 | 9.89e-44 | 0.8623 |
1. PBF | Q6D437 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.60e-54 | 2.07e-58 | 0.8263 |
1. PBF | Q5QU36 | ATP-dependent lipid A-core flippase | 0.00e+00 | 3.63e-51 | 2.73e-61 | 0.847 |
1. PBF | P45082 | ATP-binding/permease protein CydD | 0.00e+00 | 2.42e-36 | 6.55e-21 | 0.8375 |
1. PBF | Q03727 | Transport/processing ATP-binding protein ComA | 0.00e+00 | 6.65e-11 | 2.61e-43 | 0.7893 |
1. PBF | Q1MAB5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 1.50e-56 | 5.47e-44 | 0.8416 |
1. PBF | Q28433 | Antigen peptide transporter 1 | 0.00e+00 | 4.25e-13 | 3.27e-36 | 0.8505 |
1. PBF | Q2SZW0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 6.05e-58 | 6.20e-50 | 0.9061 |
1. PBF | Q9HUG8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 8.66e-56 | 9.48e-65 | 0.8248 |
1. PBF | Q4UV65 | ATP-dependent lipid A-core flippase | 0.00e+00 | 8.77e-59 | 1.12e-41 | 0.8825 |
1. PBF | A0A125QXJ1 | ATP-binding cassette sub-family B member 6 | 0.00e+00 | 3.33e-08 | 4.04e-54 | 0.8444 |
1. PBF | Q57538 | Probable ABC transporter ATP-binding/permease protein HI_0664 | 0.00e+00 | 4.59e-44 | 9.20e-45 | 0.8238 |
1. PBF | Q68W42 | Putative export ATP-binding/permease protein RT0691 | 0.00e+00 | 6.59e-55 | 3.29e-45 | 0.8911 |
1. PBF | P63360 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.55e-56 | 8.77e-57 | 0.8785 |
1. PBF | P26760 | Toxin RTX-I translocation ATP-binding protein | 0.00e+00 | 4.70e-14 | 3.79e-62 | 0.7716 |
1. PBF | A1USS5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 5.53e-48 | 9.29e-51 | 0.8215 |
1. PBF | Q5F4X8 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.75e-57 | 4.54e-56 | 0.8255 |
1. PBF | P36497 | Pediocin PA-1 transport/processing ATP-binding protein PedD | 0.00e+00 | 7.05e-11 | 3.98e-39 | 0.7866 |
1. PBF | O31707 | Uncharacterized ABC transporter ATP-binding protein YknU | 0.00e+00 | 2.77e-50 | 1.12e-72 | 0.893 |
1. PBF | Q080T2 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.64e-55 | 3.46e-61 | 0.8722 |
1. PBF | Q87EF0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.03e-59 | 8.80e-44 | 0.883 |
1. PBF | P97998 | ATP-dependent permease MDL1 | 0.00e+00 | 1.42e-23 | 6.80e-65 | 0.8477 |
1. PBF | Q0I4C5 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.70e-54 | 5.07e-55 | 0.8769 |
1. PBF | P47260 | Putative ABC transporter ATP-binding protein MG014 | 0.00e+00 | 2.40e-33 | 8.11e-20 | 0.7682 |
1. PBF | Q5B1Q2 | Iron-sulfur clusters transporter atm1, mitochondrial | 0.00e+00 | 1.80e-23 | 7.70e-53 | 0.8076 |
1. PBF | P0AAG6 | Multidrug resistance-like ATP-binding protein MdlB | 0.00e+00 | 2.20e-47 | 8.50e-41 | 0.8863 |
1. PBF | Q6FIK3 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 5.64e-18 | 1.10e-43 | 0.8183 |
1. PBF | Q9ZCM8 | Putative export ATP-binding/permease protein RP696 | 0.00e+00 | 1.34e-55 | 2.52e-50 | 0.9046 |
1. PBF | P60753 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.13e-55 | 3.02e-56 | 0.827 |
1. PBF | Q99T13 | Putative multidrug export ATP-binding/permease protein SAV1866 | 0.00e+00 | 1.93e-61 | 3.58e-77 | 0.8579 |
1. PBF | Q0BKJ3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.49e-66 | 1.80e-53 | 0.8446 |
1. PBF | Q7WH20 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.21e-54 | 9.92e-48 | 0.8501 |
1. PBF | Q3SP57 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 3.45e-58 | 7.12e-63 | 0.8108 |
1. PBF | Q1CGH0 | ATP-dependent lipid A-core flippase | 0.00e+00 | 1.74e-53 | 2.90e-56 | 0.8888 |
1. PBF | Q8K984 | Multidrug resistance-like ATP-binding protein MdlB | 0.00e+00 | 2.46e-55 | 1.05e-40 | 0.921 |
1. PBF | P0C529 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 6.60e-45 | 5.22e-50 | 0.826 |
1. PBF | P0A4W5 | Uncharacterized ABC transporter ATP-binding protein Mb1304c | 0.00e+00 | 6.17e-37 | 1.42e-38 | 0.8725 |
1. PBF | P11599 | Alpha-hemolysin translocation ATP-binding protein HlyB | 0.00e+00 | 1.91e-13 | 4.49e-59 | 0.7614 |
1. PBF | Q63VX7 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.77e-59 | 6.14e-50 | 0.8892 |
1. PBF | Q7A4T3 | Putative multidrug export ATP-binding/permease protein SA1683 | 0.00e+00 | 1.93e-61 | 3.58e-77 | 0.8532 |
1. PBF | O06967 | Multidrug resistance ABC transporter ATP-binding/permease protein BmrA | 0.00e+00 | 6.92e-61 | 1.61e-64 | 0.8643 |
1. PBF | Q93FG6 | Leukotoxin translocation ATP-binding protein LktB | 0.00e+00 | 3.80e-12 | 1.38e-62 | 0.7705 |
1. PBF | Q07QX6 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 2.39e-60 | 3.56e-58 | 0.8091 |
1. PBF | Q483B6 | ATP-dependent lipid A-core flippase 1 | 0.00e+00 | 1.66e-66 | 1.66e-63 | 0.8117 |
1. PBF | Q4QPI4 | ATP-dependent lipid A-core flippase | 0.00e+00 | 4.15e-55 | 9.42e-58 | 0.8689 |
1. PBF | Q983H5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 0.00e+00 | 2.24e-52 | 6.15e-44 | 0.8177 |
1. PBF | Q65U21 | ATP-dependent lipid A-core flippase | 0.00e+00 | 4.64e-57 | 6.04e-58 | 0.8702 |
1. PBF | P94366 | ATP-binding/permease protein CydC | 0.00e+00 | 1.61e-26 | 2.15e-27 | 0.7701 |
1. PBF | Q62IG3 | ATP-dependent lipid A-core flippase | 0.00e+00 | 5.77e-59 | 6.14e-50 | 0.8874 |
2. PF | P75207 | Putative ABC transporter ATP-binding MG390 homolog | 9.37e-11 | 2.74e-04 | NA | 0.535 |
2. PF | Q49430 | Putative ABC transporter ATP-binding MG390 | 8.99e-14 | 6.07e-06 | NA | 0.5999 |
3. BF | A0A059JJ46 | ABC multidrug transporter MDR2 | 0.00e+00 | NA | 4.67e-63 | 0.8195 |
3. BF | Q8J2Q1 | ABC transporter FUM19 | 2.14e-14 | NA | 7.34e-14 | 0.753 |
3. BF | G4N2B5 | ABC transporter 7 | 9.41e-11 | NA | 5.35e-22 | 0.7025 |
3. BF | F2RPA4 | ABC multidrug transporter MDR2 | 0.00e+00 | NA | 9.35e-42 | 0.8166 |
3. BF | P9WQI6 | Uncharacterized ABC transporter ATP-binding protein MT2388 | 6.99e-05 | NA | 1.29e-04 | 0.3507 |
3. BF | Q7JII7 | Cystic fibrosis transmembrane conductance regulator | 1.01e-09 | NA | 2.47e-19 | 0.6636 |
3. BF | Q2IBB3 | Cystic fibrosis transmembrane conductance regulator | 2.30e-11 | NA | 6.24e-19 | 0.6898 |
3. BF | A2XCD4 | ABC transporter C family member 13 | 1.22e-15 | NA | 8.17e-26 | 0.7727 |
3. BF | P21441 | Multidrug resistance protein | 7.66e-15 | NA | 6.22e-19 | 0.7539 |
3. BF | P35071 | Cystic fibrosis transmembrane conductance regulator | 7.63e-10 | NA | 2.07e-19 | 0.6824 |
3. BF | P82451 | ATP-binding cassette sub-family C member 9 | 2.70e-11 | NA | 2.28e-20 | 0.7214 |
3. BF | A0A179H0T5 | ABC multidrug transporter lscH | 3.44e-15 | NA | 6.76e-16 | 0.7888 |
3. BF | Q4WSI1 | ABC multidrug transporter mdr4 | 0.00e+00 | NA | 1.88e-42 | 0.7906 |
3. BF | Q28689 | ATP-binding cassette sub-family C member 2 | 4.22e-15 | NA | 4.49e-24 | 0.7498 |
3. BF | Q07DX5 | Cystic fibrosis transmembrane conductance regulator | 7.76e-10 | NA | 1.38e-19 | 0.6877 |
3. BF | A0R6H8 | Mycobactin import ATP-binding/permease protein IrtA | 8.99e-14 | NA | 8.32e-43 | 0.7126 |
3. BF | Q2QL83 | Cystic fibrosis transmembrane conductance regulator | 3.84e-11 | NA | 3.15e-18 | 0.6816 |
3. BF | Q07E16 | Cystic fibrosis transmembrane conductance regulator | 6.91e-10 | NA | 5.43e-19 | 0.677 |
3. BF | Q4WD46 | ABC-type transporter fsqE | 0.00e+00 | NA | 5.02e-52 | 0.761 |
3. BF | Q2QLB4 | Cystic fibrosis transmembrane conductance regulator | 4.51e-11 | NA | 7.31e-20 | 0.6811 |
3. BF | Q2QLC5 | Cystic fibrosis transmembrane conductance regulator | 2.66e-11 | NA | 5.40e-20 | 0.6892 |
3. BF | Q5F364 | Multidrug resistance-associated protein 1 | 1.11e-15 | NA | 5.58e-26 | 0.7876 |
3. BF | Q9N0V3 | Bile salt export pump | 0.00e+00 | NA | 1.56e-50 | 0.8226 |
3. BF | Q09YJ4 | Cystic fibrosis transmembrane conductance regulator | 7.14e-10 | NA | 6.48e-20 | 0.6832 |
3. BF | Q00554 | Cystic fibrosis transmembrane conductance regulator | 3.77e-11 | NA | 2.86e-20 | 0.692 |
3. BF | A0A0U1LQE1 | ABC transporter cctS | 1.91e-10 | NA | 3.06e-21 | 0.729 |
3. BF | Q00PJ2 | Cystic fibrosis transmembrane conductance regulator | 2.71e-11 | NA | 1.61e-19 | 0.6885 |
3. BF | P26363 | Cystic fibrosis transmembrane conductance regulator | 2.24e-11 | NA | 5.48e-23 | 0.7323 |
3. BF | K3VYH8 | ABC transporter FPSE_09185 | 0.00e+00 | NA | 4.13e-48 | 0.8385 |
3. BF | F2RP52 | ABC multidrug transporter MDR2 | 0.00e+00 | NA | 5.08e-63 | 0.815 |
3. BF | A0A0D1CZ63 | Multidrug resistance protein fer6 | 2.22e-16 | NA | 2.92e-23 | 0.7206 |
3. BF | A0A3G9H9H1 | ABC transporter ALT5 | 4.98e-11 | NA | 5.42e-13 | 0.6882 |
3. BF | Q09YK5 | Cystic fibrosis transmembrane conductance regulator | 3.76e-11 | NA | 3.77e-19 | 0.7057 |
3. BF | Q4WT65 | ABC multidrug transporter B | 5.77e-15 | NA | 1.39e-18 | 0.7785 |
3. BF | P21449 | Multidrug resistance protein 2 | 0.00e+00 | NA | 1.89e-55 | 0.7502 |
3. BF | F2Q5G0 | ABC multidrug transporter MDR2 | 0.00e+00 | NA | 8.59e-42 | 0.8174 |
3. BF | Q92S10 | Ribose import ATP-binding protein RbsA 1 | 1.13e-03 | NA | 2.48e-06 | 0.7364 |
3. BF | F2T1C4 | ABC multidrug transporter MDR2 | 0.00e+00 | NA | 1.29e-61 | 0.8204 |
3. BF | Q2QLE5 | Cystic fibrosis transmembrane conductance regulator | 5.11e-10 | NA | 1.70e-19 | 0.6824 |
3. BF | Q07DZ6 | Cystic fibrosis transmembrane conductance regulator | 1.77e-11 | NA | 1.61e-20 | 0.7228 |
3. BF | Q8HXQ5 | Multidrug resistance-associated protein 1 | 1.55e-15 | NA | 2.78e-26 | 0.798 |
3. BF | A0A1U8QTJ9 | ABC-type transporter cicA | 2.22e-16 | NA | 1.46e-24 | 0.7736 |
3. BF | Q9TSP5 | Cystic fibrosis transmembrane conductance regulator | 8.19e-10 | NA | 2.40e-19 | 0.6707 |
3. BF | Q9Y8G1 | ABC multidrug transporter atrD | 0.00e+00 | NA | 1.54e-58 | 0.7991 |
3. BF | Q06034 | Multidrug resistance protein 1 | 0.00e+00 | NA | 5.25e-67 | 0.829 |
3. BF | P26362 | Cystic fibrosis transmembrane conductance regulator | 1.62e-11 | NA | 5.13e-21 | 0.7229 |
3. BF | Q21TR5 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 7.17e-03 | NA | 8.58e-05 | 0.7408 |
3. BF | F2SQT8 | ABC multidrug transporter MDR5 | 0.00e+00 | NA | 2.82e-56 | 0.8432 |
3. BF | Q2QLH0 | Cystic fibrosis transmembrane conductance regulator | 3.58e-11 | NA | 2.53e-19 | 0.682 |
3. BF | Q864R9 | Multidrug resistance-associated protein 1 | 1.33e-15 | NA | 1.57e-25 | 0.7862 |
3. BF | O05253 | Guanosine import ATP-binding protein NupO | 2.33e-04 | NA | 1.24e-09 | 0.7372 |
3. BF | K0E4D9 | ABC transporter ecdL | 1.67e-15 | NA | 1.15e-17 | 0.7923 |
3. BF | Q07DV2 | Cystic fibrosis transmembrane conductance regulator | 3.06e-11 | NA | 7.13e-20 | 0.6832 |
3. BF | Q2T8T6 | Ribose import ATP-binding protein RbsA 2 | 1.36e-03 | NA | 0.006 | 0.7033 |
3. BF | P13568 | Multidrug resistance protein | 4.44e-16 | NA | 1.46e-46 | 0.7526 |
3. BF | Q2QLF9 | Cystic fibrosis transmembrane conductance regulator | 4.02e-11 | NA | 5.79e-20 | 0.6723 |
3. BF | Q09YH0 | Cystic fibrosis transmembrane conductance regulator | 3.88e-11 | NA | 5.89e-20 | 0.6801 |
3. BF | B8K1W2 | Bile salt export pump | 0.00e+00 | NA | 1.29e-52 | 0.7165 |
3. BF | G7CBF5 | Mycobactin import ATP-binding/permease protein IrtA | 1.63e-13 | NA | 2.48e-42 | 0.6578 |
3. BF | Q2IBF6 | Cystic fibrosis transmembrane conductance regulator | 8.47e-10 | NA | 1.58e-19 | 0.673 |
3. BF | Q7JII8 | Cystic fibrosis transmembrane conductance regulator | 8.01e-10 | NA | 2.47e-19 | 0.6855 |
3. BF | S0ELQ3 | ABC transporter GPY2 | 1.22e-15 | NA | 1.97e-14 | 0.7795 |
3. BF | I1R9B3 | ABC-type transporter FGSG_00046 | 0.00e+00 | NA | 1.39e-15 | 0.8046 |
3. BF | P53706 | Alpha-factor-transporting ATPase | 5.16e-11 | NA | 6.24e-21 | 0.7305 |
3. BF | S3D778 | ABC transporter gloK | 2.22e-16 | NA | 1.49e-20 | 0.8032 |
3. BF | P9WQJ8 | Mycobactin import ATP-binding/permease protein IrtA | 1.11e-16 | NA | 5.05e-39 | 0.7374 |
3. BF | Q6Q876 | Multidrug resistance protein sirA | 0.00e+00 | NA | 2.86e-52 | 0.804 |
3. BF | P63392 | Mycobactin import ATP-binding/permease protein IrtA | 1.11e-16 | NA | 5.05e-39 | 0.7375 |
3. BF | A0A059JK44 | ABC multidrug transporter MDR2 | 0.00e+00 | NA | 8.51e-42 | 0.8048 |
3. BF | Q4WFQ4 | ABC multidrug transporter H | 3.76e-03 | NA | 1.54e-04 | 0.3593 |
3. BF | B2KWH4 | ABC transporter 1 | 0.00e+00 | NA | 1.32e-47 | 0.7957 |
3. BF | Q2IBE4 | Cystic fibrosis transmembrane conductance regulator | 4.16e-10 | NA | 1.77e-19 | 0.6783 |
3. BF | Q4WA92 | ABC multidrug transporter E | 0.00e+00 | NA | 3.85e-50 | 0.7506 |
3. BF | Q07E42 | Cystic fibrosis transmembrane conductance regulator | 2.90e-11 | NA | 4.81e-21 | 0.6932 |
3. BF | Q5U820 | Cystic fibrosis transmembrane conductance regulator | 2.99e-11 | NA | 4.81e-19 | 0.6934 |
3. BF | P0CU83 | ABC multidrug transporter MDR2 | 0.00e+00 | NA | 4.00e-42 | 0.806 |
3. BF | Q8UA86 | Ribose import ATP-binding protein RbsA 1 | 6.89e-04 | NA | 0.002 | 0.6897 |
3. BF | I1S2J9 | ABC transporter FGM5 | 2.00e-15 | NA | 1.16e-17 | 0.791 |
3. BF | F2PRR1 | ABC multidrug transporter MDR2 | 0.00e+00 | NA | 5.08e-63 | 0.8101 |
3. BF | Q00552 | Cystic fibrosis transmembrane conductance regulator | 2.95e-11 | NA | 5.26e-20 | 0.6759 |
3. BF | Q6PQZ2 | Cystic fibrosis transmembrane conductance regulator | 2.69e-11 | NA | 1.82e-19 | 0.7153 |
3. BF | Q6UR05 | Multidrug resistance-associated protein 1 | 1.44e-15 | NA | 8.68e-27 | 0.7963 |
3. BF | Q00553 | Cystic fibrosis transmembrane conductance regulator | 8.65e-10 | NA | 2.47e-19 | 0.6671 |
3. BF | F9X9V4 | ABC-type transporter MYCGRDRAFT_41235 | 3.33e-16 | NA | 2.39e-17 | 0.7294 |
3. BF | A1KF14 | Multidrug efflux ATP-binding/permease protein BCG_0231 | 0.00e+00 | NA | 8.17e-50 | 0.8327 |
3. BF | Q2IBA1 | Cystic fibrosis transmembrane conductance regulator | 8.59e-10 | NA | 1.74e-19 | 0.6609 |
3. BF | P0CE70 | ABC transporter NFT1 | 1.03e-14 | NA | 1.20e-26 | 0.7238 |
3. BF | S0EGU4 | ABC transporter BEA3 | 2.75e-14 | NA | 8.10e-51 | 0.7841 |
3. BF | Q4WTT9 | ABC multidrug transporter mdr1 | 0.00e+00 | NA | 2.47e-56 | 0.8285 |
3. BF | Q07DY5 | Cystic fibrosis transmembrane conductance regulator | 8.31e-10 | NA | 5.45e-20 | 0.6859 |
3. BF | Q00555 | Cystic fibrosis transmembrane conductance regulator | 7.05e-10 | NA | 2.49e-19 | 0.6938 |
3. BF | P21448 | ATP-dependent translocase ABCB1 | 0.00e+00 | NA | 1.10e-56 | 0.7886 |
3. BF | P23174 | Phosphatidylcholine translocator ABCB4 | 0.00e+00 | NA | 1.20e-56 | 0.7641 |
4. PB | P36372 | Antigen peptide transporter 2 | 0.00e+00 | 4.85e-22 | 1.45e-43 | NA |
4. PB | Q9NP58 | ATP-binding cassette sub-family B member 6 | 0.00e+00 | 7.15e-08 | 5.45e-54 | NA |
4. PB | Q61285 | ATP-binding cassette sub-family D member 2 | 8.18e-12 | 2.67e-20 | 2.40e-09 | NA |
4. PB | Q5RKI8 | Mitochondrial potassium channel ATP-binding subunit | 0.00e+00 | 1.78e-22 | 2.31e-77 | NA |
4. PB | P33311 | ATP-dependent permease MDL2, mitochondrial | 0.00e+00 | 6.48e-13 | 1.80e-61 | NA |
4. PB | P55096 | ATP-binding cassette sub-family D member 3 | 5.74e-14 | 2.67e-14 | 6.49e-09 | NA |
4. PB | O14286 | Iron-sulfur clusters transporter atm1, mitochondrial | 0.00e+00 | 1.38e-25 | 5.03e-54 | NA |
4. PB | P34230 | Peroxisomal long-chain fatty acid import protein 1 | 2.65e-14 | 6.89e-13 | 3.42e-04 | NA |
4. PB | Q54W20 | ABC transporter D family member 3 | 3.76e-13 | 3.66e-24 | 8.68e-06 | NA |
4. PB | Q03519 | Antigen peptide transporter 2 | 0.00e+00 | 4.07e-14 | 1.84e-43 | NA |
4. PB | P23886 | ATP-binding/permease protein CydC | 0.00e+00 | 1.52e-35 | 4.81e-33 | NA |
4. PB | Q59R09 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 8.32e-18 | 1.56e-42 | NA |
4. PB | Q9NRK6 | ATP-binding cassette sub-family B member 10, mitochondrial | 0.00e+00 | 2.76e-08 | 2.51e-54 | NA |
4. PB | Q8T9W2 | ABC transporter B family member 5 | 0.00e+00 | 6.20e-16 | 2.19e-52 | NA |
4. PB | Q57335 | Uncharacterized ABC transporter ATP-binding protein HI_0036 | 0.00e+00 | 4.78e-27 | 3.11e-14 | NA |
4. PB | Q704E8 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 0.00e+00 | 3.11e-22 | 3.25e-48 | NA |
4. PB | Q54W24 | ABC transporter B family member 4 | 0.00e+00 | 1.55e-05 | 1.25e-72 | NA |
4. PB | O14678 | Lysosomal cobalamin transporter ABCD4 | 4.00e-15 | 1.51e-18 | 1.34e-11 | NA |
4. PB | Q56A55 | Mitochondrial potassium channel ATP-binding subunit | 0.00e+00 | 2.10e-14 | 2.02e-71 | NA |
4. PB | P9WQJ7 | Mycobactin import ATP-binding/permease protein IrtB | 0.00e+00 | 1.12e-45 | 4.38e-38 | NA |
4. PB | Q9M0G9 | ABC transporter B family member 24, mitochondrial | 0.00e+00 | 6.96e-21 | 7.63e-63 | NA |
4. PB | Q9QYJ4 | ABC-type oligopeptide transporter ABCB9 | 0.00e+00 | 6.83e-21 | 7.51e-49 | NA |
4. PB | P29018 | ATP-binding/permease protein CydD | 0.00e+00 | 1.92e-35 | 6.37e-20 | NA |
4. PB | P68580 | Sublancin-168-processing and transport ATP-binding protein sunT | NA | 3.57e-06 | 5.68e-20 | NA |
4. PB | E7F6F7 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 0.00e+00 | 1.34e-24 | 4.28e-50 | NA |
4. PB | O70595 | ATP-binding cassette sub-family B member 6 | 0.00e+00 | 5.29e-08 | 3.24e-53 | NA |
4. PB | Q9FUT3 | ABC transporter B family member 23, mitochondrial | 0.00e+00 | 1.54e-18 | 2.24e-59 | NA |
4. PB | P41909 | Peroxisomal long-chain fatty acid import protein 2 | 2.24e-13 | 4.22e-09 | 4.12e-04 | NA |
4. PB | Q9NUT2 | Mitochondrial potassium channel ATP-binding subunit | 0.00e+00 | 8.74e-17 | 3.29e-73 | NA |
4. PB | Q02592 | Heavy metal tolerance protein | 0.00e+00 | 8.84e-13 | 1.50e-63 | NA |
4. PB | Q9DC29 | ATP-binding cassette sub-family B member 6 | 0.00e+00 | 3.37e-08 | 5.05e-55 | NA |
4. PB | Q9JJ59 | ABC-type oligopeptide transporter ABCB9 | 0.00e+00 | 2.10e-20 | 2.50e-49 | NA |
4. PB | P0AAG5 | Multidrug resistance-like ATP-binding protein MdlB | 0.00e+00 | 2.20e-47 | 8.50e-41 | NA |
4. PB | Q9LVM1 | ABC transporter B family member 25, mitochondrial | 0.00e+00 | 9.26e-12 | 2.78e-64 | NA |
4. PB | A0A1U8QG99 | ABC multidrug transporter atrC | 0.00e+00 | 1.82e-02 | 1.36e-57 | NA |
4. PB | Q03518 | Antigen peptide transporter 1 | 0.00e+00 | 8.67e-04 | 1.95e-35 | NA |
4. PB | Q9JI39 | ATP-binding cassette sub-family B member 10, mitochondrial | 0.00e+00 | 6.09e-16 | 3.92e-59 | NA |
4. PB | D3ZHR2 | ATP-binding cassette sub-family D member 1 | 1.10e-14 | 6.04e-20 | 7.78e-09 | NA |
4. PB | P34713 | Multidrug resistance protein pgp-3 | 0.00e+00 | 1.06e-03 | 1.99e-50 | NA |
4. PB | Q6NLC1 | ABC transporter D family member 2, chloroplastic | 1.03e-12 | 3.59e-24 | 1.04e-04 | NA |
4. PB | P21958 | Antigen peptide transporter 1 | 0.00e+00 | 6.75e-17 | 4.14e-32 | NA |
4. PB | Q9FNU2 | ABC transporter B family member 25 | 0.00e+00 | 2.02e-49 | 6.87e-59 | NA |
4. PB | Q7JUN3 | ATP-binding cassette sub-family D member | 2.33e-14 | 6.84e-11 | 1.53e-11 | NA |
4. PB | P16970 | ATP-binding cassette sub-family D member 3 | 1.12e-13 | 7.84e-14 | 7.14e-09 | NA |
4. PB | Q55DA7 | ABC transporter B family member 7 | 2.22e-16 | 2.63e-06 | 1.01e-31 | NA |
4. PB | O75027 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 0.00e+00 | 7.99e-22 | 2.01e-49 | NA |
4. PB | P40416 | Iron-sulfur clusters transporter ATM1, mitochondrial | 0.00e+00 | 2.38e-26 | 3.29e-47 | NA |
4. PB | P48410 | ATP-binding cassette sub-family D member 1 | 7.88e-15 | 5.02e-20 | 1.12e-08 | NA |
4. PB | Q9NP78 | ABC-type oligopeptide transporter ABCB9 | 0.00e+00 | 1.78e-20 | 4.66e-49 | NA |
4. PB | Q9UBJ2 | ATP-binding cassette sub-family D member 2 | 9.43e-14 | 3.47e-20 | 1.33e-08 | NA |
4. PB | Q54RU1 | ABC transporter B family member 6 | 0.00e+00 | 3.14e-49 | 1.56e-54 | NA |
4. PB | G5EFD4 | Heavy metal tolerance factor 1 | 0.00e+00 | 4.32e-13 | 3.82e-52 | NA |
4. PB | P33941 | ABC transporter ATP-binding/permease protein YojI | 0.00e+00 | 3.98e-25 | 7.13e-08 | NA |
4. PB | Q9LZB8 | ABC transporter B family member 29, chloroplastic | 0.00e+00 | 1.47e-23 | 6.75e-42 | NA |
4. PB | Q8LPQ6 | ABC transporter B family member 28 | 0.00e+00 | 6.93e-24 | 1.84e-51 | NA |
4. PB | O89016 | Lysosomal cobalamin transporter ABCD4 | 1.11e-16 | 1.19e-21 | 1.67e-09 | NA |
4. PB | Q8RY46 | ABC transporter B family member 26, chloroplastic | 0.00e+00 | 7.21e-16 | 7.62e-59 | NA |
4. PB | Q9Y7M7 | ATP-dependent permease MDL1, mitochondrial | 0.00e+00 | 6.09e-11 | 3.47e-61 | NA |
4. PB | F1RBC8 | ATP-binding cassette sub-family D member 1 | 4.44e-14 | 1.82e-21 | 4.54e-10 | NA |
4. PB | P31826 | Inner membrane ABC transporter ATP-binding protein YddA | 0.00e+00 | 2.67e-28 | 2.38e-07 | NA |
4. PB | P33897 | ATP-binding cassette sub-family D member 1 | 1.51e-13 | 1.22e-21 | 2.64e-09 | NA |
4. PB | Q9QY44 | ATP-binding cassette sub-family D member 2 | 3.96e-14 | 3.40e-21 | 3.78e-09 | NA |
4. PB | P28288 | ATP-binding cassette sub-family D member 3 | 1.55e-15 | 9.50e-14 | 3.02e-10 | NA |
4. PB | P33310 | ATP-dependent permease MDL1, mitochondrial | 0.00e+00 | 4.94e-24 | 5.39e-59 | NA |
4. PB | P9WQJ1 | Uncharacterized ABC transporter ATP-binding protein Rv1273c | 0.00e+00 | 6.17e-37 | 1.42e-38 | NA |
4. PB | Q9CXJ4 | Mitochondrial potassium channel ATP-binding subunit | 0.00e+00 | 2.51e-21 | 3.14e-75 | NA |
4. PB | P9WQI9 | Hydrophilic compounds import ATP-binding/permease protein BacA | 3.33e-16 | 1.44e-21 | 4.60e-10 | NA |
4. PB | P60752 | ATP-dependent lipid A-core flippase | 0.00e+00 | 2.13e-55 | 3.02e-56 | NA |
4. PB | Q8T8P3 | ABC transporter D family member 2 | 2.52e-13 | 3.95e-15 | 6.79e-13 | NA |
4. PB | P36371 | Antigen peptide transporter 2 | 0.00e+00 | 1.33e-22 | 1.69e-39 | NA |
4. PB | P36370 | Antigen peptide transporter 1 | 0.00e+00 | 1.15e-14 | 2.57e-32 | NA |
4. PB | P9WQJ3 | Fatty acid ABC transporter ATP-binding/permease protein | 0.00e+00 | 5.06e-46 | 1.07e-50 | NA |
4. PB | Q0WML0 | ABC transporter B family member 27 | 0.00e+00 | 2.87e-44 | 7.88e-55 | NA |
4. PB | Q61102 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 0.00e+00 | 4.94e-22 | 1.20e-48 | NA |
4. PB | P77265 | Multidrug resistance-like ATP-binding protein MdlA | 0.00e+00 | 2.26e-34 | 7.39e-53 | NA |
4. PB | Q2G2M9 | Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 | 0.00e+00 | 1.93e-61 | 3.58e-77 | NA |
5. P | Q54W19 | ABC transporter D family member 1 | 5.04e-13 | 7.51e-29 | NA | NA |
5. P | Q5UNZ1 | Uncharacterized ABC transporter ATP-binding protein/permease L733 | NA | 1.34e-16 | NA | NA |
6. F | Q08120 | Bacteroid development protein BacA | 4.60e-11 | NA | NA | 0.5869 |
6. F | Q39GY8 | Ribose import ATP-binding protein RbsA 1 | 1.29e-03 | NA | NA | 0.7056 |
6. F | Q63P06 | Ribose import ATP-binding protein RbsA | 1.61e-03 | NA | NA | 0.7001 |
6. F | Q88J90 | Ribose import ATP-binding protein RbsA | 6.20e-04 | NA | NA | 0.7445 |
6. F | P0AFY7 | Peptide antibiotic transporter SbmA | 2.55e-09 | NA | NA | 0.6564 |
6. F | Q1BWN5 | Ribose import ATP-binding protein RbsA 1 | 1.52e-03 | NA | NA | 0.7075 |
7. B | Q3IM24 | Phosphonates import ATP-binding protein PhnC 2 | 9.30e-09 | NA | 6.85e-10 | NA |
7. B | Q8XZ72 | Phosphate import ATP-binding protein PstB | 1.29e-11 | NA | 3.72e-14 | NA |
7. B | Q81GC1 | Spermidine/putrescine import ATP-binding protein PotA | 9.35e-10 | NA | 6.61e-19 | NA |
7. B | A0A0H3JXA3 | Metal-staphylopine import system ATP-binding protein CntD | 2.05e-11 | NA | 1.32e-07 | NA |
7. B | O66646 | Lipoprotein-releasing system ATP-binding protein LolD | 1.88e-11 | NA | 8.15e-07 | NA |
7. B | Q56342 | Galactose/methyl galactoside import ATP-binding protein MglA | 6.82e-04 | NA | 9.59e-05 | NA |
7. B | Q2SU77 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.11e-10 | NA | 3.12e-07 | NA |
7. B | Q8FUU5 | Zinc import ATP-binding protein ZnuC | 8.68e-09 | NA | 1.40e-05 | NA |
7. B | Q00449 | Multidrug resistance protein homolog 49 | 0.00e+00 | NA | 3.36e-56 | NA |
7. B | Q8EG82 | Phosphate import ATP-binding protein PstB 1 | 7.97e-12 | NA | 1.24e-15 | NA |
7. B | P54954 | Probable amino-acid import ATP-binding protein YxeO | 4.84e-12 | NA | 2.30e-09 | NA |
7. B | Q81HW8 | Ribose import ATP-binding protein RbsA | 8.95e-04 | NA | 3.83e-07 | NA |
7. B | A0A0H2ZH52 | Di/tripeptide transport ATP-binding protein DppF | 1.19e-10 | NA | 1.19e-11 | NA |
7. B | A1URR2 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.53e-11 | NA | 1.03e-09 | NA |
7. B | Q02Z10 | Spermidine/putrescine import ATP-binding protein PotA | 2.89e-09 | NA | 1.51e-19 | NA |
7. B | Q1RC47 | Uncharacterized ABC transporter ATP-binding protein YcjV | 3.81e-11 | NA | 5.71e-12 | NA |
7. B | Q8U9B0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 | 1.06e-03 | NA | 4.56e-06 | NA |
7. B | O59479 | Putative ABC transporter ATP-binding protein PH1815 | 7.88e-09 | NA | 1.08e-08 | NA |
7. B | Q7N8M2 | Methionine import ATP-binding protein MetN | 1.90e-11 | NA | 4.85e-15 | NA |
7. B | Q8YBN6 | Putative peptide import ATP-binding protein BMEII0863 | 1.42e-09 | NA | 8.98e-11 | NA |
7. B | A0LM36 | Macrolide export ATP-binding/permease protein MacB | 2.39e-02 | NA | 2.07e-08 | NA |
7. B | Q11DN5 | Phosphate import ATP-binding protein PstB | 2.17e-08 | NA | 6.37e-14 | NA |
7. B | P32721 | D-allose import ATP-binding protein AlsA | 7.54e-04 | NA | 6.09e-08 | NA |
7. B | Q9HYT0 | Phosphonates import ATP-binding protein PhnC 1 | 1.84e-11 | NA | 2.78e-06 | NA |
7. B | Q601T5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.74e-12 | NA | 2.31e-21 | NA |
7. B | Q9KLQ5 | Fe(3+) ions import ATP-binding protein FbpC | 2.20e-09 | NA | 6.96e-14 | NA |
7. B | Q0HFA0 | Molybdenum import ATP-binding protein ModC | 4.79e-09 | NA | 1.45e-10 | NA |
7. B | Q1MAL7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.22e-07 | NA | 8.46e-07 | NA |
7. B | Q5LXJ3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.07e-09 | NA | 1.63e-14 | NA |
7. B | Q4JTG9 | Methionine import ATP-binding protein MetN | 4.82e-11 | NA | 8.20e-14 | NA |
7. B | Q92UV5 | Fe(3+) ions import ATP-binding protein FbpC 2 | 9.12e-09 | NA | 3.68e-09 | NA |
7. B | P47325 | Oligopeptide transport ATP-binding protein OppD | 5.20e-04 | NA | 1.78e-07 | NA |
7. B | O65934 | ABC transporter ATP-binding/permease protein Rv1747 | 1.38e-04 | NA | 1.62e-14 | NA |
7. B | Q89EW7 | Molybdenum import ATP-binding protein ModC 2 | 1.95e-05 | NA | 1.02e-11 | NA |
7. B | P54592 | Uncharacterized ABC transporter ATP-binding protein YhcH | 3.58e-07 | NA | 6.60e-11 | NA |
7. B | Q72FW5 | Spermidine/putrescine import ATP-binding protein PotA | 1.80e-09 | NA | 2.91e-10 | NA |
7. B | Q608V9 | Molybdenum import ATP-binding protein ModC | 8.04e-08 | NA | 1.30e-08 | NA |
7. B | Q58283 | Uncharacterized ABC transporter ATP-binding protein MJ0873 | 4.74e-08 | NA | 1.79e-06 | NA |
7. B | Q83KD5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.50e-10 | NA | 1.47e-04 | NA |
7. B | P61378 | Cytochrome c biogenesis ATP-binding export protein CcmA 2 | 1.62e-10 | NA | 0.045 | NA |
7. B | Q63Q62 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.68e-10 | NA | 2.41e-07 | NA |
7. B | Q92QN0 | Lipoprotein-releasing system ATP-binding protein LolD | 1.59e-10 | NA | 3.11e-07 | NA |
7. B | Q8GU83 | ABC transporter G family member 41 | 1.52e-03 | NA | 4.57e-04 | NA |
7. B | A1AA20 | Spermidine/putrescine import ATP-binding protein PotA | 1.84e-09 | NA | 1.19e-15 | NA |
7. B | Q9K789 | Methionine import ATP-binding protein MetN | 1.71e-11 | NA | 1.27e-12 | NA |
7. B | Q1GIE5 | Spermidine/putrescine import ATP-binding protein PotA | 4.71e-09 | NA | 6.03e-13 | NA |
7. B | Q58663 | Probable branched-chain amino acid transport ATP-binding protein LivG | 8.71e-09 | NA | 1.19e-04 | NA |
7. B | Q6LK34 | Galactose/methyl galactoside import ATP-binding protein MglA 1 | 7.44e-04 | NA | 0.004 | NA |
7. B | Q4FLF6 | Phosphate import ATP-binding protein PstB | 6.16e-13 | NA | 1.27e-17 | NA |
7. B | Q1IGM2 | Taurine import ATP-binding protein TauB | 7.23e-08 | NA | 1.21e-06 | NA |
7. B | Q1JLH6 | Phosphate import ATP-binding protein PstB 2 | 6.99e-11 | NA | 5.44e-18 | NA |
7. B | Q4L884 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 5.71e-08 | NA | 1.84e-15 | NA |
7. B | Q9FF46 | ABC transporter G family member 28 | 1.41e-03 | NA | 0.008 | NA |
7. B | B5X0E4 | ATP-binding cassette sub-family B member 5 | 0.00e+00 | NA | 3.05e-57 | NA |
7. B | Q8NY21 | Methionine import ATP-binding protein MetN 1 | 6.76e-12 | NA | 5.76e-18 | NA |
7. B | Q9MAH4 | ABC transporter G family member 10 | 1.57e-02 | NA | 1.55e-08 | NA |
7. B | Q6EQ60 | ABC transporter G family member 47 | 1.66e-03 | NA | 1.96e-07 | NA |
7. B | Q2JTU3 | Phosphate import ATP-binding protein PstB 2 | 1.23e-11 | NA | 9.67e-17 | NA |
7. B | Q927N8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.64e-09 | NA | 4.44e-13 | NA |
7. B | Q9I190 | Macrolide export ATP-binding/permease protein MacB | 4.85e-02 | NA | 6.01e-10 | NA |
7. B | Q032H4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.82e-10 | NA | 8.37e-11 | NA |
7. B | Q1I7I9 | Macrolide export ATP-binding/permease protein MacB 2 | 3.45e-02 | NA | 6.73e-11 | NA |
7. B | Q1C9V1 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.27e-03 | NA | 2.27e-05 | NA |
7. B | Q8Z245 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.70e-10 | NA | 2.75e-07 | NA |
7. B | Q8FCM9 | Nickel import ATP-binding protein NikE | 7.34e-11 | NA | 1.25e-12 | NA |
7. B | Q6G7A0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.38e-08 | NA | 1.40e-16 | NA |
7. B | Q8XED0 | Macrolide export ATP-binding/permease protein MacB | 3.60e-02 | NA | 5.24e-10 | NA |
7. B | Q71WH7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.59e-09 | NA | 4.05e-13 | NA |
7. B | Q9KUI0 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.97e-09 | NA | 6.71e-12 | NA |
7. B | Q16BJ3 | Taurine import ATP-binding protein TauB | 4.71e-08 | NA | 3.31e-10 | NA |
7. B | Q8Y7R4 | Putative ABC transporter ATP-binding protein lmo1207 | 5.72e-10 | NA | 2.41e-07 | NA |
7. B | Q9FLT5 | ABC transporter A family member 9 | 5.99e-06 | NA | 0.001 | NA |
7. B | Q4QM77 | Galactose/methyl galactoside import ATP-binding protein MglA | 6.35e-04 | NA | 6.21e-08 | NA |
7. B | P63353 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.49e-09 | NA | 3.35e-15 | NA |
7. B | Q8DFC3 | Methionine import ATP-binding protein MetN | 2.11e-11 | NA | 3.79e-15 | NA |
7. B | P16877 | Multidrug resistance protein 4 (Fragment) | 5.88e-08 | NA | 1.96e-22 | NA |
7. B | Q881U6 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.28e-07 | NA | 9.64e-07 | NA |
7. B | Q2ISN3 | Phosphonates import ATP-binding protein PhnC 2 | 2.98e-09 | NA | 7.54e-10 | NA |
7. B | Q3SVB5 | Phosphate import ATP-binding protein PstB | 4.70e-11 | NA | 7.59e-17 | NA |
7. B | P35020 | Probable ATP-dependent transporter ycf16 | 2.46e-10 | NA | 0.033 | NA |
7. B | P44692 | Zinc import ATP-binding protein ZnuC | 1.89e-10 | NA | 2.03e-07 | NA |
7. B | Q2JB14 | Phosphonates import ATP-binding protein PhnC | 3.06e-08 | NA | 0.001 | NA |
7. B | Q58639 | Uncharacterized ABC transporter ATP-binding protein MJ1242 | 3.07e-04 | NA | 3.63e-07 | NA |
7. B | Q68W38 | Lipoprotein-releasing system ATP-binding protein LolD | 9.33e-10 | NA | 9.66e-09 | NA |
7. B | P63390 | Probable ATP-binding protein YheS | 1.54e-04 | NA | 5.38e-07 | NA |
7. B | C3LLU1 | Vitamin B12 import ATP-binding protein BtuD | 1.39e-08 | NA | 1.84e-06 | NA |
7. B | Q1QTX6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.26e-11 | NA | 2.21e-05 | NA |
7. B | Q8ZRV2 | Thiamine import ATP-binding protein ThiQ | 1.71e-11 | NA | 2.47e-10 | NA |
7. B | Q035B2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.89e-09 | NA | 3.82e-14 | NA |
7. B | Q1JNE0 | Methionine import ATP-binding protein MetN | 9.46e-11 | NA | 2.79e-16 | NA |
7. B | Q1C1B8 | Ribose import ATP-binding protein RbsA | 7.77e-04 | NA | 1.58e-04 | NA |
7. B | Q7W6G5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.05e-10 | NA | 2.65e-09 | NA |
7. B | Q8UC12 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.87e-07 | NA | 1.47e-06 | NA |
7. B | Q1M7W6 | Nod factor export ATP-binding protein I | 1.62e-09 | NA | 9.44e-11 | NA |
7. B | A0AGP9 | Spermidine/putrescine import ATP-binding protein PotA | 1.99e-09 | NA | 2.76e-14 | NA |
7. B | Q0TBX9 | Nickel import ATP-binding protein NikD | 9.52e-12 | NA | 5.27e-06 | NA |
7. B | B6HV31 | ABC-type transporter adrC | 3.46e-04 | NA | 0.021 | NA |
7. B | Q62L74 | Phosphate import ATP-binding protein PstB | 6.22e-12 | NA | 1.77e-17 | NA |
7. B | Q54QY9 | ABC transporter H family member 4 | 6.02e-08 | NA | 1.83e-13 | NA |
7. B | Q3KJQ7 | Taurine import ATP-binding protein TauB | 1.03e-07 | NA | 3.33e-10 | NA |
7. B | Q8VQK6 | Putative peptide import ATP-binding protein BruAb2_1033 | 2.98e-09 | NA | 2.50e-06 | NA |
7. B | Q8DY60 | Putative ABC transporter ATP-binding protein SAG1633 | 1.76e-04 | NA | 1.61e-11 | NA |
7. B | Q2FVR1 | Putative hemin import ATP-binding protein HrtA | 8.29e-11 | NA | 6.98e-10 | NA |
7. B | O42943 | Uncharacterized ABC transporter ATP-binding protein C16H5.08c | 3.10e-04 | NA | 3.57e-04 | NA |
7. B | Q99S48 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.35e-08 | NA | 1.40e-16 | NA |
7. B | Q83MG3 | Thiamine import ATP-binding protein ThiQ | 7.93e-11 | NA | 7.81e-11 | NA |
7. B | Q6XYT0 | Phosphate import ATP-binding protein PstB | 1.37e-09 | NA | 1.02e-18 | NA |
7. B | Q2TXA7 | ABC multidrug transporter atrA | 5.27e-04 | NA | 0.048 | NA |
7. B | Q18AM3 | Spermidine/putrescine import ATP-binding protein PotA | 7.11e-10 | NA | 1.82e-12 | NA |
7. B | Q7MMN0 | Zinc import ATP-binding protein ZnuC | 8.65e-11 | NA | 3.44e-09 | NA |
7. B | A0RBB0 | Spermidine/putrescine import ATP-binding protein PotA | 8.67e-10 | NA | 1.93e-18 | NA |
7. B | P21629 | High-affinity branched-chain amino acid transport ATP-binding protein BraF | 3.50e-10 | NA | 3.29e-07 | NA |
7. B | Q9K8L5 | Phosphate import ATP-binding protein PstB | 1.51e-10 | NA | 2.03e-12 | NA |
7. B | Q55BC0 | ABC transporter A family member 8 | 2.42e-07 | NA | 3.18e-08 | NA |
7. B | Q9KN37 | Ribose import ATP-binding protein RbsA | 8.07e-04 | NA | 0.004 | NA |
7. B | Q4W9C7 | ABC multidrug transporter G | 1.77e-03 | NA | 0.006 | NA |
7. B | Q50801 | Putative ABC transporter ATP-binding protein MTBMA_c05830 | 2.02e-10 | NA | 2.38e-10 | NA |
7. B | Q5LUR8 | Zinc import ATP-binding protein ZnuC | 5.77e-10 | NA | 4.23e-08 | NA |
7. B | Q2RWU0 | Phosphate import ATP-binding protein PstB | 1.57e-12 | NA | 2.07e-13 | NA |
7. B | Q9HML8 | Phosphate import ATP-binding protein PstB 2 | 3.02e-10 | NA | 7.35e-15 | NA |
7. B | Q1RAS6 | Zinc import ATP-binding protein ZnuC | 3.01e-10 | NA | 8.36e-11 | NA |
7. B | P75356 | Putative ABC transporter ATP-binding protein MG303 homolog | 1.19e-07 | NA | 0.021 | NA |
7. B | Q737I0 | Putative ABC transporter ATP-binding protein BCE_2668 | 7.67e-05 | NA | 1.88e-13 | NA |
7. B | Q1CDJ0 | Ribose import ATP-binding protein RbsA | 7.61e-04 | NA | 1.58e-04 | NA |
7. B | Q8T9W1 | Serine protease/ABC transporter B family protein tagD | 1.17e-11 | NA | 8.86e-40 | NA |
7. B | Q5HPF5 | Phosphate import ATP-binding protein PstB | 6.34e-13 | NA | 4.36e-14 | NA |
7. B | Q5L3Q9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 6.02e-09 | NA | 1.56e-10 | NA |
7. B | Q8U7G2 | Methionine import ATP-binding protein MetN | 9.45e-11 | NA | 6.49e-08 | NA |
7. B | Q8U949 | Ribose import ATP-binding protein RbsA 2 | 1.15e-03 | NA | 1.21e-05 | NA |
7. B | Q2L0H5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.18e-10 | NA | 1.02e-09 | NA |
7. B | Q8EAN3 | Molybdenum import ATP-binding protein ModC | 1.02e-08 | NA | 2.62e-10 | NA |
7. B | Q1M589 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 | 7.80e-11 | NA | 2.01e-06 | NA |
7. B | Q399X3 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 6.19e-04 | NA | 0.001 | NA |
7. B | Q8FIM7 | Lipoprotein-releasing system ATP-binding protein LolD | 1.43e-10 | NA | 1.96e-08 | NA |
7. B | Q1JGL2 | Phosphate import ATP-binding protein PstB 2 | 5.31e-12 | NA | 5.44e-18 | NA |
7. B | Q4KBU0 | Methionine import ATP-binding protein MetN 3 | 1.21e-08 | NA | 4.47e-08 | NA |
7. B | Q7W148 | Phosphonates import ATP-binding protein PhnC | 2.34e-10 | NA | 1.05e-08 | NA |
7. B | Q21QL9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.37e-10 | NA | 0.010 | NA |
7. B | P61377 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.76e-10 | NA | 0.045 | NA |
7. B | Q57R58 | Macrolide export ATP-binding/permease protein MacB | 3.16e-02 | NA | 5.14e-12 | NA |
7. B | Q0SVB6 | Phosphate import ATP-binding protein PstB | 6.94e-13 | NA | 3.03e-14 | NA |
7. B | Q5GRS1 | Zinc import ATP-binding protein ZnuC | 1.44e-06 | NA | 1.16e-05 | NA |
7. B | Q0PAR0 | Macrolide export ATP-binding/permease protein MacB | 1.97e-02 | NA | 1.58e-08 | NA |
7. B | O84421 | Probable metal transport system ATP-binding protein CT_416 | 5.16e-09 | NA | 1.78e-04 | NA |
7. B | P0AAH1 | Phosphate import ATP-binding protein PstB | 1.63e-11 | NA | 5.39e-19 | NA |
7. B | Q55DQ2 | ABC transporter G family member 11 | 2.23e-03 | NA | 6.88e-06 | NA |
7. B | Q48KI4 | Lipoprotein-releasing system ATP-binding protein LolD | 8.65e-10 | NA | 1.36e-13 | NA |
7. B | Q4AA75 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.11e-12 | NA | 7.92e-21 | NA |
7. B | P31548 | Thiamine import ATP-binding protein ThiQ | 9.51e-12 | NA | 2.57e-10 | NA |
7. B | F1M3J4 | ATP-binding cassette subfamily C member 4 | 1.11e-16 | NA | 1.47e-25 | NA |
7. B | P9WQK8 | Phosphate import ATP-binding protein PstB 2 | 2.64e-13 | NA | 2.23e-11 | NA |
7. B | Q9R1X5 | ATP-binding cassette sub-family C member 5 | 5.55e-16 | NA | 2.33e-24 | NA |
7. B | Q884D4 | Macrolide export ATP-binding/permease protein MacB 1 | 7.19e-02 | NA | 5.96e-10 | NA |
7. B | Q8Y843 | Teichoic acids export ATP-binding protein TagH | 9.55e-06 | NA | 2.25e-08 | NA |
7. B | P9WQL4 | Probable ribonucleotide transport ATP-binding protein mkl | 3.61e-10 | NA | 0.003 | NA |
7. B | Q47F10 | Phosphonates import ATP-binding protein PhnC | 2.31e-10 | NA | 5.89e-06 | NA |
7. B | Q0BZD8 | Phosphonates import ATP-binding protein PhnC | 1.16e-10 | NA | 5.02e-08 | NA |
7. B | Q9ESR9 | ATP-binding cassette sub-family A member 2 | 4.13e-03 | NA | 3.29e-04 | NA |
7. B | Q818I7 | Phosphate import ATP-binding protein PstB | 5.78e-13 | NA | 1.23e-14 | NA |
7. B | P63373 | Phosphate import ATP-binding protein PstB 1 | 6.88e-13 | NA | 4.02e-11 | NA |
7. B | P0A194 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 3.12e-10 | NA | 3.34e-06 | NA |
7. B | A1C8C8 | ABC-type transporter oblD | 4.75e-04 | NA | 0.027 | NA |
7. B | Q87Z03 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.02e-09 | NA | 8.62e-09 | NA |
7. B | Q5E4D8 | Phosphate import ATP-binding protein PstB 1 | 1.79e-12 | NA | 2.91e-15 | NA |
7. B | Q65UW1 | Galactose/methyl galactoside import ATP-binding protein MglA | 6.35e-04 | NA | 2.30e-06 | NA |
7. B | Q9FWX8 | ABC transporter B family member 12 | 0.00e+00 | NA | 2.12e-53 | NA |
7. B | Q8E3S6 | Putative ABC transporter ATP-binding protein gbs1680 | 2.58e-04 | NA | 1.84e-11 | NA |
7. B | Q1C0Q8 | Hemin import ATP-binding protein HmuV | 1.52e-09 | NA | 9.24e-06 | NA |
7. B | Q2T4B3 | Macrolide export ATP-binding/permease protein MacB | 4.93e-02 | NA | 1.70e-06 | NA |
7. B | Q57554 | Uncharacterized ABC transporter ATP-binding protein MJ0089 | 1.01e-10 | NA | 1.01e-14 | NA |
7. B | Q8DU24 | Phosphate import ATP-binding protein PstB 1 | 8.25e-12 | NA | 4.16e-10 | NA |
7. B | Q63120 | ATP-binding cassette sub-family C member 2 | 1.33e-15 | NA | 3.46e-25 | NA |
7. B | Q0BG60 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 9.01e-04 | NA | 6.88e-05 | NA |
7. B | Q87RE5 | Zinc import ATP-binding protein ZnuC | 8.47e-11 | NA | 2.09e-10 | NA |
7. B | Q1CNC6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.02e-10 | NA | 4.16e-10 | NA |
7. B | Q7PC87 | ABC transporter G family member 34 | 6.97e-04 | NA | 7.09e-08 | NA |
7. B | H9BZ66 | ABC transporter G family member 1 | 1.92e-02 | NA | 1.14e-06 | NA |
7. B | Q8F6L8 | Lipoprotein-releasing system ATP-binding protein LolD | 3.50e-09 | NA | 6.16e-08 | NA |
7. B | Q0I3Y9 | Spermidine/putrescine import ATP-binding protein PotA | 1.01e-08 | NA | 5.23e-17 | NA |
7. B | Q0TI47 | Uncharacterized ABC transporter ATP-binding protein YcjV | 8.80e-11 | NA | 3.01e-12 | NA |
7. B | Q0SFW6 | Methionine import ATP-binding protein MetN 2 | 1.07e-11 | NA | 1.01e-16 | NA |
7. B | P9WQL1 | Phosphate import ATP-binding protein PstB 1 | 2.15e-11 | NA | 3.05e-05 | NA |
7. B | Q7N6F9 | Macrolide export ATP-binding/permease protein MacB | 4.44e-02 | NA | 3.19e-09 | NA |
7. B | Q57399 | Molybdate import ATP-binding protein MolC | 4.74e-09 | NA | 6.24e-13 | NA |
7. B | Q7FB56 | Putative ABC transporter C family member 15 | 0.00e+00 | NA | 8.38e-29 | NA |
7. B | Q9I1C8 | Methionine import ATP-binding protein MetN 1 | 3.81e-11 | NA | 1.35e-14 | NA |
7. B | Q6G2E2 | Methionine import ATP-binding protein MetN | 2.57e-10 | NA | 5.54e-10 | NA |
7. B | Q07LU3 | Hemin import ATP-binding protein HmuV | 6.68e-10 | NA | 0.001 | NA |
7. B | Q1JUP7 | Arabinose import ATP-binding protein AraG | 1.30e-03 | NA | 1.11e-06 | NA |
7. B | Q57HY8 | Phosphate import ATP-binding protein PstB | 2.66e-11 | NA | 1.07e-18 | NA |
7. B | Q48GY7 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 8.40e-04 | NA | 9.18e-06 | NA |
7. B | Q4A8A2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 6.08e-12 | NA | 2.31e-21 | NA |
7. B | Q8TQW9 | Putative ABC transporter ATP-binding protein MA_1418 | 2.47e-03 | NA | 1.79e-08 | NA |
7. B | A1B677 | Macrolide export ATP-binding/permease protein MacB 1/2 | 3.71e-05 | NA | 2.85e-06 | NA |
7. B | Q0BFU0 | Ribose import ATP-binding protein RbsA 1 | 1.67e-03 | NA | 0.008 | NA |
7. B | Q0P9X7 | Probable ABC transporter ATP-binding protein PEB1C | 6.92e-13 | NA | 6.02e-09 | NA |
7. B | Q132E8 | Phosphonates import ATP-binding protein PhnC | 4.24e-11 | NA | 3.63e-08 | NA |
7. B | P9WQK3 | Energy-dependent translational throttle protein EttA | 6.77e-05 | NA | 0.039 | NA |
7. B | Q5BAY0 | ABC multidrug transporter atrD | 0.00e+00 | NA | 1.40e-58 | NA |
7. B | Q6HP89 | Methionine import ATP-binding protein MetN 1 | 2.45e-11 | NA | 1.83e-17 | NA |
7. B | Q6GH27 | Nickel import system ATP-binding protein NikD | 5.67e-10 | NA | 1.50e-10 | NA |
7. B | Q8FFR2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.05e-10 | NA | 1.77e-04 | NA |
7. B | Q2EHL8 | Macrolide export ATP-binding/permease protein MacB | 2.64e-06 | NA | 1.57e-08 | NA |
7. B | P0CZ37 | Phosphate import ATP-binding protein PstB 1 | 1.18e-11 | NA | 2.82e-09 | NA |
7. B | Q6NDQ0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.73e-11 | NA | 9.45e-09 | NA |
7. B | Q815Y7 | Methionine import ATP-binding protein MetN 3 | 1.70e-11 | NA | 1.94e-16 | NA |
7. B | P63364 | Phosphate import ATP-binding protein PstB 1 | 1.31e-11 | NA | 1.54e-13 | NA |
7. B | Q7MEV1 | Ribose import ATP-binding protein RbsA | 8.68e-04 | NA | 8.38e-04 | NA |
7. B | J9VPA2 | ABC multidrug transporter AFR2 | 1.12e-03 | NA | 0.010 | NA |
7. B | Q9PR37 | Spermidine/putrescine import ATP-binding protein PotA | 5.33e-04 | NA | 4.29e-06 | NA |
7. B | Q57SD6 | Putative 2-aminoethylphosphonate import ATP-binding protein PhnT | 3.04e-09 | NA | 2.65e-17 | NA |
7. B | Q3BV68 | Phosphate import ATP-binding protein PstB | 1.04e-12 | NA | 7.98e-17 | NA |
7. B | Q9HMZ4 | Putative ABC transporter ATP-binding protein VNG_2317G | 1.96e-11 | NA | 1.20e-06 | NA |
7. B | Q8CF82 | Cholesterol transporter ABCA5 | 1.49e-03 | NA | 3.34e-06 | NA |
7. B | Q2FW34 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.11e-11 | NA | 1.13e-16 | NA |
7. B | Q473H8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.84e-07 | NA | 0.004 | NA |
7. B | Q5HRU5 | Methionine import ATP-binding protein MetN 1 | 1.00e-10 | NA | 1.45e-14 | NA |
7. B | Q1RK34 | Lipoprotein-releasing system ATP-binding protein LolD | 4.04e-10 | NA | 1.03e-10 | NA |
7. B | Q99ZS8 | Spermidine/putrescine import ATP-binding protein PotA | 2.14e-09 | NA | 2.45e-16 | NA |
7. B | Q9RR46 | Glycine betaine/carnitine transport ATP-binding protein GbuA | 2.05e-10 | NA | 1.34e-12 | NA |
7. B | Q8XHV2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.33e-10 | NA | 4.39e-12 | NA |
7. B | Q5X484 | Methionine import ATP-binding protein MetN | 1.20e-11 | NA | 2.92e-15 | NA |
7. B | P0A2V3 | Octopine permease ATP-binding protein P | 3.11e-12 | NA | 2.24e-08 | NA |
7. B | Q9I3N7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.15e-08 | NA | 2.92e-07 | NA |
7. B | Q2YYM4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.11e-11 | NA | 1.11e-16 | NA |
7. B | Q1QVQ7 | Methionine import ATP-binding protein MetN | 8.76e-11 | NA | 1.39e-13 | NA |
7. B | Q3AKM8 | Phosphonates import ATP-binding protein PhnC | 1.92e-08 | NA | 0.001 | NA |
7. B | Q6LG59 | Galactose/methyl galactoside import ATP-binding protein MglA 2 | 1.71e-03 | NA | 2.07e-04 | NA |
7. B | Q630Y3 | Teichoic acids export ATP-binding protein TagH | 8.04e-05 | NA | 0.008 | NA |
7. B | Q5E0T4 | Molybdenum import ATP-binding protein ModC | 6.68e-08 | NA | 4.41e-10 | NA |
7. B | P0AAI2 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.03e-08 | NA | 1.02e-11 | NA |
7. B | Q6HHI7 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.78e-08 | NA | 2.25e-09 | NA |
7. B | Q322E8 | Zinc import ATP-binding protein ZnuC | 1.22e-09 | NA | 8.36e-11 | NA |
7. B | Q9WYV0 | UvrABC system protein A | 5.16e-02 | NA | 1.42e-05 | NA |
7. B | P16876 | Multidrug resistance protein 3 (Fragment) | 4.85e-06 | NA | 1.15e-14 | NA |
7. B | Q87AL9 | Methionine import ATP-binding protein MetN | 1.06e-11 | NA | 1.35e-15 | NA |
7. B | Q5LS19 | Phosphate import ATP-binding protein PstB | 1.06e-10 | NA | 2.91e-15 | NA |
7. B | Q32JQ8 | Methionine import ATP-binding protein MetN | 1.49e-11 | NA | 1.90e-14 | NA |
7. B | Q73F11 | Methionine import ATP-binding protein MetN 1 | 4.08e-11 | NA | 8.28e-14 | NA |
7. B | P37774 | L-cystine transport system ATP-binding protein TcyN | 4.65e-12 | NA | 2.26e-13 | NA |
7. B | P45092 | Arginine transport ATP-binding protein ArtP | 6.48e-12 | NA | 2.01e-14 | NA |
7. B | Q20Y31 | Phosphonates import ATP-binding protein PhnC 2 | 7.04e-11 | NA | 4.24e-09 | NA |
7. B | Q57QD7 | Lipoprotein-releasing system ATP-binding protein LolD | 1.21e-10 | NA | 3.21e-07 | NA |
7. B | Q8UAK2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 1.02e-03 | NA | 7.33e-07 | NA |
7. B | Q21JK3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.19e-08 | NA | 2.14e-06 | NA |
7. B | O34512 | Uncharacterized ABC transporter ATP-binding protein YfmM | 1.84e-05 | NA | 2.18e-06 | NA |
7. B | O86311 | Multidrug efflux system ATP-binding protein Rv1218c | 1.13e-06 | NA | 6.06e-05 | NA |
7. B | Q0S9A4 | Ribose import ATP-binding protein RbsA | 1.13e-03 | NA | 0.001 | NA |
7. B | Q0BIE1 | Arabinose import ATP-binding protein AraG 1 | 1.44e-03 | NA | 1.24e-04 | NA |
7. B | P54683 | Serine protease/ABC transporter B family protein tagB | 1.56e-13 | NA | 3.03e-38 | NA |
7. B | P0A9S0 | Cell division ATP-binding protein FtsE | 1.23e-10 | NA | 2.11e-11 | NA |
7. B | Q11SW8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.52e-10 | NA | 1.26e-06 | NA |
7. B | P72335 | Nod factor export ATP-binding protein I | 9.78e-10 | NA | 2.81e-08 | NA |
7. B | Q5HQ70 | Spermidine/putrescine import ATP-binding protein PotA | 1.30e-09 | NA | 3.58e-16 | NA |
7. B | Q831L8 | Teichoic acids export ATP-binding protein TagH | 1.34e-05 | NA | 0.010 | NA |
7. B | Q2KCV5 | Phosphate import ATP-binding protein PstB | 7.07e-09 | NA | 1.09e-14 | NA |
7. B | Q1QSE9 | Phosphate import ATP-binding protein PstB 2 | 3.57e-12 | NA | 6.95e-18 | NA |
7. B | P47705 | Putative ABC transporter ATP-binding protein MG467 | 5.47e-06 | NA | 2.90e-08 | NA |
7. B | P23703 | Nod factor export ATP-binding protein I | 9.82e-10 | NA | 3.38e-08 | NA |
7. B | Q0SZJ3 | Nickel import ATP-binding protein NikE | 8.91e-11 | NA | 5.59e-11 | NA |
7. B | Q3YUV0 | Maltose/maltodextrin import ATP-binding protein MalK | 1.43e-10 | NA | 4.70e-12 | NA |
7. B | Q9ZR72 | ABC transporter B family member 1 | 0.00e+00 | NA | 1.07e-55 | NA |
7. B | Q9KZW2 | Phosphate import ATP-binding protein PstB | 6.11e-12 | NA | 1.85e-11 | NA |
7. B | Q03PF2 | Spermidine/putrescine import ATP-binding protein PotA | 1.48e-10 | NA | 3.86e-17 | NA |
7. B | P0AAI1 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.63e-08 | NA | 1.02e-11 | NA |
7. B | Q108U0 | Cystic fibrosis transmembrane conductance regulator | 2.14e-11 | NA | 1.44e-19 | NA |
7. B | Q5PJX5 | Ribose import ATP-binding protein RbsA | 7.56e-04 | NA | 4.54e-05 | NA |
7. B | Q5HDY7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.17e-08 | NA | 1.40e-16 | NA |
7. B | Q0TIU8 | Spermidine/putrescine import ATP-binding protein PotA | 1.73e-09 | NA | 1.36e-15 | NA |
7. B | P37313 | Dipeptide transport ATP-binding protein DppF | 8.13e-10 | NA | 6.22e-12 | NA |
7. B | Q6D4W8 | Arabinose import ATP-binding protein AraG | 4.93e-04 | NA | 4.46e-05 | NA |
7. B | P38046 | Nitrate import ATP-binding protein NrtD | 5.67e-08 | NA | 2.46e-13 | NA |
7. B | Q3Z2S7 | Arabinose import ATP-binding protein AraG | 8.01e-04 | NA | 6.97e-05 | NA |
7. B | Q2IXX0 | Macrolide export ATP-binding/permease protein MacB | 4.31e-02 | NA | 1.11e-10 | NA |
7. B | Q27256 | Protein white | 1.65e-02 | NA | 4.99e-08 | NA |
7. B | Q76CU2 | Pleiotropic drug resistance protein 1 | 2.15e-03 | NA | 5.10e-05 | NA |
7. B | A1WXT0 | Zinc import ATP-binding protein ZnuC | 1.96e-09 | NA | 6.74e-05 | NA |
7. B | Q5FM17 | Phosphate import ATP-binding protein PstB 2 | 1.09e-11 | NA | 4.38e-15 | NA |
7. B | O86751 | Fe(3+) ions import ATP-binding protein FbpC | 4.75e-09 | NA | 2.01e-05 | NA |
7. B | Q9KLL9 | Molybdenum import ATP-binding protein ModC | 1.09e-08 | NA | 4.67e-12 | NA |
7. B | Q0K4I1 | Phosphonates import ATP-binding protein PhnC 1 | 7.76e-10 | NA | 2.23e-06 | NA |
7. B | Q87UI3 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 9.00e-07 | NA | 6.89e-10 | NA |
7. B | Q2K2X0 | Molybdenum import ATP-binding protein ModC | 1.15e-07 | NA | 2.65e-13 | NA |
7. B | Q8D385 | Zinc import ATP-binding protein ZnuC | 2.31e-10 | NA | 9.74e-05 | NA |
7. B | Q57RB2 | Glutathione import ATP-binding protein GsiA | 2.70e-04 | NA | 3.61e-10 | NA |
7. B | P32386 | ATP-dependent bile acid permease | 4.24e-10 | NA | 2.57e-25 | NA |
7. B | Q0T6A8 | Aliphatic sulfonates import ATP-binding protein SsuB | 6.97e-08 | NA | 1.45e-11 | NA |
7. B | Q88HL0 | Nickel import ATP-binding protein NikE | 5.60e-11 | NA | 1.82e-10 | NA |
7. B | P43535 | Protein GCN20 | 2.30e-05 | NA | 3.40e-08 | NA |
7. B | Q8Z9T1 | Phosphate import ATP-binding protein PstB 2 | 1.98e-11 | NA | 3.27e-16 | NA |
7. B | P48243 | Glutamate transport ATP-binding protein GluA | 1.47e-13 | NA | 5.65e-10 | NA |
7. B | Q8X5D9 | Galactose/methyl galactoside import ATP-binding protein MglA | 8.70e-04 | NA | 5.87e-06 | NA |
7. B | Q2PCF1 | Pleiotropic drug resistance protein 2 | 2.83e-03 | NA | 9.95e-05 | NA |
7. B | Q1JGY7 | Spermidine/putrescine import ATP-binding protein PotA | 2.43e-09 | NA | 6.49e-16 | NA |
7. B | Q6HI76 | Putative ABC transporter ATP-binding protein BT9727_2424 | 5.36e-04 | NA | 8.36e-12 | NA |
7. B | Q54VC1 | ABC transporter C family member 15 | 0.00e+00 | NA | 1.22e-22 | NA |
7. B | Q3ARY3 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 5.18e-10 | NA | 1.87e-05 | NA |
7. B | Q7VCZ3 | Phosphate import ATP-binding protein PstB | 2.58e-12 | NA | 2.05e-13 | NA |
7. B | Q9FWX7 | ABC transporter B family member 11 | 0.00e+00 | NA | 8.61e-54 | NA |
7. B | Q0I2Z4 | Fe(3+) ions import ATP-binding protein FbpC | 9.24e-10 | NA | 3.06e-15 | NA |
7. B | Q5LYN4 | Spermidine/putrescine import ATP-binding protein PotA | 1.74e-09 | NA | 1.86e-15 | NA |
7. B | Q2SZC2 | Arabinose import ATP-binding protein AraG 1 | 1.10e-03 | NA | 2.78e-04 | NA |
7. B | Q1J450 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.98e-10 | NA | 1.28e-13 | NA |
7. B | Q2SJ99 | Ribose import ATP-binding protein RbsA | 1.13e-03 | NA | 0.011 | NA |
7. B | Q72D46 | Phosphate import ATP-binding protein PstB | 4.90e-12 | NA | 5.82e-15 | NA |
7. B | Q135Z8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.27e-10 | NA | 5.42e-05 | NA |
7. B | Q3Z006 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.16e-10 | NA | 7.35e-05 | NA |
7. B | Q88XV1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.24e-08 | NA | 3.06e-17 | NA |
7. B | Q1LNM0 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.74e-07 | NA | 2.76e-12 | NA |
7. B | Q8XHV3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.20e-08 | NA | 8.34e-18 | NA |
7. B | Q5MZ53 | Bicarbonate transport ATP-binding protein CmpD | 8.34e-08 | NA | 4.83e-08 | NA |
7. B | Q6KHL2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.06e-08 | NA | 5.06e-08 | NA |
7. B | Q322L1 | Arabinose import ATP-binding protein AraG | 3.49e-04 | NA | 6.56e-05 | NA |
7. B | Q1IGN4 | Methionine import ATP-binding protein MetN 1 | 2.30e-11 | NA | 1.57e-15 | NA |
7. B | Q9HYF9 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.50e-06 | NA | 5.53e-06 | NA |
7. B | Q31GF5 | Lipoprotein-releasing system ATP-binding protein LolD | 4.39e-10 | NA | 3.24e-04 | NA |
7. B | Q48C94 | Taurine import ATP-binding protein TauB | 6.78e-08 | NA | 3.74e-07 | NA |
7. B | Q1RFH8 | Taurine import ATP-binding protein TauB | 5.00e-08 | NA | 2.28e-09 | NA |
7. B | Q7MJ01 | Lipoprotein-releasing system ATP-binding protein LolD | 5.47e-10 | NA | 1.22e-06 | NA |
7. B | Q58903 | Uncharacterized ABC transporter ATP-binding protein MJ1508 | 1.99e-12 | NA | 1.12e-07 | NA |
7. B | Q6D0F3 | Thiamine import ATP-binding protein ThiQ | 2.20e-11 | NA | 4.40e-08 | NA |
7. B | Q9KP42 | Thiamine import ATP-binding protein ThiQ | 5.48e-12 | NA | 3.85e-14 | NA |
7. B | Q4KDI2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 8.44e-04 | NA | 2.06e-04 | NA |
7. B | Q1CNR8 | Maltose/maltodextrin import ATP-binding protein MalK | 2.30e-11 | NA | 2.46e-15 | NA |
7. B | Q6N6K5 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.23e-07 | NA | 4.95e-10 | NA |
7. B | Q1C951 | Molybdenum import ATP-binding protein ModC | 1.58e-08 | NA | 1.28e-12 | NA |
7. B | Q8X6W1 | Glutathione import ATP-binding protein GsiA | 2.66e-04 | NA | 6.00e-11 | NA |
7. B | Q8UFV7 | Lipoprotein-releasing system ATP-binding protein LolD | 1.21e-10 | NA | 7.66e-06 | NA |
7. B | Q6MMH0 | Phosphate import ATP-binding protein PstB | 6.92e-12 | NA | 1.23e-18 | NA |
7. B | Q65F80 | Methionine import ATP-binding protein MetN 2 | 2.27e-11 | NA | 3.77e-14 | NA |
7. B | Q6YPR6 | Spermidine/putrescine import ATP-binding protein PotA | 1.61e-05 | NA | 4.51e-07 | NA |
7. B | P30769 | Probable ribonucleotide transport ATP-binding protein mkl | 3.10e-10 | NA | 0.002 | NA |
7. B | P16875 | Multidrug resistance protein 1 (Fragment) | 2.82e-08 | NA | 6.06e-16 | NA |
7. B | P36638 | Peptide transport system ATP-binding protein SapF | 8.43e-11 | NA | 2.78e-13 | NA |
7. B | Q48J29 | Molybdenum import ATP-binding protein ModC | 9.79e-08 | NA | 2.05e-07 | NA |
7. B | Q8CRB0 | Putative hemin import ATP-binding protein HrtA | 7.19e-11 | NA | 7.53e-07 | NA |
7. B | O52618 | Nod factor export ATP-binding protein I | 1.79e-09 | NA | 3.06e-12 | NA |
7. B | O42690 | Opaque-specific ABC transporter CDR3 | 9.62e-03 | NA | 5.84e-05 | NA |
7. B | Q7NQN5 | Spermidine/putrescine import ATP-binding protein PotA | 1.29e-09 | NA | 3.98e-09 | NA |
7. B | Q6DB03 | Xylose import ATP-binding protein XylG | 1.84e-04 | NA | 1.97e-05 | NA |
7. B | Q2KBP5 | Biotin transport ATP-binding protein BioM | 9.48e-11 | NA | 6.24e-08 | NA |
7. B | Q65HC0 | Phosphate import ATP-binding protein PstB 1 | 7.78e-13 | NA | 3.67e-12 | NA |
7. B | Q07LQ4 | Aliphatic sulfonates import ATP-binding protein SsuB | 6.99e-07 | NA | 5.15e-13 | NA |
7. B | P9WQL7 | Fluoroquinolones export ATP-binding protein Rv2688c | 1.43e-09 | NA | 5.39e-10 | NA |
7. B | Q39AT4 | Methionine import ATP-binding protein MetN 2 | 1.71e-09 | NA | 1.34e-13 | NA |
7. B | Q57243 | Uncharacterized ABC transporter ATP-binding protein HI_1272 | 1.15e-10 | NA | 2.69e-09 | NA |
7. B | Q3Z300 | Lipoprotein-releasing system ATP-binding protein LolD | 1.34e-10 | NA | 1.96e-08 | NA |
7. B | Q88RL1 | Zinc import ATP-binding protein ZnuC | 1.58e-09 | NA | 1.55e-06 | NA |
7. B | Q2SMT0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 6.26e-04 | NA | 2.33e-04 | NA |
7. B | Q8UCM5 | Hemin import ATP-binding protein HmuV | 3.74e-09 | NA | 0.020 | NA |
7. B | Q6AM16 | Phosphate import ATP-binding protein PstB | 3.16e-11 | NA | 2.10e-17 | NA |
7. B | Q4K681 | Spermidine/putrescine import ATP-binding protein PotA | 3.70e-09 | NA | 1.84e-10 | NA |
7. B | Q9HPH7 | Putative ABC transporter ATP-binding protein VNG_1631G | 5.40e-11 | NA | 1.54e-05 | NA |
7. B | Q8YJ04 | Thiamine import ATP-binding protein ThiQ | 1.55e-10 | NA | 3.11e-07 | NA |
7. B | Q8P8M1 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.87e-08 | NA | 1.24e-04 | NA |
7. B | Q98DT6 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 3.29e-06 | NA | 1.20e-12 | NA |
7. B | O84337 | UvrABC system protein A | 5.53e-01 | NA | 3.45e-04 | NA |
7. B | P46341 | Phosphate import ATP-binding protein PstB 2 | 1.68e-11 | NA | 7.14e-12 | NA |
7. B | Q8NV47 | Putative hemin import ATP-binding protein HrtA | 9.19e-11 | NA | 6.98e-10 | NA |
7. B | P0A191 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 4.28e-11 | NA | 0.026 | NA |
7. B | Q0TNZ3 | Spermidine/putrescine import ATP-binding protein PotA | 2.10e-09 | NA | 3.18e-13 | NA |
7. B | Q7UPK3 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 2.11e-07 | NA | 4.70e-07 | NA |
7. B | Q839D4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.33e-08 | NA | 2.45e-16 | NA |
7. B | O30144 | Molybdate/tungstate import ATP-binding protein WtpC | 3.26e-11 | NA | 5.77e-08 | NA |
7. B | Q3J3V9 | Ribose import ATP-binding protein RbsA | 1.08e-03 | NA | 2.40e-04 | NA |
7. B | A0R4C0 | Phosphate import ATP-binding protein PstB | 2.38e-11 | NA | 0.008 | NA |
7. B | Q97SA3 | Putative ABC transporter ATP-binding protein SP_0483 | 1.67e-04 | NA | 2.18e-14 | NA |
7. B | Q87SV4 | Thiamine import ATP-binding protein ThiQ | 1.09e-11 | NA | 6.57e-10 | NA |
7. B | Q7W1F4 | Molybdenum import ATP-binding protein ModC | 1.15e-07 | NA | 1.49e-08 | NA |
7. B | P24693 | Lipopolysaccharide export system ATP-binding protein LptB | 3.08e-10 | NA | 8.98e-06 | NA |
7. B | Q9EYM2 | Lipoprotein-releasing system ATP-binding protein LolD | 1.53e-10 | NA | 1.84e-04 | NA |
7. B | Q6LKD4 | Fe(3+) ions import ATP-binding protein FbpC | 6.41e-10 | NA | 3.36e-12 | NA |
7. B | Q8K448 | Cholesterol transporter ABCA5 | 5.25e-04 | NA | 1.50e-07 | NA |
7. B | Q46577 | UvrABC system protein A | 1.36e-02 | NA | 0.002 | NA |
7. B | Q12NL5 | Lipoprotein-releasing system ATP-binding protein LolD | 5.60e-11 | NA | 4.01e-09 | NA |
7. B | A1A9B7 | Macrolide export ATP-binding/permease protein MacB 1 | 6.64e-02 | NA | 1.38e-10 | NA |
7. B | Q8ZDX6 | Vitamin B12 import ATP-binding protein BtuD | 3.13e-08 | NA | 2.68e-08 | NA |
7. B | Q8PSR0 | Putative ABC transporter ATP-binding protein MM_3016 | 1.03e-05 | NA | 2.98e-15 | NA |
7. B | O28912 | Phosphate import ATP-binding protein PstB | 7.63e-13 | NA | 4.85e-17 | NA |
7. B | Q31DV4 | Phosphonates import ATP-binding protein PhnC | 1.72e-10 | NA | 1.32e-13 | NA |
7. B | Q8U242 | Phosphate import ATP-binding protein PstB | 3.28e-12 | NA | 2.35e-13 | NA |
7. B | O93796 | Elongation factor 3 | 4.63e-04 | NA | 1.93e-07 | NA |
7. B | P27675 | Glutamine transport ATP-binding protein GlnQ | 8.98e-14 | NA | 2.70e-14 | NA |
7. B | Q9NGP5 | ABC transporter G family member 2 | 9.42e-04 | NA | 6.46e-05 | NA |
7. B | Q1GFI8 | Lipoprotein-releasing system ATP-binding protein LolD | 5.89e-10 | NA | 1.64e-04 | NA |
7. B | Q9PK60 | UvrABC system protein A | 3.68e-01 | NA | 0.001 | NA |
7. B | Q83J33 | Xylose import ATP-binding protein XylG | 6.00e-04 | NA | 0.002 | NA |
7. B | Q6HG98 | Putative ABC transporter ATP-binding protein BT9727_3105 | 1.29e-04 | NA | 4.57e-08 | NA |
7. B | Q0WER5 | Arabinose import ATP-binding protein AraG | 6.00e-04 | NA | 1.01e-05 | NA |
7. B | Q98DA2 | Methionine import ATP-binding protein MetN | 2.33e-10 | NA | 8.34e-08 | NA |
7. B | Q1CR30 | Methionine import ATP-binding protein MetN | 3.01e-12 | NA | 1.00e-16 | NA |
7. B | Q1MLW4 | Phosphate import ATP-binding protein PstB 1 | 4.80e-09 | NA | 6.20e-16 | NA |
7. B | Q8YIT2 | Macrolide export ATP-binding/permease protein MacB | 4.29e-02 | NA | 2.33e-06 | NA |
7. B | Q8G847 | Fructose import ATP-binding protein FruK | 4.23e-04 | NA | 8.89e-06 | NA |
7. B | P14788 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.98e-09 | NA | 4.20e-11 | NA |
7. B | Q87HN4 | Molybdenum import ATP-binding protein ModC | 9.18e-09 | NA | 2.43e-13 | NA |
7. B | Q55281 | Manganese transport system ATP-binding protein MntA | 3.49e-09 | NA | 2.95e-07 | NA |
7. B | Q2YRG7 | Macrolide export ATP-binding/permease protein MacB | 1.09e-01 | NA | 2.11e-06 | NA |
7. B | Q8TQ05 | Putative ABC transporter ATP-binding protein MA_1747 | 3.12e-04 | NA | 8.42e-12 | NA |
7. B | Q3K506 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.35e-07 | NA | 1.26e-10 | NA |
7. B | Q5PJL1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.39e-10 | NA | 2.09e-07 | NA |
7. B | Q2FTF8 | Phosphate import ATP-binding protein PstB | 9.13e-13 | NA | 1.37e-19 | NA |
7. B | Q9FKF2 | ABC transporter A family member 11 | 8.31e-06 | NA | 3.76e-04 | NA |
7. B | Q4ZV73 | Lipoprotein-releasing system ATP-binding protein LolD | 8.48e-10 | NA | 3.16e-13 | NA |
7. B | Q13ZJ1 | Nod factor export ATP-binding protein I | 1.86e-09 | NA | 2.63e-08 | NA |
7. B | Q9YGA6 | Trehalose/maltose import ATP-binding protein MalK | 3.65e-10 | NA | 4.71e-13 | NA |
7. B | Q8E9I8 | Phosphate import ATP-binding protein PstB 2 | 1.22e-12 | NA | 7.49e-14 | NA |
7. B | Q48IB9 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 4.11e-07 | NA | 7.55e-08 | NA |
7. B | A1U776 | Zinc import ATP-binding protein ZnuC | 6.22e-10 | NA | 0.010 | NA |
7. B | O32188 | Probable siderophore transport system ATP-binding protein YusV | 7.79e-11 | NA | 7.46e-11 | NA |
7. B | Q8NVB5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 7.36e-11 | NA | 1.20e-16 | NA |
7. B | P45094 | Dipeptide transport ATP-binding protein DppF | 3.05e-10 | NA | 1.70e-14 | NA |
7. B | Q4QKQ9 | Lipoprotein-releasing system ATP-binding protein LolD | 6.78e-11 | NA | 1.81e-07 | NA |
7. B | Q7CHI2 | Macrolide export ATP-binding/permease protein MacB 1 | 2.48e-02 | NA | 5.34e-10 | NA |
7. B | Q0K998 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.64e-10 | NA | 7.50e-11 | NA |
7. B | Q82HA2 | Putative ABC transporter ATP-binding protein SAV_3608 | 1.74e-10 | NA | 1.12e-06 | NA |
7. B | Q97UY8 | Glucose import ATP-binding protein GlcV | 2.45e-10 | NA | 4.62e-14 | NA |
7. B | Q7NNG3 | Phosphate import ATP-binding protein PstB 2 | 5.32e-12 | NA | 1.16e-13 | NA |
7. B | Q6F1W4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.39e-08 | NA | 5.82e-10 | NA |
7. B | Q54T02 | ABC transporter G family member 24 | 2.19e-03 | NA | 1.62e-05 | NA |
7. B | Q5E715 | Methionine import ATP-binding protein MetN | 2.33e-11 | NA | 2.74e-17 | NA |
7. B | P0A9X3 | Zinc import ATP-binding protein ZnuC | 2.43e-10 | NA | 8.36e-11 | NA |
7. B | A0A0D1BUH6 | ABC-type transporter atr1 | 2.45e-12 | NA | 1.50e-49 | NA |
7. B | Q00830 | Probable ATP-dependent transporter ycf16 | 8.12e-10 | NA | 1.39e-05 | NA |
7. B | Q1R4L0 | Phosphate import ATP-binding protein PstB | 1.89e-11 | NA | 5.39e-19 | NA |
7. B | Q8R7Y4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.87e-11 | NA | 2.22e-15 | NA |
7. B | Q8D0W8 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.46e-10 | NA | 2.32e-12 | NA |
7. B | Q5XBY7 | Phosphate import ATP-binding protein PstB 1 | 1.11e-11 | NA | 2.95e-09 | NA |
7. B | Q8UKE4 | Macrolide export ATP-binding/permease protein MacB | 1.23e-01 | NA | 3.31e-09 | NA |
7. B | Q8RFN2 | Methionine import ATP-binding protein MetN | 4.69e-12 | NA | 1.21e-18 | NA |
7. B | Q2YNH6 | Lipoprotein-releasing system ATP-binding protein LolD | 8.95e-11 | NA | 2.59e-06 | NA |
7. B | Q52815 | General L-amino acid transport ATP-binding protein AapP | 6.79e-13 | NA | 5.23e-12 | NA |
7. B | Q0T8D1 | Thiamine import ATP-binding protein ThiQ | 1.45e-11 | NA | 7.38e-11 | NA |
7. B | Q8PY27 | Putative ABC transporter ATP-binding protein MM_1037 | 3.48e-09 | NA | 7.30e-11 | NA |
7. B | Q66AT7 | Zinc import ATP-binding protein ZnuC | 2.16e-09 | NA | 8.39e-10 | NA |
7. B | Q166I9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.12e-07 | NA | 2.38e-05 | NA |
7. B | Q2YKX3 | Fe(3+) ions import ATP-binding protein FbpC | 5.08e-09 | NA | 3.51e-16 | NA |
7. B | Q2JPW6 | Phosphonates import ATP-binding protein PhnC 1 | 2.70e-11 | NA | 0.002 | NA |
7. B | Q2FII2 | Methionine import ATP-binding protein MetN 2 | 3.29e-11 | NA | 2.86e-13 | NA |
7. B | Q4WUS1 | ABC multidrug transporter I | 4.21e-03 | NA | 3.64e-04 | NA |
7. B | Q1CG91 | Methionine import ATP-binding protein MetN 1 | 1.81e-10 | NA | 9.82e-14 | NA |
7. B | Q3B3H7 | Phosphate import ATP-binding protein PstB | 5.96e-08 | NA | 1.95e-10 | NA |
7. B | Q1C812 | Zinc import ATP-binding protein ZnuC | 1.67e-09 | NA | 8.08e-10 | NA |
7. B | Q9CP98 | Ribose import ATP-binding protein RbsA 1 | 8.51e-04 | NA | 2.78e-07 | NA |
7. B | Q1JBJ4 | Phosphate import ATP-binding protein PstB 2 | 4.89e-12 | NA | 5.44e-18 | NA |
7. B | Q6Y306 | ATP-binding cassette sub-family C member 12 | 2.33e-15 | NA | 1.30e-29 | NA |
7. B | P0CZ29 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.56e-09 | NA | 7.60e-12 | NA |
7. B | Q6GEL4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.38e-08 | NA | 4.58e-17 | NA |
7. B | Q8D9J4 | Spermidine/putrescine import ATP-binding protein PotA | 5.49e-07 | NA | 1.03e-17 | NA |
7. B | Q6GJL2 | Methionine import ATP-binding protein MetN 1 | 8.35e-12 | NA | 7.39e-18 | NA |
7. B | Q8Z864 | Glutathione import ATP-binding protein GsiA | 2.38e-04 | NA | 2.98e-10 | NA |
7. B | Q8ELR4 | Spermidine/putrescine import ATP-binding protein PotA | 1.72e-09 | NA | 4.13e-15 | NA |
7. B | Q0B7X0 | Ribose import ATP-binding protein RbsA 2 | 1.35e-03 | NA | 0.014 | NA |
7. B | Q8XXY9 | Nod factor export ATP-binding protein I | 4.50e-08 | NA | 3.36e-08 | NA |
7. B | P0C0E3 | Lantibiotic transport ATP-binding protein SrtF | 5.92e-08 | NA | 2.31e-12 | NA |
7. B | Q2FH57 | Nickel import system ATP-binding protein NikD | 6.76e-10 | NA | 1.10e-09 | NA |
7. B | Q5LXJ4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.01e-10 | NA | 1.26e-15 | NA |
7. B | Q215F6 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 8.12e-11 | NA | 1.38e-06 | NA |
7. B | O34977 | Uncharacterized ABC transporter ATP-binding protein YthP | 6.27e-09 | NA | 3.52e-05 | NA |
7. B | Q8YYE2 | Phosphate import ATP-binding protein PstB 2 | 2.37e-12 | NA | 4.12e-11 | NA |
7. B | Q5SLN1 | Phosphate import ATP-binding protein PstB | 2.68e-09 | NA | 2.57e-18 | NA |
7. B | Q1GH74 | Phosphate import ATP-binding protein PstB | 4.82e-11 | NA | 8.48e-17 | NA |
7. B | Q3IS07 | Phosphate import ATP-binding protein PstB 1 | 5.79e-09 | NA | 5.14e-16 | NA |
7. B | Q2LY16 | Cobalt import ATP-binding protein CbiO | 2.22e-09 | NA | 7.47e-10 | NA |
7. B | Q0VTB6 | Zinc import ATP-binding protein ZnuC | 2.86e-09 | NA | 4.99e-10 | NA |
7. B | Q7MIR0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.48e-09 | NA | 0.040 | NA |
7. B | Q1IKM7 | Lipoprotein-releasing system ATP-binding protein LolD | 1.77e-11 | NA | 2.71e-08 | NA |
7. B | Q7NX01 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 5.46e-11 | NA | 5.09e-10 | NA |
7. B | Q57CD8 | Putative ABC transporter ATP-binding protein BruAb1_1365 | 2.33e-10 | NA | 0.002 | NA |
7. B | P40735 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.58e-10 | NA | 2.98e-16 | NA |
7. B | Q7V7P0 | Phosphate import ATP-binding protein PstB | 5.18e-12 | NA | 2.10e-12 | NA |
7. B | A3CMQ7 | Spermidine/putrescine import ATP-binding protein PotA | 2.00e-09 | NA | 3.22e-16 | NA |
7. B | Q1CJS9 | Fe(3+) ions import ATP-binding protein FbpC | 5.79e-09 | NA | 1.83e-15 | NA |
7. B | Q8E2L3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.43e-10 | NA | 3.47e-13 | NA |
7. B | A0A2U8U2K9 | ABC transporter asL7 | 1.04e-03 | NA | 1.08e-04 | NA |
7. B | Q895Y0 | Phosphate import ATP-binding protein PstB | 1.02e-12 | NA | 8.56e-12 | NA |
7. B | Q4L9P7 | Phosphonates import ATP-binding protein PhnC | 4.92e-11 | NA | 2.08e-11 | NA |
7. B | P0CZ34 | Spermidine/putrescine import ATP-binding protein PotA | 1.29e-09 | NA | 9.94e-16 | NA |
7. B | G5EE72 | Multidrug resistance-associated protein 5 | 3.33e-16 | NA | 2.20e-24 | NA |
7. B | Q1BWI2 | Nod factor export ATP-binding protein I | 5.03e-09 | NA | 4.71e-13 | NA |
7. B | Q8A1M1 | Lipoprotein-releasing system ATP-binding protein LolD | 5.40e-11 | NA | 7.62e-08 | NA |
7. B | Q09427 | ATP-binding cassette sub-family C member 8 | 2.71e-11 | NA | 6.54e-18 | NA |
7. B | Q8NSN2 | Methionine import ATP-binding protein MetN | 1.10e-10 | NA | 1.01e-17 | NA |
7. B | Q3A558 | Lipoprotein-releasing system ATP-binding protein LolD | 1.78e-11 | NA | 2.23e-10 | NA |
7. B | Q7VUJ5 | Molybdenum import ATP-binding protein ModC | 1.37e-07 | NA | 1.59e-08 | NA |
7. B | Q2QV81 | ABC transporter G family member 49 | 4.71e-03 | NA | 1.27e-04 | NA |
7. B | P77279 | Probable iron export ATP-binding protein FetA | 5.21e-12 | NA | 8.01e-15 | NA |
7. B | Q32DZ9 | Macrolide export ATP-binding/permease protein MacB | 3.32e-06 | NA | 9.23e-11 | NA |
7. B | Q2FRT7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 5.45e-09 | NA | 8.26e-16 | NA |
7. B | P14175 | Glycine betaine/proline betaine transport system ATP-binding protein ProV | 7.64e-11 | NA | 5.99e-19 | NA |
7. B | Q6MPX9 | Macrolide export ATP-binding/permease protein MacB | 1.55e-02 | NA | 2.27e-08 | NA |
7. B | Q38YC2 | Phosphate import ATP-binding protein PstB 1 | 1.27e-12 | NA | 1.58e-16 | NA |
7. B | Q0SY86 | Xylose import ATP-binding protein XylG | 6.11e-04 | NA | 0.002 | NA |
7. B | Q8UBN2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 1.99e-03 | NA | 0.023 | NA |
7. B | P0AAG9 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.01e-03 | NA | 5.15e-06 | NA |
7. B | Q49XI8 | Phosphate import ATP-binding protein PstB | 6.13e-09 | NA | 3.33e-14 | NA |
7. B | Q3JKX3 | Taurine import ATP-binding protein TauB | 7.69e-08 | NA | 4.33e-06 | NA |
7. B | Q81P94 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.92e-07 | NA | 1.51e-09 | NA |
7. B | Q3SQ65 | Hemin import ATP-binding protein HmuV | 1.14e-09 | NA | 8.06e-05 | NA |
7. B | Q1RGD0 | Thiamine import ATP-binding protein ThiQ | 9.05e-12 | NA | 3.71e-10 | NA |
7. B | P0A2V9 | Phosphate import ATP-binding protein PstB 3 | 1.63e-13 | NA | 1.57e-14 | NA |
7. B | Q8X8E3 | Lipoprotein-releasing system ATP-binding protein LolD | 2.57e-10 | NA | 5.92e-08 | NA |
7. B | O31711 | Uncharacterized ABC transporter ATP-binding protein YknY | 2.16e-10 | NA | 1.86e-08 | NA |
7. B | Q7WGW1 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.86e-10 | NA | 8.83e-10 | NA |
7. B | Q3YW77 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.49e-10 | NA | 1.09e-07 | NA |
7. B | Q38YC1 | Phosphate import ATP-binding protein PstB 2 | 8.96e-13 | NA | 5.18e-15 | NA |
7. B | Q8RPP4 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.74e-09 | NA | 4.62e-05 | NA |
7. B | Q662E6 | Phosphate import ATP-binding protein PstB | 3.57e-13 | NA | 3.06e-12 | NA |
7. B | Q5KYQ7 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 4.79e-04 | NA | 3.54e-04 | NA |
7. B | Q5W274 | Pleiotropic drug resistance protein 3 | 4.90e-04 | NA | 0.005 | NA |
7. B | Q98G43 | Fe(3+) ions import ATP-binding protein FbpC | 6.78e-09 | NA | 2.93e-14 | NA |
7. B | Q8NMK1 | Phosphate import ATP-binding protein PstB | 2.79e-11 | NA | 4.04e-04 | NA |
7. B | P33593 | Nickel import ATP-binding protein NikD | 1.13e-11 | NA | 4.94e-06 | NA |
7. B | Q8YM92 | Spermidine/putrescine import ATP-binding protein PotA | 6.63e-07 | NA | 4.31e-13 | NA |
7. B | Q8GU87 | ABC transporter G family member 31 | 4.47e-03 | NA | 2.55e-05 | NA |
7. B | P9WQI2 | Trehalose import ATP-binding protein SugC | 1.81e-10 | NA | 7.76e-12 | NA |
7. B | Q834B3 | Phosphate import ATP-binding protein PstB 2 | 1.77e-11 | NA | 3.75e-16 | NA |
7. B | Q5NN23 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.97e-09 | NA | 2.71e-16 | NA |
7. B | Q5FA19 | Fe(3+) ions import ATP-binding protein FbpC | 3.04e-09 | NA | 1.37e-15 | NA |
7. B | Q31I88 | Phosphate import ATP-binding protein PstB | 1.09e-07 | NA | 1.16e-17 | NA |
7. B | Q0B5V4 | Arabinose import ATP-binding protein AraG 2 | 1.04e-03 | NA | 6.11e-07 | NA |
7. B | Q1GAN9 | Methionine import ATP-binding protein MetN | 2.90e-10 | NA | 1.04e-13 | NA |
7. B | P44656 | Uncharacterized ABC transporter ATP-binding protein HI_0354 | 6.23e-07 | NA | 1.70e-07 | NA |
7. B | A1UG51 | Spermidine/putrescine import ATP-binding protein PotA | 1.47e-06 | NA | 7.60e-09 | NA |
7. B | Q93DX8 | Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) | 7.44e-11 | NA | 1.56e-10 | NA |
7. B | Q58967 | Putative ABC transporter ATP-binding protein MJ1572 | 3.10e-11 | NA | 1.91e-13 | NA |
7. B | Q72PP0 | Lipoprotein-releasing system ATP-binding protein LolD | 6.31e-09 | NA | 7.21e-08 | NA |
7. B | Q74L62 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 7.92e-09 | NA | 8.70e-11 | NA |
7. B | Q32EX7 | Lipoprotein-releasing system ATP-binding protein LolD | 1.62e-10 | NA | 1.69e-08 | NA |
7. B | Q3B5J7 | Macrolide export ATP-binding/permease protein MacB | 7.40e-06 | NA | 5.57e-06 | NA |
7. B | Q8ETV6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 6.05e-09 | NA | 2.66e-11 | NA |
7. B | Q0VL18 | Phosphate import ATP-binding protein PstB | 3.66e-09 | NA | 1.06e-12 | NA |
7. B | B2RX12 | ATP-binding cassette sub-family C member 3 | 1.44e-15 | NA | 2.11e-25 | NA |
7. B | Q5PDU4 | Cobalt import ATP-binding protein CbiO | 1.03e-08 | NA | 0.004 | NA |
7. B | Q2IWV8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.08e-10 | NA | 2.30e-05 | NA |
7. B | Q6WB51 | Phosphate import ATP-binding protein PstB | 8.37e-12 | NA | 3.60e-15 | NA |
7. B | O15440 | ATP-binding cassette sub-family C member 5 | 0.00e+00 | NA | 1.25e-23 | NA |
7. B | Q6F1N1 | Phosphate import ATP-binding protein PstB | 1.87e-08 | NA | 1.40e-11 | NA |
7. B | Q9CH26 | Teichoic acids export ATP-binding protein TagH | 4.05e-05 | NA | 1.77e-05 | NA |
7. B | Q13VD7 | Methionine import ATP-binding protein MetN 1 | 2.43e-08 | NA | 4.92e-10 | NA |
7. B | Q1JGL3 | Phosphate import ATP-binding protein PstB 1 | 5.85e-13 | NA | 2.88e-09 | NA |
7. B | O29527 | Putative ABC transporter ATP-binding protein AF_0731 | 1.70e-08 | NA | 2.27e-08 | NA |
7. B | Q03PY6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.10e-08 | NA | 1.52e-08 | NA |
7. B | Q254K9 | Methionine import ATP-binding protein MetN | 2.60e-11 | NA | 1.05e-12 | NA |
7. B | O15438 | ATP-binding cassette sub-family C member 3 | 1.44e-15 | NA | 4.40e-26 | NA |
7. B | Q8P2L5 | Oligopeptide transport ATP-binding protein OppF | 6.59e-11 | NA | 2.05e-15 | NA |
7. B | A0KE71 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 5.71e-07 | NA | 5.24e-07 | NA |
7. B | Q13FD9 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 2.03e-03 | NA | 6.90e-06 | NA |
7. B | P19566 | Maltose/maltodextrin import ATP-binding protein MalK | 3.55e-11 | NA | 5.21e-12 | NA |
7. B | Q8GU89 | ABC transporter G family member 37 | 6.24e-04 | NA | 3.22e-04 | NA |
7. B | P63361 | Phosphate import ATP-binding protein PstB | 2.86e-09 | NA | 9.85e-16 | NA |
7. B | Q83LN2 | Aliphatic sulfonates import ATP-binding protein SsuB | 6.75e-08 | NA | 1.39e-11 | NA |
7. B | Q97JB8 | Putative ABC transporter ATP-binding protein CA_C1368 | 5.83e-09 | NA | 2.97e-10 | NA |
7. B | Q9S472 | L-arabinose transport ATP-binding protein AraG | 5.73e-04 | NA | 1.77e-06 | NA |
7. B | Q88RL5 | Methionine import ATP-binding protein MetN 1 | 1.56e-12 | NA | 2.64e-16 | NA |
7. B | Q5MB13 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 4.12e-02 | NA | 4.54e-09 | NA |
7. B | Q54BU4 | ABC transporter B family member 1 | 0.00e+00 | NA | 3.53e-66 | NA |
7. B | Q8Z2R4 | Ribose import ATP-binding protein RbsA | 8.85e-04 | NA | 2.97e-04 | NA |
7. B | P47545 | Putative ABC transporter ATP-binding protein MG303 | 6.01e-07 | NA | 0.001 | NA |
7. B | Q0RYP7 | Fe(3+) ions import ATP-binding protein FbpC 3 | 1.87e-09 | NA | 4.40e-15 | NA |
7. B | Q0D9V6 | Protein STAR1 | 4.76e-12 | NA | 1.41e-17 | NA |
7. B | Q83LR7 | Macrolide export ATP-binding/permease protein MacB | 3.25e-02 | NA | 1.41e-10 | NA |
7. B | Q14H97 | Methionine import ATP-binding protein MetN | 7.68e-12 | NA | 6.34e-16 | NA |
7. B | O32169 | Methionine import ATP-binding protein MetN | 2.79e-11 | NA | 7.75e-14 | NA |
7. B | Q9FLT4 | ABC transporter A family member 10 | 3.13e-04 | NA | 2.35e-09 | NA |
7. B | Q04CG8 | Phosphonates import ATP-binding protein PhnC | 8.65e-12 | NA | 1.44e-09 | NA |
7. B | Q8T690 | ABC transporter G family member 3 | 7.13e-04 | NA | 3.26e-05 | NA |
7. B | Q9A1G5 | Probable ABC transporter ATP-binding protein SPy_0285/M5005_Spy0242 | 5.76e-07 | NA | 4.08e-06 | NA |
7. B | Q6WB63 | Phosphonates import ATP-binding protein PhnC | 5.51e-10 | NA | 5.19e-13 | NA |
7. B | P07821 | Iron(3+)-hydroxamate import ATP-binding protein FhuC | 2.50e-11 | NA | 1.04e-11 | NA |
7. B | Q2JUA1 | Phosphate import ATP-binding protein PstB 1 | 8.09e-13 | NA | 2.57e-11 | NA |
7. B | Q2SNX4 | Phosphate import ATP-binding protein PstB | 5.22e-12 | NA | 4.24e-16 | NA |
7. B | Q99VG8 | Methionine import ATP-binding protein MetN 2 | 2.98e-11 | NA | 3.53e-13 | NA |
7. B | Q4QK57 | Spermidine/putrescine import ATP-binding protein PotA | 2.48e-09 | NA | 8.57e-17 | NA |
7. B | Q8TSA8 | Phosphate import ATP-binding protein PstB | 2.36e-12 | NA | 3.87e-13 | NA |
7. B | Q65E84 | Teichoic acids export ATP-binding protein TagH | 1.48e-06 | NA | 1.10e-08 | NA |
7. B | Q82VL9 | Lipoprotein-releasing system ATP-binding protein LolD | 3.80e-11 | NA | 1.89e-07 | NA |
7. B | Q16928 | Protein white | 2.26e-02 | NA | 2.40e-05 | NA |
7. B | Q4KFA2 | Lipoprotein-releasing system ATP-binding protein LolD | 5.75e-10 | NA | 7.37e-11 | NA |
7. B | Q81PZ8 | Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 | 2.36e-04 | NA | 3.41e-12 | NA |
7. B | Q1CN15 | Autoinducer 2 import ATP-binding protein LsrA | 5.29e-04 | NA | 7.59e-05 | NA |
7. B | Q577J5 | Putative peptide import ATP-binding protein BruAb2_0796 | 1.30e-09 | NA | 2.24e-10 | NA |
7. B | Q2J1U0 | Molybdenum import ATP-binding protein ModC | 1.96e-07 | NA | 3.82e-10 | NA |
7. B | Q1BG93 | Xylose import ATP-binding protein XylG | 9.33e-04 | NA | 0.013 | NA |
7. B | P0CZ26 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.16e-10 | NA | 1.38e-13 | NA |
7. B | Q1CJG3 | Zinc import ATP-binding protein ZnuC | 3.27e-10 | NA | 8.08e-10 | NA |
7. B | Q4A5A5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.49e-12 | NA | 2.58e-17 | NA |
7. B | Q399M3 | Macrolide export ATP-binding/permease protein MacB | 6.89e-02 | NA | 1.36e-08 | NA |
7. B | P77268 | Probable D,D-dipeptide transport ATP-binding protein DdpD | 4.96e-10 | NA | 3.98e-08 | NA |
7. B | Q49ZE0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.49e-10 | NA | 2.99e-17 | NA |
7. B | Q3BTD3 | Lipoprotein-releasing system ATP-binding protein LolD | 3.22e-10 | NA | 6.82e-06 | NA |
7. B | Q24XJ2 | Spermidine/putrescine import ATP-binding protein PotA | 1.21e-09 | NA | 1.74e-12 | NA |
7. B | B9GDE5 | ABC transporter G family member 50 | 9.94e-04 | NA | 5.88e-06 | NA |
7. B | A0PY57 | Spermidine/putrescine import ATP-binding protein PotA | 9.99e-10 | NA | 2.11e-14 | NA |
7. B | Q8ZGX6 | Molybdenum import ATP-binding protein ModC | 1.61e-08 | NA | 1.28e-12 | NA |
7. B | Q664P8 | Taurine import ATP-binding protein TauB | 7.88e-08 | NA | 1.66e-06 | NA |
7. B | Q1R155 | Zinc import ATP-binding protein ZnuC | 1.68e-09 | NA | 7.03e-11 | NA |
7. B | P0A9U0 | Uncharacterized ABC transporter ATP-binding protein YbbA | 3.15e-10 | NA | 3.10e-12 | NA |
7. B | Q1CIX6 | Arabinose import ATP-binding protein AraG | 7.19e-04 | NA | 1.01e-05 | NA |
7. B | O51236 | Phosphate import ATP-binding protein PstB | 3.66e-13 | NA | 7.42e-12 | NA |
7. B | D4GSY7 | Probable anion import ATP-binding protein HVO_1886 | 1.42e-10 | NA | 2.71e-08 | NA |
7. B | A2RI78 | Dipeptide transport ATP-binding protein DppF | 1.75e-11 | NA | 1.31e-14 | NA |
7. B | Q8Y454 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.94e-09 | NA | 8.47e-14 | NA |
7. B | Q86UK0 | Glucosylceramide transporter ABCA12 | 3.51e-03 | NA | 5.76e-06 | NA |
7. B | P0AAI0 | Peptide transport system ATP-binding protein SapF | 7.98e-11 | NA | 1.10e-14 | NA |
7. B | Q9Z3I3 | Nod factor export ATP-binding protein I | 1.70e-09 | NA | 1.58e-09 | NA |
7. B | Q5ANA3 | Pleiotropic ABC efflux transporter of multiple drugs CDR1 | 3.22e-02 | NA | 1.08e-04 | NA |
7. B | Q1B3B4 | Phosphate import ATP-binding protein PstB | 1.87e-11 | NA | 1.46e-05 | NA |
7. B | O15439 | ATP-binding cassette sub-family C member 4 | 1.11e-16 | NA | 1.43e-25 | NA |
7. B | Q8ESM5 | Phosphonates import ATP-binding protein PhnC 1 | 4.15e-11 | NA | 2.89e-11 | NA |
7. B | Q8YDJ8 | Zinc import ATP-binding protein ZnuC | 7.12e-09 | NA | 1.10e-06 | NA |
7. B | Q8RHK9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 4.27e-08 | NA | 1.50e-07 | NA |
7. B | Q5P4W2 | Molybdenum import ATP-binding protein ModC | 1.60e-07 | NA | 1.84e-07 | NA |
7. B | P44785 | Methionine import ATP-binding protein MetN | NA | NA | 3.40e-16 | NA |
7. B | Q57855 | Uncharacterized ABC transporter ATP-binding protein MJ0412 | 6.22e-07 | NA | 9.67e-07 | NA |
7. B | Q60AI1 | Spermidine/putrescine import ATP-binding protein PotA | 5.72e-07 | NA | 2.99e-14 | NA |
7. B | Q5KYS1 | Xylose import ATP-binding protein XylG | 4.25e-04 | NA | 0.005 | NA |
7. B | Q88QK7 | UvrABC system protein A | 6.45e-02 | NA | 0.003 | NA |
7. B | Q45593 | Probable peptide export ATP-binding protein YydI | 1.32e-07 | NA | 0.021 | NA |
7. B | Q8FRX8 | Methionine import ATP-binding protein MetN | 2.71e-10 | NA | 9.76e-18 | NA |
7. B | Q9X1Z1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.89e-10 | NA | 2.45e-14 | NA |
7. B | Q8REE1 | Galactose/methyl galactoside import ATP-binding protein MglA | 7.12e-04 | NA | 9.72e-05 | NA |
7. B | Q8X8K4 | Uncharacterized ABC transporter ATP-binding protein YcjV | 2.39e-11 | NA | 2.51e-12 | NA |
7. B | Q16BC5 | Phosphonates import ATP-binding protein PhnC 1 | 2.66e-10 | NA | 1.85e-08 | NA |
7. B | Q4A5Q4 | Spermidine/putrescine import ATP-binding protein PotA | 1.54e-04 | NA | 2.90e-04 | NA |
7. B | Q99X73 | Phosphonates import ATP-binding protein PhnC | 5.99e-11 | NA | 5.18e-12 | NA |
7. B | Q1RD28 | Spermidine/putrescine import ATP-binding protein PotA | 2.31e-09 | NA | 1.19e-15 | NA |
7. B | P41820 | Brefeldin A resistance protein | 1.03e-03 | NA | 1.17e-04 | NA |
7. B | Q8FJL0 | Glutathione import ATP-binding protein GsiA | 2.56e-04 | NA | 4.10e-11 | NA |
7. B | Q6FYL0 | Macrolide export ATP-binding/permease protein MacB | 6.05e-06 | NA | 6.55e-13 | NA |
7. B | Q5HDJ6 | Putative hemin import ATP-binding protein HrtA | 8.41e-11 | NA | 6.98e-10 | NA |
7. B | P46903 | ABC transporter ATP-binding protein NatA | 8.81e-11 | NA | 1.36e-07 | NA |
7. B | Q2YLW6 | Thiamine import ATP-binding protein ThiQ | 1.25e-10 | NA | 5.83e-07 | NA |
7. B | Q31ZK0 | Spermidine/putrescine import ATP-binding protein PotA | 1.64e-09 | NA | 8.39e-16 | NA |
7. B | Q8H8V7 | ABC transporter G family member 5 | 2.69e-02 | NA | 0.014 | NA |
7. B | Q1WVI7 | Spermidine/putrescine import ATP-binding protein PotA | 5.43e-10 | NA | 1.45e-14 | NA |
7. B | Q74R28 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.90e-10 | NA | 4.16e-10 | NA |
7. B | Q87EF4 | Lipoprotein-releasing system ATP-binding protein LolD | 1.40e-10 | NA | 8.99e-07 | NA |
7. B | Q04DA7 | Methionine import ATP-binding protein MetN 2 | 8.48e-11 | NA | 2.14e-22 | NA |
7. B | Q9C8G9 | ABC transporter C family member 1 | 9.99e-16 | NA | 4.89e-22 | NA |
7. B | Q3IL62 | Lipoprotein-releasing system ATP-binding protein LolD | 8.71e-10 | NA | 3.62e-06 | NA |
7. B | Q15TB1 | Lipoprotein-releasing system ATP-binding protein LolD | 6.28e-11 | NA | 7.22e-10 | NA |
7. B | Q8D740 | Molybdenum import ATP-binding protein ModC | 2.20e-08 | NA | 1.67e-10 | NA |
7. B | Q7UX73 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 6.80e-11 | NA | 9.41e-15 | NA |
7. B | Q65TB7 | Lipoprotein-releasing system ATP-binding protein LolD | 1.59e-10 | NA | 1.05e-06 | NA |
7. B | Q0T810 | Methionine import ATP-binding protein MetN | 1.34e-11 | NA | 1.34e-13 | NA |
7. B | Q92L31 | Thiamine import ATP-binding protein ThiQ | 6.13e-11 | NA | 1.54e-06 | NA |
7. B | B8ALI0 | ABC transporter G family member 5 | 5.20e-02 | NA | 0.013 | NA |
7. B | P72477 | Putative ABC transporter ATP-binding protein | 1.72e-09 | NA | 2.32e-13 | NA |
7. B | Q9FIB4 | ABC transporter F family member 2 | 7.37e-06 | NA | 1.92e-09 | NA |
7. B | Q5HQW9 | UvrABC system protein A | 1.63e-02 | NA | 0.047 | NA |
7. B | Q66EN1 | Thiamine import ATP-binding protein ThiQ | 2.26e-11 | NA | 1.39e-10 | NA |
7. B | Q6D1C4 | Methionine import ATP-binding protein MetN 3 | 1.70e-11 | NA | 1.06e-14 | NA |
7. B | Q5M243 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 5.54e-10 | NA | 1.63e-14 | NA |
7. B | O30506 | Arginine/ornithine transport ATP-binding protein AotP | 8.84e-12 | NA | 1.57e-08 | NA |
7. B | Q3Z057 | Galactose/methyl galactoside import ATP-binding protein MglA | 8.77e-04 | NA | 5.15e-06 | NA |
7. B | Q5WY52 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.21e-09 | NA | 1.90e-05 | NA |
7. B | Q8FMN9 | Phosphate import ATP-binding protein PstB | 5.85e-12 | NA | 0.003 | NA |
7. B | Q928L8 | Methionine import ATP-binding protein MetN 2 | 1.84e-11 | NA | 4.15e-12 | NA |
7. B | Q8XVS2 | Arabinose import ATP-binding protein AraG | 1.55e-03 | NA | 3.86e-04 | NA |
7. B | Q50294 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.05e-11 | NA | 1.44e-19 | NA |
7. B | Q9WY65 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.59e-08 | NA | 2.26e-14 | NA |
7. B | Q5M5Z2 | Methionine import ATP-binding protein MetN | 7.06e-11 | NA | 1.07e-17 | NA |
7. B | Q5WET8 | Phosphate import ATP-binding protein PstB 1 | 5.58e-13 | NA | 3.18e-13 | NA |
7. B | P50332 | Nod factor export ATP-binding protein I | 3.63e-09 | NA | 5.64e-10 | NA |
7. B | Q9M3B9 | ABC transporter B family member 20 | 1.09e-13 | NA | 1.11e-46 | NA |
7. B | Q890D1 | Nickel import ATP-binding protein LarO | 3.83e-12 | NA | 1.58e-09 | NA |
7. B | Q6F9A8 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.26e-10 | NA | 3.21e-14 | NA |
7. B | Q6NJ07 | Methionine import ATP-binding protein MetN | 9.78e-11 | NA | 3.90e-16 | NA |
7. B | Q63JZ3 | Taurine import ATP-binding protein TauB | 9.11e-08 | NA | 3.85e-06 | NA |
7. B | Q8TYV9 | Putative ABC transporter ATP-binding protein MK0182 | 4.59e-09 | NA | 1.08e-05 | NA |
7. B | Q88HL1 | Nickel import ATP-binding protein NikD | 2.10e-10 | NA | 6.79e-05 | NA |
7. B | Q0HH38 | Phosphate import ATP-binding protein PstB | 1.17e-11 | NA | 9.98e-16 | NA |
7. B | Q3ATA4 | Phosphate import ATP-binding protein PstB | 9.24e-13 | NA | 1.83e-16 | NA |
7. B | Q92337 | ATP-binding cassette transporter abc1 | 6.66e-16 | NA | 6.56e-22 | NA |
7. B | Q1R9L8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.09e-10 | NA | 5.93e-05 | NA |
7. B | Q21Y06 | Phosphonates import ATP-binding protein PhnC 2 | 5.14e-10 | NA | 7.91e-07 | NA |
7. B | Q6CYU2 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.06e-07 | NA | 7.41e-11 | NA |
7. B | Q2P3E1 | Lipoprotein-releasing system ATP-binding protein LolD | 1.82e-10 | NA | 1.58e-05 | NA |
7. B | P57403 | Zinc import ATP-binding protein ZnuC | 8.71e-10 | NA | 0.013 | NA |
7. B | Q46ZA5 | Phosphate import ATP-binding protein PstB | 1.18e-11 | NA | 2.99e-15 | NA |
7. B | Q2W1R8 | Molybdenum import ATP-binding protein ModC | 7.15e-08 | NA | 6.10e-10 | NA |
7. B | Q8UBY6 | Thiamine import ATP-binding protein ThiQ | 3.57e-12 | NA | 3.04e-05 | NA |
7. B | Q1BZA2 | Arabinose import ATP-binding protein AraG 1 | 1.38e-03 | NA | 3.76e-04 | NA |
7. B | Q6FWS5 | Pleiotropic ABC efflux transporter of multiple drugs YBT1 | 3.12e-14 | NA | 1.87e-23 | NA |
7. B | Q8DEW5 | Phosphate import ATP-binding protein PstB 1 | 2.77e-11 | NA | 3.06e-16 | NA |
7. B | Q7M9G3 | Phosphate import ATP-binding protein PstB | 1.31e-12 | NA | 7.76e-14 | NA |
7. B | Q8R4P9 | ATP-binding cassette sub-family C member 10 | 1.27e-12 | NA | 1.10e-23 | NA |
7. B | Q0PAB6 | Methionine import ATP-binding protein MetN | 6.14e-11 | NA | 2.15e-11 | NA |
7. B | P25371 | Probable ATP-dependent permease | 9.66e-02 | NA | 3.83e-06 | NA |
7. B | Q66C83 | Galactose/methyl galactoside import ATP-binding protein MglA | 8.65e-04 | NA | 2.27e-05 | NA |
7. B | Q1C1S0 | Aliphatic sulfonates import ATP-binding protein SsuB | 9.50e-08 | NA | 5.00e-11 | NA |
7. B | P0AAF8 | Arginine transport ATP-binding protein ArtP | 2.45e-12 | NA | 9.44e-07 | NA |
7. B | Q81K31 | Teichoic acids export ATP-binding protein TagH | 5.65e-05 | NA | 2.26e-04 | NA |
7. B | Q668K6 | Sulfate/thiosulfate import ATP-binding protein CysA | 7.04e-10 | NA | 2.71e-12 | NA |
7. B | Q8KLG1 | Nod factor export ATP-binding protein I | 2.27e-05 | NA | 7.17e-11 | NA |
7. B | Q8UBB7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 | 4.95e-11 | NA | 2.07e-07 | NA |
7. B | Q65T42 | Sulfate/thiosulfate import ATP-binding protein CysA | 5.97e-10 | NA | 2.81e-12 | NA |
7. B | A6TEB8 | Autoinducer 2 import ATP-binding protein LsrA | 4.05e-04 | NA | 1.38e-05 | NA |
7. B | Q54NL1 | ABC transporter C family member 9 | 3.70e-14 | NA | 1.81e-25 | NA |
7. B | Q21PQ7 | Zinc import ATP-binding protein ZnuC | 1.36e-09 | NA | 2.95e-06 | NA |
7. B | Q47L96 | Phosphate import ATP-binding protein PstB | 6.12e-12 | NA | 3.10e-15 | NA |
7. B | Q8RD07 | Putative ABC transporter ATP-binding protein TTE0246 | 1.20e-12 | NA | 1.39e-14 | NA |
7. B | Q81LW6 | Phosphate import ATP-binding protein PstB | 6.03e-13 | NA | 3.00e-14 | NA |
7. B | Q8PVF6 | Phosphate import ATP-binding protein PstB | 5.67e-12 | NA | 3.45e-14 | NA |
7. B | O06476 | Uncharacterized ABC transporter ATP-binding protein YfmR | 4.51e-05 | NA | 1.46e-05 | NA |
7. B | Q0TC10 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.09e-10 | NA | 3.99e-06 | NA |
7. B | Q180A5 | Phosphate import ATP-binding protein PstB | 9.36e-12 | NA | 1.10e-12 | NA |
7. B | Q3MBW2 | Phosphate import ATP-binding protein PstB 2 | 6.55e-13 | NA | 2.35e-12 | NA |
7. B | Q6NBX6 | Phosphonates import ATP-binding protein PhnC 1 | 4.56e-11 | NA | 2.32e-10 | NA |
7. B | Q8FV85 | Methionine import ATP-binding protein MetN | 2.84e-10 | NA | 1.58e-10 | NA |
7. B | Q3ILC5 | Phosphate import ATP-binding protein PstB | 1.41e-11 | NA | 1.03e-16 | NA |
7. B | P37009 | Fe(3+) ions import ATP-binding protein FbpC | 3.56e-10 | NA | 6.53e-13 | NA |
7. B | P0A9W5 | Energy-dependent translational throttle protein EttA | 3.04e-04 | NA | 7.19e-06 | NA |
7. B | Q839D5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.14e-09 | NA | 3.69e-13 | NA |
7. B | B1IRU7 | Autoinducer 2 import ATP-binding protein LsrA | 6.53e-04 | NA | 1.29e-05 | NA |
7. B | Q74PI5 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.10e-07 | NA | 5.00e-11 | NA |
7. B | Q6D8T5 | Macrolide export ATP-binding/permease protein MacB | 5.61e-02 | NA | 8.90e-10 | NA |
7. B | Q0A9K1 | Phosphate import ATP-binding protein PstB | 3.27e-07 | NA | 5.22e-15 | NA |
7. B | Q7WID6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.03e-10 | NA | 1.58e-09 | NA |
7. B | Q88UV2 | Methionine import ATP-binding protein MetN 2 | 1.13e-11 | NA | 7.21e-19 | NA |
7. B | Q49VI3 | Teichoic acids export ATP-binding protein TagH | 2.09e-06 | NA | 8.90e-04 | NA |
7. B | Q1M360 | Ribose import ATP-binding protein RbsA 3 | 7.79e-04 | NA | 5.23e-04 | NA |
7. B | Q6F9P2 | Methionine import ATP-binding protein MetN 2 | 6.17e-12 | NA | 4.26e-15 | NA |
7. B | Q92GP5 | Lipoprotein-releasing system ATP-binding protein LolD | 6.87e-10 | NA | 1.15e-09 | NA |
7. B | Q5HG40 | Nickel import system ATP-binding protein NikD | 7.08e-10 | NA | 1.10e-09 | NA |
7. B | Q9C7F2 | ABC transporter B family member 14 | 0.00e+00 | NA | 8.46e-57 | NA |
7. B | Q032H3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.81e-08 | NA | 2.95e-15 | NA |
7. B | Q3YW48 | Nickel import ATP-binding protein NikE | 1.20e-10 | NA | 5.33e-12 | NA |
7. B | Q663Y5 | Xylose import ATP-binding protein XylG | 5.88e-04 | NA | 0.005 | NA |
7. B | P26050 | Nod factor export ATP-binding protein I | 8.89e-10 | NA | 4.14e-11 | NA |
7. B | Q93SS1 | Hemin import ATP-binding protein HmuV | 3.44e-09 | NA | 0.010 | NA |
7. B | Q08381 | Molybdenum import ATP-binding protein ModC | 1.90e-07 | NA | 7.56e-09 | NA |
7. B | Q9L0Q1 | Diacetylchitobiose uptake system ATP-binding protein MsiK | 8.16e-11 | NA | 1.27e-07 | NA |
7. B | Q8DWR4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.47e-10 | NA | 3.47e-13 | NA |
7. B | Q99PE8 | ATP-binding cassette sub-family G member 5 | 9.91e-03 | NA | 4.20e-07 | NA |
7. B | Q3IWB5 | Zinc import ATP-binding protein ZnuC | 3.49e-10 | NA | 3.12e-07 | NA |
7. B | Q8TI15 | Putative ABC transporter ATP-binding protein MA_4342 | 7.51e-08 | NA | 3.73e-11 | NA |
7. B | Q9JUX4 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.78e-10 | NA | 4.92e-14 | NA |
7. B | Q0BH79 | Methionine import ATP-binding protein MetN 1 | 2.77e-08 | NA | 1.58e-12 | NA |
7. B | Q896Y2 | Galactose/methyl galactoside import ATP-binding protein MglA | 6.79e-04 | NA | 0.003 | NA |
7. B | Q32IB5 | Glutathione import ATP-binding protein GsiA | 2.67e-04 | NA | 1.60e-10 | NA |
7. B | Q5PCG9 | Methionine import ATP-binding protein MetN 2 | 5.52e-11 | NA | 9.87e-13 | NA |
7. B | P12866 | Alpha-factor-transporting ATPase | 2.64e-14 | NA | 1.12e-34 | NA |
7. B | Q9PJX9 | Probable metal transport system ATP-binding protein TC_0697 | 6.53e-09 | NA | 4.86e-04 | NA |
7. B | Q58488 | Energy-coupling factor transporter ATP-binding protein EcfA | 7.47e-09 | NA | 2.48e-11 | NA |
7. B | P18813 | Maltose/maltodextrin import ATP-binding protein MalK (Fragment) | 1.52e-11 | NA | 1.71e-10 | NA |
7. B | P44884 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.48e-03 | NA | 6.21e-08 | NA |
7. B | Q0WJE4 | Thiamine import ATP-binding protein ThiQ | 2.25e-11 | NA | 1.19e-09 | NA |
7. B | P15031 | Fe(3+) dicitrate transport ATP-binding protein FecE | 4.49e-11 | NA | 2.30e-09 | NA |
7. B | Q0K1N8 | Phosphonates import ATP-binding protein PhnC 2 | 1.63e-09 | NA | 1.74e-06 | NA |
7. B | Q88KY4 | Lipoprotein-releasing system ATP-binding protein LolD | 6.39e-10 | NA | 2.07e-14 | NA |
7. B | Q6G194 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.19e-11 | NA | 5.57e-11 | NA |
7. B | Q4K441 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 7.46e-08 | NA | 2.65e-12 | NA |
7. B | Q3ZWN4 | Phosphate import ATP-binding protein PstB | 7.02e-13 | NA | 8.82e-18 | NA |
7. B | Q57T09 | Methionine import ATP-binding protein MetN 1 | 2.07e-11 | NA | 1.10e-13 | NA |
7. B | O74676 | ABC transporter CDR4 | 3.87e-03 | NA | 0.032 | NA |
7. B | Q8UI76 | Phosphate import ATP-binding protein PstB | 1.19e-08 | NA | 1.18e-15 | NA |
7. B | Q9KIF7 | Glycine betaine transport ATP-binding protein OpuAA | 2.94e-10 | NA | 2.22e-16 | NA |
7. B | Q87RS1 | Methionine import ATP-binding protein MetN | 1.88e-11 | NA | 3.39e-16 | NA |
7. B | Q5FFT1 | Phosphate import ATP-binding protein PstB | 5.50e-13 | NA | 9.88e-19 | NA |
7. B | Q7NUJ3 | Macrolide export ATP-binding/permease protein MacB | 5.40e-02 | NA | 2.24e-07 | NA |
7. B | Q7VMV4 | Lipoprotein-releasing system ATP-binding protein LolD | 1.34e-10 | NA | 4.19e-06 | NA |
7. B | Q7NA79 | Ribose import ATP-binding protein RbsA | 1.06e-03 | NA | 0.008 | NA |
7. B | Q4A5A4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.06e-08 | NA | 6.64e-09 | NA |
7. B | O60706 | ATP-binding cassette sub-family C member 9 | 2.24e-11 | NA | 5.62e-21 | NA |
7. B | P63355 | Methionine import ATP-binding protein MetN | 1.47e-11 | NA | 2.41e-14 | NA |
7. B | P63389 | Probable ATP-binding protein YheS | 1.53e-04 | NA | 5.38e-07 | NA |
7. B | A2RKA7 | Nucleoside import ATP-binding protein NupA | 1.33e-03 | NA | 6.80e-11 | NA |
7. B | Q1C5N7 | Phosphate import ATP-binding protein PstB 1 | 2.03e-11 | NA | 4.14e-14 | NA |
7. B | Q39BJ8 | Arabinose import ATP-binding protein AraG 2 | 1.13e-03 | NA | 9.14e-07 | NA |
7. B | Q9KXJ6 | Putative ABC transporter ATP-binding protein SCO2324 | 3.12e-04 | NA | 2.70e-10 | NA |
7. B | Q8YQ88 | Putative ABC transporter ATP-binding protein alr3946 | 1.55e-09 | NA | 3.26e-10 | NA |
7. B | P63369 | Phosphate import ATP-binding protein PstB 2 | 1.97e-12 | NA | 1.73e-17 | NA |
7. B | Q8R7Y5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.63e-09 | NA | 2.03e-14 | NA |
7. B | Q7CHQ3 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.75e-03 | NA | 2.27e-05 | NA |
7. B | Q2NUD6 | Galactose/methyl galactoside import ATP-binding protein MglA | 7.99e-04 | NA | 6.83e-07 | NA |
7. B | Q5MK06 | Macrolide export ATP-binding/permease protein MacB | 2.78e-02 | NA | 7.81e-09 | NA |
7. B | Q2IGQ6 | Phosphate import ATP-binding protein PstB | 4.86e-12 | NA | 7.13e-13 | NA |
7. B | Q9X196 | Spermidine/putrescine import ATP-binding protein PotA | 2.06e-09 | NA | 1.02e-13 | NA |
7. B | Q3YSK9 | Zinc import ATP-binding protein ZnuC | 5.04e-09 | NA | 0.009 | NA |
7. B | Q1MBG4 | Arabinose import ATP-binding protein AraG | 1.93e-03 | NA | 1.43e-04 | NA |
7. B | Q8XE58 | Cytochrome c biogenesis ATP-binding export protein CcmA | 9.07e-11 | NA | 5.77e-05 | NA |
7. B | A0K4E8 | Arabinose import ATP-binding protein AraG 1 | 1.40e-03 | NA | 3.76e-04 | NA |
7. B | P75796 | Glutathione import ATP-binding protein GsiA | 6.24e-05 | NA | 6.11e-11 | NA |
7. B | Q57GZ7 | Maltose/maltodextrin import ATP-binding protein MalK | 4.03e-11 | NA | 5.21e-12 | NA |
7. B | Q87MK8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.12e-09 | NA | 2.68e-05 | NA |
7. B | Q7A5Q8 | Nickel import system ATP-binding protein NikD | 6.28e-10 | NA | 6.43e-10 | NA |
7. B | Q0T3U8 | Zinc import ATP-binding protein ZnuC | 1.37e-09 | NA | 1.34e-10 | NA |
7. B | Q8DRS0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.90e-10 | NA | 3.92e-13 | NA |
7. B | O84071 | Probable metal transport system ATP-binding protein CT_068 | 7.66e-09 | NA | 3.96e-10 | NA |
7. B | Q895C4 | Methionine import ATP-binding protein MetN | 1.29e-11 | NA | 4.29e-15 | NA |
7. B | Q4KK46 | Methionine import ATP-binding protein MetN 2 | 9.61e-11 | NA | 9.46e-18 | NA |
7. B | Q48HD9 | Phosphate import ATP-binding protein PstB 1 | 2.17e-12 | NA | 9.74e-16 | NA |
7. B | Q6LU82 | Phosphate import ATP-binding protein PstB 1 | 1.77e-11 | NA | 1.41e-14 | NA |
7. B | Q6FAN3 | Methionine import ATP-binding protein MetN 1 | 2.53e-10 | NA | 1.79e-13 | NA |
7. B | Q2G7G7 | Lipoprotein-releasing system ATP-binding protein LolD | 8.32e-10 | NA | 0.021 | NA |
7. B | Q6ME20 | Methionine import ATP-binding protein MetN | 1.01e-10 | NA | 1.78e-12 | NA |
7. B | Q834B4 | Phosphate import ATP-binding protein PstB 1 | 4.19e-13 | NA | 7.21e-15 | NA |
7. B | P0AAH3 | Phosphate import ATP-binding protein PstB | 2.36e-11 | NA | 5.39e-19 | NA |
7. B | A3PRY1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.37e-10 | NA | 9.97e-10 | NA |
7. B | Q46BM0 | Phosphate import ATP-binding protein PstB | 5.69e-13 | NA | 1.17e-11 | NA |
7. B | Q3MAR5 | Spermidine/putrescine import ATP-binding protein PotA | 3.08e-09 | NA | 2.11e-13 | NA |
7. B | Q5HGY5 | Spermidine/putrescine import ATP-binding protein PotA | 1.94e-09 | NA | 2.87e-13 | NA |
7. B | Q8XAY7 | Autoinducer 2 import ATP-binding protein LsrA | 2.06e-03 | NA | 9.27e-06 | NA |
7. B | Q8RQL7 | Glutamate transport ATP-binding protein GluA | 1.39e-13 | NA | 2.04e-10 | NA |
7. B | P34358 | ABC transporter ced-7 | 3.67e-03 | NA | 2.08e-05 | NA |
7. B | Q9Z985 | UvrABC system protein A | 1.54e-01 | NA | 0.039 | NA |
7. B | Q1MQ44 | Spermidine/putrescine import ATP-binding protein PotA | 1.67e-09 | NA | 3.36e-12 | NA |
7. B | Q74KF8 | Phosphate import ATP-binding protein PstB 2 | 1.05e-11 | NA | 6.65e-16 | NA |
7. B | Q0C1C3 | Lipoprotein-releasing system ATP-binding protein LolD | 7.78e-11 | NA | 2.99e-06 | NA |
7. B | Q325U1 | Methionine import ATP-binding protein MetN | 1.88e-11 | NA | 2.32e-14 | NA |
7. B | Q1M8E0 | Methionine import ATP-binding protein MetN | 1.70e-07 | NA | 8.02e-07 | NA |
7. B | Q5L222 | Spermidine/putrescine import ATP-binding protein PotA | 7.04e-10 | NA | 7.57e-16 | NA |
7. B | Q7A342 | Putative ABC transporter ATP-binding protein SA2476 | 4.07e-04 | NA | 8.45e-10 | NA |
7. B | Q32HC7 | Arabinose import ATP-binding protein AraG | 7.69e-04 | NA | 6.56e-05 | NA |
7. B | Q6GEL3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.55e-11 | NA | 1.28e-17 | NA |
7. B | Q8YD40 | Methionine import ATP-binding protein MetN | 2.75e-10 | NA | 1.58e-10 | NA |
7. B | Q31VH5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.88e-10 | NA | 1.17e-07 | NA |
7. B | P0CZ27 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.66e-10 | NA | 1.38e-13 | NA |
7. B | Q0TQU8 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.50e-03 | NA | 1.18e-07 | NA |
7. B | Q9CNJ7 | Phosphate import ATP-binding protein PstB | 3.46e-12 | NA | 1.55e-15 | NA |
7. B | Q9K619 | Bacitracin export ATP-binding protein BceA | 3.36e-08 | NA | 2.14e-09 | NA |
7. B | Q2K204 | Ribose import ATP-binding protein RbsA 2 | 8.43e-04 | NA | 7.97e-05 | NA |
7. B | Q38UU0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.82e-10 | NA | 1.46e-19 | NA |
7. B | P69876 | Spermidine/putrescine import ATP-binding protein PotA | 1.74e-09 | NA | 1.36e-15 | NA |
7. B | P91660 | Probable multidrug resistance-associated protein lethal(2)03659 | 8.88e-16 | NA | 3.10e-27 | NA |
7. B | Q8GZ52 | ABC transporter G family member 30 | 7.83e-04 | NA | 7.15e-04 | NA |
7. B | A0B297 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 1.22e-02 | NA | 8.26e-04 | NA |
7. B | Q8G838 | Putative ABC transporter ATP-binding protein BL0043 | 8.71e-04 | NA | 6.78e-13 | NA |
7. B | Q55GB1 | ABC transporter G family member 15 | 8.70e-03 | NA | 6.39e-04 | NA |
7. B | Q57BC2 | Thiamine import ATP-binding protein ThiQ | 1.20e-10 | NA | 5.83e-07 | NA |
7. B | Q3K8M7 | Arabinose import ATP-binding protein AraG | 1.07e-03 | NA | 1.16e-06 | NA |
7. B | Q7VZ66 | Phosphate import ATP-binding protein PstB | 3.74e-12 | NA | 3.59e-16 | NA |
7. B | Q830W6 | Spermidine/putrescine import ATP-binding protein PotA | 2.32e-09 | NA | 1.64e-16 | NA |
7. B | Q02DK6 | Methionine import ATP-binding protein MetN 2 | 2.97e-12 | NA | 1.25e-13 | NA |
7. B | Q8E281 | Ribose import ATP-binding protein RbsA | 9.91e-04 | NA | 0.001 | NA |
7. B | Q63H61 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 6.51e-09 | NA | 5.14e-10 | NA |
7. B | P96117 | Zinc transport system ATP-binding protein TroB | 2.18e-09 | NA | 2.62e-07 | NA |
7. B | P0CZ42 | Probable ABC transporter ATP-binding protein SpyM3_0208 | 2.65e-09 | NA | 4.08e-06 | NA |
7. B | P47546 | Putative ABC transporter ATP-binding protein MG304 | 2.22e-09 | NA | 1.63e-13 | NA |
7. B | Q578E9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.83e-11 | NA | 5.58e-12 | NA |
7. B | Q0TPX5 | Ribose import ATP-binding protein RbsA | 6.36e-04 | NA | 7.05e-09 | NA |
7. B | P19844 | Probable ABC transporter ATP-binding protein NosF | 1.43e-07 | NA | 4.49e-05 | NA |
7. B | Q825P1 | Ribose import ATP-binding protein RbsA 2 | 9.46e-04 | NA | 0.007 | NA |
7. B | Q67SV5 | Methionine import ATP-binding protein MetN | 1.28e-11 | NA | 2.55e-16 | NA |
7. B | Q8FYU9 | Thiamine import ATP-binding protein ThiQ | 1.48e-10 | NA | 3.11e-07 | NA |
7. B | Q97N50 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.65e-09 | NA | 2.98e-11 | NA |
7. B | Q65M64 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.10e-07 | NA | 5.05e-09 | NA |
7. B | Q7A088 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.27e-08 | NA | 1.40e-16 | NA |
7. B | Q8DGZ3 | Phosphate import ATP-binding protein PstB | 3.00e-11 | NA | 3.02e-14 | NA |
7. B | Q92G36 | Zinc import ATP-binding protein ZnuC | 4.35e-09 | NA | 2.87e-13 | NA |
7. B | Q00752 | Multiple sugar-binding transport ATP-binding protein MsmK | 3.53e-11 | NA | 7.19e-10 | NA |
7. B | Q8T689 | ABC transporter G family member 4 | 4.36e-05 | NA | 2.24e-09 | NA |
7. B | P77257 | Autoinducer 2 import ATP-binding protein LsrA | 6.79e-04 | NA | 3.60e-06 | NA |
7. B | Q92887 | ATP-binding cassette sub-family C member 2 | 2.22e-15 | NA | 5.81e-26 | NA |
7. B | Q3J8J2 | Phosphate import ATP-binding protein PstB 2 | 3.17e-07 | NA | 2.47e-15 | NA |
7. B | Q1JII9 | Methionine import ATP-binding protein MetN | 1.19e-10 | NA | 2.49e-15 | NA |
7. B | Q6LX68 | Energy-coupling factor transporter ATP-binding protein EcfA | 6.74e-09 | NA | 4.87e-11 | NA |
7. B | P44662 | Probable iron transport system ATP-binding protein HI_0361 | 7.57e-09 | NA | 6.70e-06 | NA |
7. B | Q83F44 | Methionine import ATP-binding protein MetN | 5.14e-11 | NA | 3.58e-13 | NA |
7. B | Q89LP2 | Methionine import ATP-binding protein MetN | 3.74e-11 | NA | 9.23e-14 | NA |
7. B | Q1J8E4 | Methionine import ATP-binding protein MetN | 9.77e-11 | NA | 1.29e-14 | NA |
7. B | Q67RG2 | Phosphate import ATP-binding protein PstB 1 | 1.12e-12 | NA | 2.02e-11 | NA |
7. B | Q9PPV2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 6.40e-04 | NA | 1.04e-04 | NA |
7. B | Q0SWH9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 4.79e-09 | NA | 2.54e-08 | NA |
7. B | Q3JYF4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.70e-09 | NA | 2.30e-10 | NA |
7. B | Q73EL7 | Methionine import ATP-binding protein MetN 2 | 1.90e-11 | NA | 2.66e-17 | NA |
7. B | O31427 | SkfA peptide export ATP-binding protein SkfE | 1.16e-07 | NA | 4.14e-06 | NA |
7. B | Q2NU23 | Lipoprotein-releasing system ATP-binding protein LolD | 2.79e-10 | NA | 3.25e-08 | NA |
7. B | P9WQK4 | Uncharacterized ABC transporter ATP-binding protein MT0079 | 6.75e-09 | NA | 1.17e-06 | NA |
7. B | Q5H0W2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.24e-08 | NA | 0.005 | NA |
7. B | A7FMJ7 | Autoinducer 2 import ATP-binding protein LsrA | 2.76e-03 | NA | 1.10e-04 | NA |
7. B | Q1LKJ2 | Nod factor export ATP-binding protein I | 3.27e-08 | NA | 2.28e-11 | NA |
7. B | Q8FW07 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.24e-11 | NA | 5.58e-12 | NA |
7. B | Q5PMK1 | Spermidine/putrescine import ATP-binding protein PotA | 2.42e-09 | NA | 9.74e-15 | NA |
7. B | Q5E6M2 | Zinc import ATP-binding protein ZnuC 1 | 3.19e-10 | NA | 6.67e-09 | NA |
7. B | Q578M5 | Putative ATP-binding protein BruAb2_0487 | 6.37e-11 | NA | 1.14e-08 | NA |
7. B | Q1M7A6 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.04e-07 | NA | 4.19e-07 | NA |
7. B | O95255 | ATP-binding cassette sub-family C member 6 | 0.00e+00 | NA | 3.79e-22 | NA |
7. B | Q48FT0 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.12e-07 | NA | 6.99e-05 | NA |
7. B | Q1J982 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.88e-09 | NA | 5.01e-12 | NA |
7. B | Q5HVF4 | Phosphate import ATP-binding protein PstB | 1.46e-13 | NA | 6.33e-18 | NA |
7. B | Q7NNW9 | Putative ABC transporter ATP-binding protein gll0289 | 1.25e-10 | NA | 1.25e-06 | NA |
7. B | Q2GE91 | Lipoprotein-releasing system ATP-binding protein LolD | 7.58e-10 | NA | 1.85e-06 | NA |
7. B | Q7MFC4 | Maltose/maltodextrin import ATP-binding protein MalK | 2.22e-11 | NA | 6.67e-12 | NA |
7. B | Q9C7F8 | ABC transporter B family member 13 | 0.00e+00 | NA | 1.01e-59 | NA |
7. B | Q7VR29 | Lipoprotein-releasing system ATP-binding protein LolD | 6.03e-11 | NA | 4.34e-08 | NA |
7. B | Q48PU6 | Methionine import ATP-binding protein MetN 1 | 1.82e-11 | NA | 4.71e-15 | NA |
7. B | Q92AF9 | Manganese transport system ATP-binding protein MntB | 8.31e-09 | NA | 1.75e-06 | NA |
7. B | Q7PC86 | ABC transporter G family member 35 | 1.17e-03 | NA | 0.002 | NA |
7. B | Q0S736 | Phosphate import ATP-binding protein PstB | 7.56e-12 | NA | 0.004 | NA |
7. B | Q8Z7H7 | Spermidine/putrescine import ATP-binding protein PotA | 1.89e-09 | NA | 7.98e-15 | NA |
7. B | Q0RAT5 | Spermidine/putrescine import ATP-binding protein PotA | 2.81e-06 | NA | 3.56e-08 | NA |
7. B | Q0SML1 | Spermidine/putrescine import ATP-binding protein PotA | 8.88e-10 | NA | 1.81e-12 | NA |
7. B | P9WQI5 | Uncharacterized ABC transporter ATP-binding protein Rv2564 | 1.21e-08 | NA | 7.74e-05 | NA |
7. B | Q0TBN5 | Xylose import ATP-binding protein XylG | 5.94e-04 | NA | 0.002 | NA |
7. B | E9PU17 | ATP-binding cassette sub-family A member 17 | 1.39e-03 | NA | 4.28e-08 | NA |
7. B | Q8ZJD0 | Taurine import ATP-binding protein TauB | 5.74e-08 | NA | 1.98e-06 | NA |
7. B | Q56927 | Fe(3+) ions import ATP-binding protein FbpC | 2.41e-09 | NA | 8.67e-14 | NA |
7. B | Q55DA0 | ABC transporter G family member 22 | 1.15e-02 | NA | 3.40e-06 | NA |
7. B | O80725 | ABC transporter B family member 4 | 0.00e+00 | NA | 3.93e-56 | NA |
7. B | Q65S66 | Fe(3+) ions import ATP-binding protein FbpC | 8.50e-10 | NA | 7.38e-15 | NA |
7. B | Q13RD3 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.07e-06 | NA | 1.43e-05 | NA |
7. B | Q8U6M1 | Fe(3+) ions import ATP-binding protein FbpC | 3.98e-09 | NA | 2.15e-15 | NA |
7. B | Q2FW35 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.40e-08 | NA | 1.40e-16 | NA |
7. B | P78363 | Retinal-specific phospholipid-transporting ATPase ABCA4 | 3.53e-03 | NA | 1.35e-05 | NA |
7. B | O88269 | ATP-binding cassette sub-family C member 6 | 1.33e-15 | NA | 4.70e-24 | NA |
7. B | Q24QI5 | Methionine import ATP-binding protein MetN | 7.94e-11 | NA | 1.04e-16 | NA |
7. B | Q045Z8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.31e-08 | NA | 1.26e-10 | NA |
7. B | Q8G7F4 | Phosphate import ATP-binding protein PstB | 6.09e-12 | NA | 1.07e-14 | NA |
7. B | Q97X60 | Putative ABC transporter ATP-binding protein SSO1893 | 5.47e-04 | NA | 0.002 | NA |
7. B | O70127 | Bile salt export pump | 1.50e-12 | NA | 2.22e-50 | NA |
7. B | Q0VQQ0 | Lipoprotein-releasing system ATP-binding protein LolD | 4.04e-10 | NA | 1.85e-07 | NA |
7. B | Q8LPJ4 | ABC transporter E family member 2 | 4.44e-03 | NA | 0.004 | NA |
7. B | E0SCY1 | Glycine betaine/choline transport system ATP-binding protein OusV | 1.14e-10 | NA | 3.52e-17 | NA |
7. B | O34510 | Fe(3+)-citrate import ATP-binding protein YfmF | 1.72e-10 | NA | 1.73e-13 | NA |
7. B | Q5YYR7 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 7.98e-08 | NA | 2.51e-07 | NA |
7. B | Q8FVM9 | Nickel import ATP-binding protein NikD | 2.12e-10 | NA | 6.85e-07 | NA |
7. B | P63374 | Phosphate import ATP-binding protein PstB 1 | 4.75e-12 | NA | 4.02e-11 | NA |
7. B | Q81VM2 | Methionine import ATP-binding protein MetN 1 | 3.80e-11 | NA | 1.80e-13 | NA |
7. B | Q1CCR9 | Taurine import ATP-binding protein TauB | 4.64e-08 | NA | 1.98e-06 | NA |
7. B | Q8P4S7 | Methionine import ATP-binding protein MetN | 1.56e-11 | NA | 2.72e-17 | NA |
7. B | Q1LJ08 | Phosphonates import ATP-binding protein PhnC 2 | 1.29e-10 | NA | 5.64e-07 | NA |
7. B | Q56953 | Chelated iron transport system membrane protein YfeB | 2.47e-09 | NA | 6.28e-06 | NA |
7. B | Q62M41 | Methionine import ATP-binding protein MetN 1 | 2.00e-08 | NA | 3.34e-13 | NA |
7. B | Q63QQ7 | Arabinose import ATP-binding protein AraG | 1.10e-03 | NA | 7.99e-05 | NA |
7. B | Q3BNZ3 | Methionine import ATP-binding protein MetN | 1.54e-11 | NA | 2.06e-16 | NA |
7. B | Q46YX6 | Nod factor export ATP-binding protein I | 7.89e-07 | NA | 4.80e-07 | NA |
7. B | Q83J77 | Nickel import ATP-binding protein NikE | 7.19e-11 | NA | 6.42e-11 | NA |
7. B | Q6GHY6 | Spermidine/putrescine import ATP-binding protein PotA | 2.47e-09 | NA | 2.87e-13 | NA |
7. B | Q6HBS0 | Methionine import ATP-binding protein MetN 2 | 1.77e-11 | NA | 2.80e-16 | NA |
7. B | Q1I966 | Macrolide export ATP-binding/permease protein MacB 1 | 4.68e-02 | NA | 1.84e-10 | NA |
7. B | Q576H3 | Xylose import ATP-binding protein XylG | 7.61e-04 | NA | 0.016 | NA |
7. B | Q8D3S8 | Hemin import ATP-binding protein HmuV | 2.88e-09 | NA | 1.23e-04 | NA |
7. B | Q8T6J1 | ABC transporter A family member 6 | 4.71e-04 | NA | 1.39e-05 | NA |
7. B | Q823C4 | Methionine import ATP-binding protein MetN | 2.33e-11 | NA | 4.30e-11 | NA |
7. B | Q97WT4 | Putative ABC transporter ATP-binding protein SSO2030 | 2.04e-04 | NA | 5.34e-05 | NA |
7. B | Q7U172 | Phosphate import ATP-binding protein PstB 1 | 6.68e-12 | NA | 1.50e-04 | NA |
7. B | Q8FUN3 | Putative ATP-binding protein BRA1187/BS1330_II1178 | 1.09e-08 | NA | 1.17e-05 | NA |
7. B | Q97KZ3 | Putative ABC transporter ATP-binding protein CA_C0773 | 3.10e-12 | NA | 3.05e-13 | NA |
7. B | Q0BMC9 | Methionine import ATP-binding protein MetN | 5.43e-11 | NA | 1.27e-16 | NA |
7. B | Q0BIZ6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.09e-10 | NA | 1.27e-09 | NA |
7. B | Q0S0X2 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 5.65e-07 | NA | 1.77e-08 | NA |
7. B | Q9PR42 | UvrABC system protein A | 4.08e-02 | NA | 0.002 | NA |
7. B | Q39HM4 | Phosphate import ATP-binding protein PstB | 5.84e-12 | NA | 1.68e-16 | NA |
7. B | Q5XBY6 | Phosphate import ATP-binding protein PstB 2 | 4.58e-12 | NA | 5.44e-18 | NA |
7. B | Q0A8P9 | Lipoprotein-releasing system ATP-binding protein LolD | 6.76e-11 | NA | 1.99e-11 | NA |
7. B | P0AAF4 | Arabinose import ATP-binding protein AraG | 7.59e-04 | NA | 6.50e-05 | NA |
7. B | Q7NTU0 | Lipoprotein-releasing system ATP-binding protein LolD | 1.05e-10 | NA | 3.41e-06 | NA |
7. B | Q65UE1 | Spermidine/putrescine import ATP-binding protein PotA | 1.15e-08 | NA | 2.26e-17 | NA |
7. B | Q9U2G5 | Multidrug resistance protein mrp-7 | 6.63e-13 | NA | 6.71e-26 | NA |
7. B | Q556W2 | ABC transporter G family member 17 | 7.77e-03 | NA | 4.43e-04 | NA |
7. B | A2RI01 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.27e-10 | NA | 8.37e-11 | NA |
7. B | Q12BC9 | Phosphonates import ATP-binding protein PhnC | 5.76e-10 | NA | 0.036 | NA |
7. B | Q5LBT4 | Spermidine/putrescine import ATP-binding protein PotA | 4.58e-08 | NA | 2.40e-11 | NA |
7. B | Q5HDY6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.64e-11 | NA | 1.13e-16 | NA |
7. B | Q56993 | Hemin import ATP-binding protein HmuV | 2.37e-09 | NA | 9.24e-06 | NA |
7. B | Q5FFC0 | Lipoprotein-releasing system ATP-binding protein LolD | 5.09e-10 | NA | 1.97e-08 | NA |
7. B | Q6F813 | Macrolide export ATP-binding/permease protein MacB | 2.44e-02 | NA | 2.32e-11 | NA |
7. B | Q881Q1 | Macrolide export ATP-binding/permease protein MacB 2 | 5.89e-02 | NA | 1.99e-09 | NA |
7. B | Q734T1 | Putative ABC transporter ATP-binding protein BCE_3323 | 2.02e-04 | NA | 1.52e-08 | NA |
7. B | P47288 | Spermidine/putrescine import ATP-binding protein PotA | 3.47e-04 | NA | 1.62e-06 | NA |
7. B | A1BC20 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.20e-06 | NA | 2.14e-05 | NA |
7. B | Q87PH3 | Spermidine/putrescine import ATP-binding protein PotA | 7.81e-07 | NA | 2.39e-17 | NA |
7. B | Q04HV7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.49e-09 | NA | 2.98e-11 | NA |
7. B | Q5ZZZ7 | Spermidine/putrescine import ATP-binding protein PotA | 5.87e-04 | NA | 4.05e-05 | NA |
7. B | Q0KDG3 | Methionine import ATP-binding protein MetN | 2.98e-08 | NA | 6.51e-12 | NA |
7. B | Q98KI3 | Molybdenum import ATP-binding protein ModC | 1.95e-07 | NA | 2.76e-11 | NA |
7. B | Q73L25 | Lipoprotein-releasing system ATP-binding protein LolD | 1.26e-10 | NA | 1.21e-06 | NA |
7. B | Q66FU4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.76e-10 | NA | 1.14e-09 | NA |
7. B | Q09466 | ABC transporter ATP-binding protein/permease wht-3 | 1.10e-02 | NA | 0.008 | NA |
7. B | Q32K28 | Thiamine import ATP-binding protein ThiQ | 1.65e-11 | NA | 3.07e-10 | NA |
7. B | Q71WT2 | Phosphate import ATP-binding protein PstB 2 | 1.07e-12 | NA | 2.70e-15 | NA |
7. B | A0A1U9YI12 | ABC-type transmembrane transporter verA | 0.00e+00 | NA | 1.51e-46 | NA |
7. B | Q57S53 | Methionine import ATP-binding protein MetN 2 | 5.90e-11 | NA | 3.43e-12 | NA |
7. B | Q8Z5N5 | Cobalt import ATP-binding protein CbiO | 1.25e-08 | NA | 0.005 | NA |
7. B | Q8T6J0 | ABC transporter A family member 7 | 3.12e-07 | NA | 1.82e-07 | NA |
7. B | Q89WG0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.57e-11 | NA | 1.97e-06 | NA |
7. B | Q1C138 | Autoinducer 2 import ATP-binding protein LsrA | 2.84e-03 | NA | 7.59e-05 | NA |
7. B | Q7A5Q9 | Nickel import system ATP-binding protein NikE | 1.16e-11 | NA | 9.61e-14 | NA |
7. B | Q9CM47 | Macrolide export ATP-binding/permease protein MacB | 6.37e-02 | NA | 5.25e-11 | NA |
7. B | Q9M3D6 | ABC transporter G family member 19 | 4.38e-02 | NA | 8.39e-04 | NA |
7. B | Q3JSR6 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.44e-06 | NA | 5.55e-10 | NA |
7. B | Q5WUF8 | Lipoprotein-releasing system ATP-binding protein LolD | 5.40e-11 | NA | 1.34e-08 | NA |
7. B | Q1ARR5 | Ribose import ATP-binding protein RbsA 3 | 1.74e-03 | NA | 5.80e-05 | NA |
7. B | Q6GH28 | Nickel import system ATP-binding protein NikE | 9.51e-12 | NA | 8.62e-15 | NA |
7. B | Q6LQC0 | Hemin import ATP-binding protein HmuV | 5.85e-09 | NA | 4.59e-05 | NA |
7. B | P21447 | ATP-dependent translocase ABCB1 | 2.26e-12 | NA | 1.07e-57 | NA |
7. B | Q81GU1 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.96e-10 | NA | 2.86e-12 | NA |
7. B | Q6LSC4 | Phosphate import ATP-binding protein PstB 2 | 2.81e-12 | NA | 7.89e-14 | NA |
7. B | Q8YNJ3 | Phosphate import ATP-binding protein PstB 3 | 1.87e-12 | NA | 9.23e-14 | NA |
7. B | Q32AQ2 | Nickel import ATP-binding protein NikD | 1.32e-11 | NA | 5.22e-06 | NA |
7. B | P63400 | Uncharacterized ABC transporter ATP-binding protein Mb2353c | 9.24e-05 | NA | 1.29e-04 | NA |
7. B | Q2PBM0 | Autoinducer 2 import ATP-binding protein LsrA | 6.33e-04 | NA | 0.002 | NA |
7. B | Q88YK8 | Phosphate import ATP-binding protein PstB 1 | 2.15e-12 | NA | 1.85e-17 | NA |
7. B | Q8FJ95 | Aliphatic sulfonates import ATP-binding protein SsuB | 4.06e-08 | NA | 3.43e-12 | NA |
7. B | Q55740 | Putative ABC transporter ATP-binding protein sll0385 | 2.06e-09 | NA | 3.48e-06 | NA |
7. B | Q8TUR7 | Phosphate import ATP-binding protein PstB | 2.61e-12 | NA | 6.31e-10 | NA |
7. B | P37494 | Uncharacterized ABC transporter ATP-binding protein YybJ | 1.05e-10 | NA | 7.46e-10 | NA |
7. B | Q8E8K8 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 6.21e-10 | NA | 6.17e-10 | NA |
7. B | Q1GAD3 | Phosphate import ATP-binding protein PstB | 3.66e-13 | NA | 2.22e-15 | NA |
7. B | Q07UI9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.79e-11 | NA | 2.12e-10 | NA |
7. B | Q81J16 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 5.13e-09 | NA | 9.96e-19 | NA |
7. B | Q8NXH5 | Methionine import ATP-binding protein MetN 2 | 2.91e-11 | NA | 2.86e-13 | NA |
7. B | F2SG60 | ABC multidrug transporter MDR3 | 7.88e-03 | NA | 0.001 | NA |
7. B | Q7A471 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.28e-08 | NA | 1.40e-16 | NA |
7. B | Q4ZYK8 | Phosphonates import ATP-binding protein PhnC 1 | 1.47e-11 | NA | 7.44e-06 | NA |
7. B | Q8PK53 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.56e-08 | NA | 0.004 | NA |
7. B | P49938 | Iron(3+)-hydroxamate import ATP-binding protein FhuC | 1.35e-10 | NA | 2.55e-09 | NA |
7. B | Q9CM08 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.49e-03 | NA | 2.79e-08 | NA |
7. B | P0A9R7 | Cell division ATP-binding protein FtsE | 1.26e-10 | NA | 2.11e-11 | NA |
7. B | Q5H503 | Methionine import ATP-binding protein MetN | 1.64e-11 | NA | 9.05e-17 | NA |
7. B | P47311 | Putative ABC transporter ATP-binding protein MG065 | 4.77e-08 | NA | 2.07e-06 | NA |
7. B | P94420 | Petrobactin import ATP-binding protein YclP | 3.26e-11 | NA | 9.91e-08 | NA |
7. B | Q8T6B7 | ABC transporter F family member 2 | 2.48e-05 | NA | 6.62e-09 | NA |
7. B | Q8Y8T6 | Spermidine/putrescine import ATP-binding protein PotA | 3.30e-09 | NA | 6.88e-15 | NA |
7. B | Q8YUI9 | Phosphonates import ATP-binding protein PhnC 2 | 3.00e-10 | NA | 1.54e-09 | NA |
7. B | Q5NFU5 | Methionine import ATP-binding protein MetN | 5.09e-11 | NA | 3.76e-16 | NA |
7. B | Q3Z542 | Taurine import ATP-binding protein TauB | 4.63e-08 | NA | 7.44e-09 | NA |
7. B | Q9LSJ6 | ABC transporter B family member 17 | 0.00e+00 | NA | 2.08e-60 | NA |
7. B | Q42093 | ABC transporter C family member 2 | 1.78e-15 | NA | 1.29e-20 | NA |
7. B | Q9YG51 | Phosphate import ATP-binding protein PstB | 2.08e-12 | NA | 6.60e-12 | NA |
7. B | O95342 | Bile salt export pump | 2.79e-12 | NA | 6.64e-53 | NA |
7. B | D5AQY6 | Nickel import ATP-binding protein NikO | 1.61e-11 | NA | 2.65e-14 | NA |
7. B | Q9ZCC4 | Zinc import ATP-binding protein ZnuC | 9.23e-09 | NA | 6.95e-12 | NA |
7. B | A5U7B7 | Cell division ATP-binding protein FtsE | 4.51e-11 | NA | 4.64e-13 | NA |
7. B | Q8DMY0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.81e-10 | NA | 4.79e-11 | NA |
7. B | Q8EIL8 | Macrolide export ATP-binding/permease protein MacB | 2.97e-02 | NA | 7.68e-11 | NA |
7. B | Q4UQD2 | Methionine import ATP-binding protein MetN | 1.65e-11 | NA | 2.72e-17 | NA |
7. B | Q98HF7 | Spermidine/putrescine import ATP-binding protein PotA | 3.29e-09 | NA | 4.73e-14 | NA |
7. B | Q5FHB0 | Zinc import ATP-binding protein ZnuC | 6.49e-09 | NA | 0.004 | NA |
7. B | Q55462 | Bicarbonate transport ATP-binding protein CmpC | 8.81e-06 | NA | 3.06e-07 | NA |
7. B | P80866 | Vegetative protein 296 | 8.63e-09 | NA | 7.44e-04 | NA |
7. B | Q8LEF6 | ABC transporter I family member 11, chloroplastic | 2.02e-09 | NA | 2.57e-05 | NA |
7. B | Q0T4L9 | Autoinducer 2 import ATP-binding protein LsrA | 2.18e-03 | NA | 1.06e-05 | NA |
7. B | Q46RX0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 9.69e-10 | NA | 1.41e-04 | NA |
7. B | Q73XU8 | Sulfate/thiosulfate import ATP-binding protein CysA | 8.81e-09 | NA | 4.64e-10 | NA |
7. B | Q1JLT7 | Spermidine/putrescine import ATP-binding protein PotA | 2.37e-09 | NA | 6.49e-16 | NA |
7. B | Q9CM80 | Fe(3+) ions import ATP-binding protein FbpC | 4.33e-10 | NA | 2.17e-14 | NA |
7. B | P36879 | Uncharacterized ABC transporter ATP-binding protein YadG | 1.64e-11 | NA | 1.07e-09 | NA |
7. B | Q92DL6 | Spermidine/putrescine import ATP-binding protein PotA | 1.78e-09 | NA | 2.55e-14 | NA |
7. B | Q2NHA1 | Energy-coupling factor transporter ATP-binding protein EcfA | 3.54e-10 | NA | 4.95e-12 | NA |
7. B | Q7VV72 | Methionine import ATP-binding protein MetN | 3.74e-11 | NA | 8.04e-15 | NA |
7. B | Q53193 | Probable peptide ABC transporter ATP-binding protein y4tR | 1.19e-09 | NA | 3.44e-04 | NA |
7. B | Q6YW62 | ABC transporter G family member 44 | 1.64e-03 | NA | 5.42e-04 | NA |
7. B | Q88R93 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.18e-07 | NA | 5.03e-11 | NA |
7. B | P0AAG0 | Dipeptide transport ATP-binding protein DppD | 1.50e-09 | NA | 0.011 | NA |
7. B | Q8GDV4 | Phosphate import ATP-binding protein PstB (Fragment) | 4.65e-13 | NA | 2.43e-14 | NA |
7. B | Q8FCN0 | Nickel import ATP-binding protein NikD | 9.16e-12 | NA | 1.05e-05 | NA |
7. B | Q8PVG9 | Putative ABC transporter ATP-binding protein MM_1996 | 4.01e-05 | NA | 3.16e-06 | NA |
7. B | Q7PC82 | ABC transporter G family member 42 | 1.13e-03 | NA | 3.15e-05 | NA |
7. B | Q8YDH1 | Putative peptide import ATP-binding protein BMEII0205 | 6.24e-10 | NA | 4.76e-14 | NA |
7. B | P75516 | Putative carbohydrate transport ATP-binding protein MPN_258 | 2.81e-04 | NA | 2.65e-08 | NA |
7. B | P30193 | Uncharacterized protein in epiA 5'region (Fragment) | 1.15e-14 | NA | 5.84e-06 | NA |
7. B | Q7NB11 | Spermidine/putrescine import ATP-binding protein PotA | 9.90e-04 | NA | 1.32e-04 | NA |
7. B | Q91V24 | ATP-binding cassette sub-family A member 7 | 4.30e-03 | NA | 1.31e-04 | NA |
7. B | P54537 | Arginine transport ATP-binding protein ArtM | 8.00e-14 | NA | 4.22e-16 | NA |
7. B | Q55196 | Phosphate import ATP-binding protein PstB 1 | 3.95e-13 | NA | 3.47e-15 | NA |
7. B | Q3MA91 | Phosphate import ATP-binding protein PstB 3 | 1.30e-12 | NA | 2.07e-14 | NA |
7. B | Q04BY7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.52e-09 | NA | 4.82e-14 | NA |
7. B | P38735 | ABC transporter ATP-binding protein/permease VMR1 | 7.75e-12 | NA | 1.67e-19 | NA |
7. B | Q9HWG0 | UvrABC system protein A | 5.43e-02 | NA | 0.006 | NA |
7. B | Q7MG07 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.16e-03 | NA | 0.039 | NA |
7. B | A0L0V9 | Macrolide export ATP-binding/permease protein MacB | 2.78e-02 | NA | 5.77e-11 | NA |
7. B | Q9DBM0 | ATP-binding cassette sub-family G member 8 | 1.93e-02 | NA | 1.42e-05 | NA |
7. B | P96605 | Uncharacterized ABC transporter ATP-binding protein YdbJ | 1.58e-07 | NA | 2.02e-06 | NA |
7. B | Q8FVT0 | Putative ATP-binding protein BRA0745/BS1330_II0738 | 7.00e-11 | NA | 1.13e-08 | NA |
7. B | A0A348AXX9 | ABC-type transporter TR06 | 0.00e+00 | NA | 1.68e-46 | NA |
7. B | P53978 | Elongation factor 3B | 7.03e-04 | NA | 9.49e-07 | NA |
7. B | Q9BZC7 | ATP-binding cassette sub-family A member 2 | 6.97e-03 | NA | 2.40e-04 | NA |
7. B | P55476 | Nod factor export ATP-binding protein I | 1.80e-06 | NA | 2.44e-08 | NA |
7. B | Q2JKC2 | Phosphate import ATP-binding protein PstB 2 | 1.01e-11 | NA | 2.25e-13 | NA |
7. B | P77737 | Oligopeptide transport ATP-binding protein OppF | 3.45e-10 | NA | 2.07e-12 | NA |
7. B | Q63FX9 | Ribose import ATP-binding protein RbsA | 8.10e-04 | NA | 2.02e-07 | NA |
7. B | Q7CMM7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.42e-09 | NA | 7.60e-12 | NA |
7. B | Q2P7S3 | Methionine import ATP-binding protein MetN | 1.69e-11 | NA | 1.13e-16 | NA |
7. B | Q6KHL1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.96e-11 | NA | 2.13e-19 | NA |
7. B | P45769 | Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ | 5.72e-13 | NA | 2.24e-12 | NA |
7. B | P43672 | ATP-binding protein Uup | 2.24e-04 | NA | 2.25e-07 | NA |
7. B | Q9M1H3 | ABC transporter F family member 4 | 4.87e-05 | NA | 9.40e-07 | NA |
7. B | Q4AA74 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.31e-08 | NA | 2.42e-05 | NA |
7. B | Q7PC80 | ABC transporter G family member 34 | 1.31e-03 | NA | 0.002 | NA |
7. B | Q9LHD1 | ABC transporter B family member 15 | 0.00e+00 | NA | 5.50e-56 | NA |
7. B | Q30W28 | Phosphonates import ATP-binding protein PhnC | 2.41e-10 | NA | 2.33e-05 | NA |
7. B | Q7AH43 | Fe(3+) ions import ATP-binding protein FbpC | 3.03e-11 | NA | 9.74e-13 | NA |
7. B | Q2S3A3 | Lipoprotein-releasing system ATP-binding protein LolD | 2.06e-09 | NA | 1.14e-09 | NA |
7. B | Q08201 | Phosphatidylcholine translocator ABCB4 | 0.00e+00 | NA | 1.29e-57 | NA |
7. B | Q5FM62 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.47e-08 | NA | 9.89e-07 | NA |
7. B | Q6D4E2 | Spermidine/putrescine import ATP-binding protein PotA | 1.43e-07 | NA | 2.89e-16 | NA |
7. B | Q52666 | Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD | 5.60e-09 | NA | 6.11e-13 | NA |
7. B | Q8ZPK4 | Osmoprotectant import ATP-binding protein OsmV | 7.86e-11 | NA | 1.91e-12 | NA |
7. B | Q2NIT5 | Energy-coupling factor transporter ATP-binding protein EcfA | 2.51e-10 | NA | 4.67e-17 | NA |
7. B | O28882 | Probable branched-chain amino acid transport ATP-binding protein LivF | 7.33e-10 | NA | 8.17e-06 | NA |
7. B | P63358 | Probable ribonucleotide transport ATP-binding protein mkl | 3.06e-10 | NA | 0.003 | NA |
7. B | Q39GW5 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 4.82e-06 | NA | 3.71e-09 | NA |
7. B | Q1QE80 | Spermidine/putrescine import ATP-binding protein PotA | 1.51e-08 | NA | 2.78e-11 | NA |
7. B | Q48PN3 | Methionine import ATP-binding protein MetN 2 | 4.57e-08 | NA | 6.22e-18 | NA |
7. B | Q8GU92 | ABC transporter G family member 35 | 9.62e-04 | NA | 9.14e-05 | NA |
7. B | Q9H221 | ATP-binding cassette sub-family G member 8 | 2.24e-02 | NA | 1.44e-04 | NA |
7. B | Q7VP69 | Thiamine import ATP-binding protein ThiQ | 8.27e-11 | NA | 2.69e-13 | NA |
7. B | Q8RWI9 | ABC transporter G family member 15 | 1.45e-02 | NA | 3.06e-07 | NA |
7. B | Q14Q07 | Spermidine/putrescine import ATP-binding protein PotA | 1.52e-09 | NA | 7.95e-18 | NA |
7. B | Q8WWZ4 | ATP-binding cassette sub-family A member 10 | 1.25e-03 | NA | 5.16e-05 | NA |
7. B | Q2SE49 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.10e-08 | NA | 0.003 | NA |
7. B | Q2YX74 | Spermidine/putrescine import ATP-binding protein PotA | 2.40e-09 | NA | 2.87e-13 | NA |
7. B | Q04BG2 | Spermidine/putrescine import ATP-binding protein PotA | 5.22e-10 | NA | 4.48e-14 | NA |
7. B | Q2T751 | Taurine import ATP-binding protein TauB | 1.01e-07 | NA | 1.39e-05 | NA |
7. B | Q5PID0 | Methionine import ATP-binding protein MetN 1 | 2.00e-11 | NA | 3.08e-14 | NA |
7. B | Q01937 | Lactose transport ATP-binding protein LacK | 1.06e-10 | NA | 3.71e-09 | NA |
7. B | Q3IX40 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.97e-10 | NA | 7.09e-09 | NA |
7. B | Q9QY30 | Bile salt export pump | 0.00e+00 | NA | 2.79e-51 | NA |
7. B | Q60350 | Uncharacterized ABC transporter ATP-binding protein MJ0035 | 1.96e-09 | NA | 5.89e-10 | NA |
7. B | Q890R3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 4.83e-09 | NA | 6.71e-09 | NA |
7. B | Q1R9S4 | Galactose/methyl galactoside import ATP-binding protein MglA | 8.59e-04 | NA | 1.72e-05 | NA |
7. B | Q1R0Z6 | Phosphonates import ATP-binding protein PhnC | 1.76e-10 | NA | 4.55e-06 | NA |
7. B | Q9CEW8 | Phosphate import ATP-binding protein PstB 1 | 6.33e-12 | NA | 1.74e-13 | NA |
7. B | P0A2V8 | Phosphate import ATP-binding protein PstB 3 | 1.52e-13 | NA | 1.57e-14 | NA |
7. B | Q99UA2 | Nickel import system ATP-binding protein NikD | 8.30e-10 | NA | 6.43e-10 | NA |
7. B | Q0BV49 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.11e-07 | NA | 7.17e-07 | NA |
7. B | Q7A1Z1 | Phosphonates import ATP-binding protein PhnC | 5.37e-11 | NA | 5.18e-12 | NA |
7. B | Q9LYS2 | ABC transporter C family member 10 | 1.89e-15 | NA | 1.49e-21 | NA |
7. B | Q7W4E1 | Methionine import ATP-binding protein MetN | 3.55e-11 | NA | 8.04e-15 | NA |
7. B | Q6F0V4 | Spermidine/putrescine import ATP-binding protein PotA | 6.54e-11 | NA | 4.19e-12 | NA |
7. B | Q4K9A4 | Macrolide export ATP-binding/permease protein MacB 2 | 1.49e-05 | NA | 6.98e-15 | NA |
7. B | Q8LPT1 | ABC transporter B family member 6 | 0.00e+00 | NA | 3.14e-46 | NA |
7. B | P45171 | Spermidine/putrescine import ATP-binding protein PotA | 7.53e-09 | NA | 7.34e-17 | NA |
7. B | P47365 | Putative carbohydrate transport ATP-binding protein MG119 | 5.31e-04 | NA | 2.00e-08 | NA |
7. B | P9WQJ9 | Mycobactin import ATP-binding/permease protein IrtA | 1.11e-16 | NA | 5.05e-39 | NA |
7. B | Q0BTP1 | Phosphate import ATP-binding protein PstB | 2.96e-09 | NA | 1.20e-14 | NA |
7. B | Q1LQB5 | Phosphonates import ATP-binding protein PhnC 1 | 7.64e-10 | NA | 5.99e-06 | NA |
7. B | P14772 | Bile pigment transporter 1 | 6.66e-16 | NA | 8.79e-23 | NA |
7. B | Q63TW1 | Aliphatic sulfonates import ATP-binding protein SsuB | 6.81e-06 | NA | 4.41e-10 | NA |
7. B | Q1Q8K4 | Phosphate import ATP-binding protein PstB | 2.58e-11 | NA | 2.03e-17 | NA |
7. B | Q7M8U0 | Macrolide export ATP-binding/permease protein MacB | 2.22e-06 | NA | 3.19e-07 | NA |
7. B | P69874 | Spermidine/putrescine import ATP-binding protein PotA | 1.66e-09 | NA | 1.36e-15 | NA |
7. B | Q927N9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.37e-09 | NA | 6.21e-15 | NA |
7. B | Q2SR40 | Phosphonates import ATP-binding protein PhnC | 5.04e-11 | NA | 1.18e-09 | NA |
7. B | P23924 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.01e-03 | NA | 3.23e-06 | NA |
7. B | Q9LSJ2 | ABC transporter B family member 22 | 0.00e+00 | NA | 9.15e-60 | NA |
7. B | Q0TGT7 | Arabinose import ATP-binding protein AraG | 6.53e-04 | NA | 6.33e-05 | NA |
7. B | Q8EUF1 | Energy-coupling factor transporter ATP-binding protein EcfA | 1.31e-08 | NA | 2.64e-15 | NA |
7. B | Q8FUW8 | Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 | 2.92e-09 | NA | 2.50e-06 | NA |
7. B | Q1C0A2 | Phosphate import ATP-binding protein PstB 2 | 2.43e-11 | NA | 3.27e-16 | NA |
7. B | P0CZ28 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.05e-09 | NA | 7.60e-12 | NA |
7. B | Q74I62 | Putative ABC transporter ATP-binding protein LJ_1704 | 2.06e-04 | NA | 1.92e-10 | NA |
7. B | Q4K3K9 | Phosphate import ATP-binding protein PstB | 1.15e-08 | NA | 2.13e-14 | NA |
7. B | P57030 | Lipoprotein-releasing system ATP-binding protein LolD | 2.72e-10 | NA | 1.70e-05 | NA |
7. B | Q6HNE7 | Ribose import ATP-binding protein RbsA | 5.51e-04 | NA | 2.06e-07 | NA |
7. B | Q1RFY9 | Methionine import ATP-binding protein MetN | 1.96e-11 | NA | 2.41e-14 | NA |
7. B | Q55EH8 | ABC transporter G family member 23 | 1.47e-02 | NA | 2.70e-05 | NA |
7. B | Q631Y4 | Methionine import ATP-binding protein MetN 3 | 1.84e-11 | NA | 6.42e-16 | NA |
7. B | Q2YXY2 | Phosphate import ATP-binding protein PstB | 7.93e-13 | NA | 4.45e-15 | NA |
7. B | Q62K82 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.36e-10 | NA | 1.74e-10 | NA |
7. B | Q8S628 | ABC transporter G family member 51 | 4.04e-04 | NA | 0.004 | NA |
7. B | P29551 | Elongation factor 3 | 2.47e-03 | NA | 0.002 | NA |
7. B | Q8VI47 | ATP-binding cassette sub-family C member 2 | 1.11e-15 | NA | 1.31e-22 | NA |
7. B | Q9PHQ1 | Phosphate import ATP-binding protein PstB | 1.70e-13 | NA | 8.82e-18 | NA |
7. B | Q667L9 | Methionine import ATP-binding protein MetN 2 | 2.05e-11 | NA | 2.46e-15 | NA |
7. B | Q0B1U4 | Xylose import ATP-binding protein XylG | 8.91e-04 | NA | 2.90e-04 | NA |
7. B | Q73DH7 | Ribose import ATP-binding protein RbsA | 8.96e-04 | NA | 9.16e-08 | NA |
7. B | Q65VG9 | Methionine import ATP-binding protein MetN | 8.23e-12 | NA | 1.64e-16 | NA |
7. B | Q8RI39 | Spermidine/putrescine import ATP-binding protein PotA | 1.08e-09 | NA | 5.46e-15 | NA |
7. B | Q8H0V6 | ABC transporter F family member 3 | 6.66e-05 | NA | 1.89e-08 | NA |
7. B | Q8Y455 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.33e-09 | NA | 5.39e-16 | NA |
7. B | Q99XI2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.01e-10 | NA | 1.28e-13 | NA |
7. B | P26905 | Dipeptide transport ATP-binding protein DppD | 1.05e-09 | NA | 1.17e-10 | NA |
7. B | O94489 | Elongation factor 3 | 4.86e-04 | NA | 3.31e-10 | NA |
7. B | Q53I83 | Methionine import ATP-binding protein MetN | 1.41e-10 | NA | 1.40e-15 | NA |
7. B | Q3JDJ6 | Phosphate import ATP-binding protein PstB 1 | 8.81e-09 | NA | 9.03e-10 | NA |
7. B | Q0I074 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.40e-08 | NA | 0.005 | NA |
7. B | Q949G3 | Pleiotropic drug resistance protein 1 | 7.62e-04 | NA | 8.37e-05 | NA |
7. B | A4WER4 | Autoinducer 2 import ATP-binding protein LsrA | 6.12e-04 | NA | 3.06e-04 | NA |
7. B | A0A059J0G5 | ABC multidrug transporter MDR1 | 1.97e-03 | NA | 0.005 | NA |
7. B | Q88WA5 | Methionine import ATP-binding protein MetN 1 | 5.63e-11 | NA | 1.59e-17 | NA |
7. B | Q57AC2 | Phosphate import ATP-binding protein PstB | 3.35e-10 | NA | 9.85e-16 | NA |
7. B | Q9V2E4 | Putative ABC transporter ATP-binding protein PYRAB01300 | 3.17e-11 | NA | 1.73e-11 | NA |
7. B | Q0TFP1 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.45e-10 | NA | 5.83e-05 | NA |
7. B | Q92VJ2 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 1.79e-09 | NA | 7.01e-15 | NA |
7. B | Q2IF17 | Lipoprotein-releasing system ATP-binding protein LolD | 1.67e-10 | NA | 4.84e-07 | NA |
7. B | Q88YK7 | Phosphate import ATP-binding protein PstB 2 | 9.50e-13 | NA | 1.36e-15 | NA |
7. B | Q8CQS7 | Methionine import ATP-binding protein MetN 2 | 9.68e-11 | NA | 1.45e-14 | NA |
7. B | A0A0M4FLW6 | ABC transporter G family member STR2 | 8.82e-03 | NA | 1.92e-05 | NA |
7. B | Q1LX78 | Cystic fibrosis transmembrane conductance regulator | 1.89e-10 | NA | 4.95e-18 | NA |
7. B | Q02ME3 | Methionine import ATP-binding protein MetN 1 | 3.48e-11 | NA | 5.50e-14 | NA |
7. B | Q3KK97 | Methionine import ATP-binding protein MetN 1 | 1.44e-11 | NA | 9.89e-14 | NA |
7. B | Q7MFE8 | Phosphate import ATP-binding protein PstB 2 | 6.65e-09 | NA | 3.62e-15 | NA |
7. B | Q57242 | ATP-binding protein Uup | 3.09e-04 | NA | 0.042 | NA |
7. B | Q05360 | Protein white | NA | NA | 8.11e-08 | NA |
7. B | Q30YR3 | Phosphate import ATP-binding protein PstB | 4.26e-13 | NA | 5.96e-17 | NA |
7. B | O27764 | Phosphate import ATP-binding protein PstB | 2.95e-13 | NA | 5.23e-14 | NA |
7. B | O67154 | Phosphate import ATP-binding protein PstB | 2.57e-12 | NA | 2.37e-17 | NA |
7. B | Q5LI72 | Lipoprotein-releasing system ATP-binding protein LolD | 8.03e-11 | NA | 9.87e-09 | NA |
7. B | Q12ES3 | Lipoprotein-releasing system ATP-binding protein LolD | 1.03e-10 | NA | 1.23e-07 | NA |
7. B | Q63TY1 | Sulfate/thiosulfate import ATP-binding protein CysA | 5.95e-10 | NA | 1.71e-10 | NA |
7. B | Q2IYS5 | Phosphonates import ATP-binding protein PhnC 1 | 4.71e-10 | NA | 1.73e-08 | NA |
7. B | Q8T6B4 | ABC transporter F family member 4 | 5.48e-04 | NA | 9.96e-05 | NA |
7. B | Q9QYM0 | ATP-binding cassette sub-family C member 5 | 0.00e+00 | NA | 2.00e-24 | NA |
7. B | O28881 | Probable branched-chain amino acid transport ATP-binding protein LivG | 1.09e-09 | NA | 2.02e-06 | NA |
7. B | Q03SI5 | Teichoic acids export ATP-binding protein TagH | 1.78e-05 | NA | 2.68e-05 | NA |
7. B | Q5F8K2 | Lipoprotein-releasing system ATP-binding protein LolD | 1.45e-10 | NA | 4.59e-05 | NA |
7. B | Q7A679 | Spermidine/putrescine import ATP-binding protein PotA | 2.48e-09 | NA | 2.87e-13 | NA |
7. B | O26236 | Putative ABC transporter ATP-binding protein MTH_133 | 3.63e-10 | NA | 3.97e-09 | NA |
7. B | P63378 | Phosphate import ATP-binding protein PstB 2 | 4.78e-12 | NA | 5.44e-18 | NA |
7. B | Q5PGP3 | Glutathione import ATP-binding protein GsiA | 2.60e-04 | NA | 2.15e-10 | NA |
7. B | Q50046 | Phosphate import ATP-binding protein PstB | 1.58e-11 | NA | 4.53e-04 | NA |
7. B | Q4L691 | Phosphate import ATP-binding protein PstB | 1.85e-10 | NA | 3.61e-13 | NA |
7. B | Q2YVT7 | Methionine import ATP-binding protein MetN 1 | 7.48e-12 | NA | 1.06e-17 | NA |
7. B | Q8T9W4 | ABC transporter B family member 3 | 0.00e+00 | NA | 5.72e-63 | NA |
7. B | B1JLQ0 | Autoinducer 2 import ATP-binding protein LsrA | 3.12e-03 | NA | 7.27e-05 | NA |
7. B | Q9M1C7 | ABC transporter C family member 9 | 6.66e-13 | NA | 7.56e-29 | NA |
7. B | Q6D7D0 | Molybdenum import ATP-binding protein ModC | 2.11e-08 | NA | 6.69e-13 | NA |
7. B | Q99V03 | Spermidine/putrescine import ATP-binding protein PotA | 1.65e-09 | NA | 2.87e-13 | NA |
7. B | Q6YR39 | Energy-coupling factor transporter ATP-binding protein EcfA | 2.16e-10 | NA | 9.43e-19 | NA |
7. B | Q5ZWE4 | Spermidine/putrescine import ATP-binding protein PotA | 8.05e-10 | NA | 8.26e-15 | NA |
7. B | Q92NU9 | Macrolide export ATP-binding/permease protein MacB | 5.09e-06 | NA | 1.56e-09 | NA |
7. B | O94911 | ABC-type organic anion transporter ABCA8 | 1.75e-03 | NA | 5.59e-08 | NA |
7. B | Q8Y4L8 | Methionine import ATP-binding protein MetN 2 | 1.63e-11 | NA | 2.52e-12 | NA |
7. B | Q8VQK7 | Putative peptide import ATP-binding protein BruAb2_1034 | 2.38e-10 | NA | 3.20e-14 | NA |
7. B | Q5WNX0 | Bacitracin transport ATP-binding protein BcrA | 2.51e-07 | NA | 1.68e-09 | NA |
7. B | Q4ZRT7 | Phosphate import ATP-binding protein PstB 1 | 2.55e-12 | NA | 2.52e-15 | NA |
7. B | Q2G607 | Phosphate import ATP-binding protein PstB | 2.82e-12 | NA | 1.83e-15 | NA |
7. B | P10907 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.71e-10 | NA | 1.21e-07 | NA |
7. B | Q54V86 | ABC transporter C family member 13 | 1.43e-13 | NA | 2.47e-25 | NA |
7. B | Q6LTL7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.78e-09 | NA | 7.84e-04 | NA |
7. B | Q8XMP8 | Phosphate import ATP-binding protein PstB | 6.07e-13 | NA | 3.03e-14 | NA |
7. B | Q8LGU1 | ABC transporter C family member 8 | 6.66e-16 | NA | 5.84e-24 | NA |
7. B | Q97ZT9 | Phosphate import ATP-binding protein PstB | 4.42e-13 | NA | 2.08e-11 | NA |
7. B | Q5H0G3 | Lipoprotein-releasing system ATP-binding protein LolD | 2.42e-10 | NA | 1.58e-05 | NA |
7. B | Q578S8 | Nickel import ATP-binding protein NikD | 2.44e-10 | NA | 3.09e-07 | NA |
7. B | Q1BJW2 | Arabinose import ATP-binding protein AraG 2 | 1.05e-03 | NA | 1.36e-06 | NA |
7. B | Q28VN1 | Zinc import ATP-binding protein ZnuC | 2.60e-10 | NA | 2.45e-14 | NA |
7. B | Q5LVC2 | Phosphonates import ATP-binding protein PhnC | 1.32e-10 | NA | 1.64e-07 | NA |
7. B | Q832R5 | Putative ABC transporter ATP-binding protein EF_2153 | 2.21e-05 | NA | 9.92e-13 | NA |
7. B | P33594 | Nickel import ATP-binding protein NikE | 9.21e-11 | NA | 4.55e-12 | NA |
7. B | P0CZ38 | Phosphate import ATP-binding protein PstB 2 | 6.47e-11 | NA | 5.44e-18 | NA |
7. B | P56899 | UvrABC system protein A | 6.36e-02 | NA | 0.005 | NA |
7. B | Q80WJ6 | ATP-binding cassette sub-family C member 12 | 6.66e-16 | NA | 6.15e-30 | NA |
7. B | Q99S47 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 7.73e-11 | NA | 6.28e-17 | NA |
7. B | P77481 | Putative uncharacterized ABC transporter ATP-binding protein YcjV | 2.08e-11 | NA | 7.82e-12 | NA |
7. B | Q7CMM8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.77e-10 | NA | 1.28e-13 | NA |
7. B | P24586 | Polysialic acid transport ATP-binding protein KpsT | 1.64e-05 | NA | 0.001 | NA |
7. B | Q9MUN1 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.89e-10 | NA | 2.74e-12 | NA |
7. B | Q8R9I2 | Phosphate import ATP-binding protein PstB 2 | 1.99e-12 | NA | 1.20e-16 | NA |
7. B | Q7MLB8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.08e-11 | NA | 1.12e-10 | NA |
7. B | Q2SJY7 | Spermidine/putrescine import ATP-binding protein PotA | 2.59e-09 | NA | 1.79e-16 | NA |
7. B | Q8FFB3 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.47e-10 | NA | 8.38e-11 | NA |
7. B | Q6MSQ1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 5.36e-08 | NA | 4.06e-16 | NA |
7. B | Q1J6D2 | Phosphate import ATP-binding protein PstB 1 | 5.80e-12 | NA | 2.88e-09 | NA |
7. B | Q5HIL5 | Methionine import ATP-binding protein MetN 1 | 9.66e-12 | NA | 1.75e-17 | NA |
7. B | Q7U6R4 | Phosphate import ATP-binding protein PstB | 1.17e-11 | NA | 1.21e-13 | NA |
7. B | Q79EE4 | Osmoprotective compounds uptake ATP-binding protein GgtA | 3.86e-11 | NA | 2.79e-09 | NA |
7. B | Q724C0 | Methionine import ATP-binding protein MetN 1 | 5.81e-11 | NA | 3.72e-13 | NA |
7. B | Q8ZAS8 | Maltose/maltodextrin import ATP-binding protein MalK | 2.23e-11 | NA | 2.46e-15 | NA |
7. B | Q478L3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.22e-09 | NA | 0.024 | NA |
7. B | Q7A470 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 7.30e-11 | NA | 6.28e-17 | NA |
7. B | Q329R2 | Phosphate import ATP-binding protein PstB | 1.78e-11 | NA | 5.39e-19 | NA |
7. B | Q1AXT9 | Phosphate import ATP-binding protein PstB | 2.17e-11 | NA | 7.18e-14 | NA |
7. B | Q1R5D9 | Nickel import ATP-binding protein NikD | 1.13e-11 | NA | 5.27e-06 | NA |
7. B | Q0TMS8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.12e-08 | NA | 8.34e-18 | NA |
7. B | Q1CCI2 | Phosphate import ATP-binding protein PstB 2 | 1.75e-11 | NA | 3.27e-16 | NA |
7. B | P0A4W3 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.37e-09 | NA | 2.64e-11 | NA |
7. B | P61481 | Lipoprotein-releasing system ATP-binding protein LolD | 1.70e-10 | NA | 3.90e-07 | NA |
7. B | P43071 | Multidrug resistance protein CDR1 | 3.46e-04 | NA | 6.20e-05 | NA |
7. B | Q1BG75 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 5.60e-07 | NA | 5.24e-07 | NA |
7. B | P0A9V1 | Lipopolysaccharide export system ATP-binding protein LptB | 7.61e-11 | NA | 1.09e-04 | NA |
7. B | Q8PGE8 | Methionine import ATP-binding protein MetN | 1.67e-11 | NA | 6.89e-16 | NA |
7. B | Q6LV32 | Thiamine import ATP-binding protein ThiQ | 4.71e-11 | NA | 5.62e-13 | NA |
7. B | Q7W9U5 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.99e-10 | NA | 9.23e-10 | NA |
7. B | Q82WT5 | Sulfate/thiosulfate import ATP-binding protein CysA | 8.45e-11 | NA | 1.06e-15 | NA |
7. B | Q160M2 | Spermidine/putrescine import ATP-binding protein PotA | 1.18e-09 | NA | 8.89e-11 | NA |
7. B | Q02MI4 | Macrolide export ATP-binding/permease protein MacB | 6.04e-02 | NA | 6.01e-10 | NA |
7. B | Q2M3G0 | ATP-binding cassette sub-family B member 5 | 0.00e+00 | NA | 7.03e-60 | NA |
7. B | Q8PY26 | Putative ABC transporter ATP-binding protein MM_1038 | 5.01e-08 | NA | 4.25e-13 | NA |
7. B | Q9VL32 | ATP-binding cassette sub-family C member Sur | 4.72e-11 | NA | 2.04e-24 | NA |
7. B | Q9C8K2 | ABC transporter G family member 12 | 1.47e-02 | NA | 2.80e-05 | NA |
7. B | Q8YCB1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.94e-11 | NA | 1.12e-11 | NA |
7. B | Q972J5 | Putative ABC transporter ATP-binding protein STK_11360 | 8.17e-04 | NA | 6.24e-07 | NA |
7. B | Q8ZH38 | Methionine import ATP-binding protein MetN 1 | 1.99e-11 | NA | 6.04e-16 | NA |
7. B | Q48BP8 | Phosphate import ATP-binding protein PstB 2 | 1.26e-08 | NA | 5.24e-16 | NA |
7. B | Q2J534 | Phosphate import ATP-binding protein PstB | 1.37e-11 | NA | 2.49e-12 | NA |
7. B | Q97Q42 | Spermidine/putrescine import ATP-binding protein PotA | 1.79e-09 | NA | 4.77e-15 | NA |
7. B | Q032A0 | Methionine import ATP-binding protein MetN | 1.87e-10 | NA | 3.65e-17 | NA |
7. B | P42064 | Oligopeptide transport ATP-binding protein AppD | 3.56e-10 | NA | 3.98e-08 | NA |
7. B | Q8FBS3 | Ribose import ATP-binding protein RbsA | 7.22e-04 | NA | 1.87e-06 | NA |
7. B | P13569 | Cystic fibrosis transmembrane conductance regulator | 4.86e-10 | NA | 2.15e-19 | NA |
7. B | P0CZ31 | Methionine import ATP-binding protein MetN | 9.69e-11 | NA | 1.90e-16 | NA |
7. B | A0B344 | Methionine import ATP-binding protein MetN 2 | 1.34e-06 | NA | 1.31e-13 | NA |
7. B | P0A9V2 | Lipopolysaccharide export system ATP-binding protein LptB | 7.96e-11 | NA | 1.09e-04 | NA |
7. B | P15361 | Probable ABC transporter ATP-binding protein p29 | 1.14e-10 | NA | 2.70e-12 | NA |
7. B | Q8FCE2 | Xylose import ATP-binding protein XylG | 6.80e-04 | NA | 0.002 | NA |
7. B | Q6G5J0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.31e-11 | NA | 4.78e-11 | NA |
7. B | Q3Z3Q4 | Macrolide export ATP-binding/permease protein MacB | 2.71e-02 | NA | 1.78e-10 | NA |
7. B | Q04F14 | Methionine import ATP-binding protein MetN 1 | 2.35e-10 | NA | 2.47e-17 | NA |
7. B | Q8FL82 | Thiamine import ATP-binding protein ThiQ | 9.49e-12 | NA | 3.96e-10 | NA |
7. B | P31134 | Putrescine transport ATP-binding protein PotG | 7.39e-09 | NA | 2.69e-15 | NA |
7. B | P45051 | Oligopeptide transport ATP-binding protein OppF | 3.73e-10 | NA | 3.67e-09 | NA |
7. B | Q21TG3 | Lipoprotein-releasing system ATP-binding protein LolD | 7.50e-11 | NA | 6.67e-08 | NA |
7. B | Q63H29 | Methionine import ATP-binding protein MetN 1 | 3.86e-11 | NA | 3.99e-14 | NA |
7. B | Q668L6 | Macrolide export ATP-binding/permease protein MacB 2 | 3.85e-02 | NA | 3.90e-11 | NA |
7. B | Q1BQ82 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 7.05e-04 | NA | 8.26e-04 | NA |
7. B | Q63A38 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.01e-07 | NA | 1.10e-09 | NA |
7. B | Q8GNH6 | Nod factor export ATP-binding protein I | 1.92e-06 | NA | 1.28e-11 | NA |
7. B | Q1DDP4 | Methionine import ATP-binding protein MetN | 5.46e-11 | NA | 8.42e-14 | NA |
7. B | Q7WFU9 | Methionine import ATP-binding protein MetN | 3.11e-08 | NA | 8.04e-15 | NA |
7. B | Q9HYG4 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.78e-07 | NA | 5.88e-12 | NA |
7. B | Q92TS8 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 6.19e-04 | NA | 5.36e-07 | NA |
7. B | Q5HHK4 | Methionine import ATP-binding protein MetN 2 | 2.89e-11 | NA | 2.86e-13 | NA |
7. B | P9WQL5 | Probable ribonucleotide transport ATP-binding protein mkl | 3.58e-10 | NA | 0.003 | NA |
7. B | O34814 | Cell division ATP-binding protein FtsE | 2.96e-11 | NA | 3.47e-19 | NA |
7. B | O05779 | Cell division ATP-binding protein FtsE | 3.26e-11 | NA | 4.10e-13 | NA |
7. B | A4TQL5 | Autoinducer 2 import ATP-binding protein LsrA | 1.02e-03 | NA | 7.59e-05 | NA |
7. B | Q8E3S0 | Methionine import ATP-binding protein MetN | 7.18e-11 | NA | 3.12e-14 | NA |
7. B | Q4L4R9 | Methionine import ATP-binding protein MetN | 2.56e-11 | NA | 3.40e-16 | NA |
7. B | Q9I6T2 | Spermidine/putrescine import ATP-binding protein PotA 1 | 3.81e-09 | NA | 5.67e-11 | NA |
7. B | Q8ZGU5 | Phosphonates import ATP-binding protein PhnC | 5.60e-08 | NA | 4.75e-07 | NA |
7. B | P0C2H2 | Macrolide export ATP-binding/permease protein MacB | 1.11e-01 | NA | 2.02e-09 | NA |
7. B | Q8MIB3 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 3.62e-02 | NA | 1.18e-08 | NA |
7. B | Q0T2X5 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.81e-03 | NA | 8.59e-06 | NA |
7. B | Q83LT3 | Glutathione import ATP-binding protein GsiA | 2.31e-04 | NA | 9.18e-11 | NA |
7. B | Q3JZP8 | Methionine import ATP-binding protein MetN | 1.04e-10 | NA | 9.38e-15 | NA |
7. B | Q1M7R4 | Taurine import ATP-binding protein TauB | 1.26e-07 | NA | 7.09e-05 | NA |
7. B | Q62GB4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.21e-10 | NA | 9.58e-08 | NA |
7. B | Q8GU84 | ABC transporter G family member 48 | 4.96e-04 | NA | 1.34e-04 | NA |
7. B | Q9HZS1 | Histidine transport ATP-binding protein HisP | 2.24e-11 | NA | 2.71e-07 | NA |
7. B | Q4KKK8 | Methionine import ATP-binding protein MetN 1 | 1.75e-12 | NA | 7.48e-16 | NA |
7. B | Q47RE8 | Methionine import ATP-binding protein MetN | 1.98e-11 | NA | 1.48e-13 | NA |
7. B | Q9A9P4 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 6.47e-11 | NA | 2.13e-09 | NA |
7. B | Q5M244 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.77e-10 | NA | 1.26e-15 | NA |
7. B | P0A192 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 4.26e-11 | NA | 0.026 | NA |
7. B | Q81VQ2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.99e-09 | NA | 1.80e-18 | NA |
7. B | P44735 | Ribose import ATP-binding protein RbsA | 6.51e-04 | NA | 4.38e-04 | NA |
7. B | Q9KTJ5 | Methionine import ATP-binding protein MetN | 2.27e-11 | NA | 1.56e-15 | NA |
7. B | Q89AJ0 | Zinc import ATP-binding protein ZnuC | 5.28e-11 | NA | 8.07e-09 | NA |
7. B | Q55108 | Bicarbonate transport ATP-binding protein CmpD | 8.01e-08 | NA | 4.83e-08 | NA |
7. B | Q7V1X3 | Phosphate import ATP-binding protein PstB | 1.01e-11 | NA | 4.25e-13 | NA |
7. B | Q9FT51 | ABC transporter G family member 27 | 8.88e-02 | NA | 1.09e-05 | NA |
7. B | Q6G0V9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.75e-07 | NA | 0.015 | NA |
7. B | Q8ZCM2 | Fe(3+) ions import ATP-binding protein FbpC | 8.14e-09 | NA | 1.83e-15 | NA |
7. B | Q1CI46 | Lipoprotein-releasing system ATP-binding protein LolD | 1.55e-10 | NA | 3.34e-08 | NA |
7. B | Q9SJK6 | Putative white-brown complex homolog protein 30 | 7.27e-04 | NA | 2.43e-06 | NA |
7. B | Q7WIP8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.97e-09 | NA | 6.88e-06 | NA |
7. B | P0CZ39 | Phosphate import ATP-binding protein PstB 2 | 5.33e-12 | NA | 5.44e-18 | NA |
7. B | Q9HY19 | Spermidine/putrescine import ATP-binding protein PotA 2 | 1.22e-09 | NA | 7.10e-11 | NA |
7. B | Q6G6W1 | Putative hemin import ATP-binding protein HrtA | 3.27e-11 | NA | 6.98e-10 | NA |
7. B | Q04BY6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.61e-08 | NA | 3.98e-09 | NA |
7. B | Q5KUX3 | Ribose import ATP-binding protein RbsA | 6.81e-04 | NA | 4.50e-07 | NA |
7. B | A7KVC2 | ABC transporter C family MRP4 | 4.76e-13 | NA | 4.46e-26 | NA |
7. B | P33916 | Uncharacterized ABC transporter ATP-binding protein YejF | 1.75e-04 | NA | 2.16e-14 | NA |
7. B | Q66FK0 | Hemin import ATP-binding protein HmuV | 1.63e-09 | NA | 9.24e-06 | NA |
7. B | Q45460 | Choline transport ATP-binding protein OpuBA | 2.97e-11 | NA | 4.64e-16 | NA |
7. B | Q54BT3 | ABC transporter B family member 2 | 0.00e+00 | NA | 9.67e-67 | NA |
7. B | Q5FQN4 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.66e-07 | NA | 4.03e-04 | NA |
7. B | Q0I5E9 | Methionine import ATP-binding protein MetN | 1.44e-11 | NA | 2.51e-16 | NA |
7. B | Q8YCG3 | Fe(3+) ions import ATP-binding protein FbpC | 3.33e-09 | NA | 9.61e-16 | NA |
7. B | Q9Z8J5 | Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 | 9.76e-07 | NA | 5.63e-10 | NA |
7. B | Q492R2 | Lipoprotein-releasing system ATP-binding protein LolD | 5.10e-11 | NA | 1.44e-05 | NA |
7. B | Q8DFQ4 | Zinc import ATP-binding protein ZnuC | 1.05e-10 | NA | 3.44e-09 | NA |
7. B | P0AAH0 | Phosphate import ATP-binding protein PstB | 1.80e-11 | NA | 5.39e-19 | NA |
7. B | Q0SIB7 | Hemin import ATP-binding protein HmuV | 9.47e-08 | NA | 0.004 | NA |
7. B | P77795 | Uncharacterized ABC transporter ATP-binding protein YdcT | 1.68e-09 | NA | 5.94e-09 | NA |
7. B | Q2YXY9 | Nickel import system ATP-binding protein NikD | 1.23e-09 | NA | 1.01e-09 | NA |
7. B | Q03PY5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.50e-09 | NA | 6.62e-10 | NA |
7. B | Q32AY3 | Hemin import ATP-binding protein HmuV | 1.72e-09 | NA | 5.22e-05 | NA |
7. B | Q1C5W7 | Macrolide export ATP-binding/permease protein MacB 2 | 3.81e-02 | NA | 3.63e-11 | NA |
7. B | Q3M4H5 | Phosphate import ATP-binding protein PstB 5 | 2.53e-12 | NA | 4.15e-11 | NA |
7. B | Q8LPK2 | ABC transporter B family member 2 | 0.00e+00 | NA | 3.60e-65 | NA |
7. B | A1TXH7 | Spermidine/putrescine import ATP-binding protein PotA | 3.25e-09 | NA | 1.62e-13 | NA |
7. B | Q47087 | Achromobactin transport ATP-binding protein CbrD | 2.44e-10 | NA | 1.67e-09 | NA |
7. B | Q98GF5 | Phosphonates import ATP-binding protein PhnC | 3.49e-11 | NA | 8.03e-11 | NA |
7. B | Q6D4A8 | Zinc import ATP-binding protein ZnuC | 9.73e-10 | NA | 2.25e-11 | NA |
7. B | Q7M8M4 | Phosphonates import ATP-binding protein PhnC | 2.94e-11 | NA | 1.49e-10 | NA |
7. B | P40860 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.67e-10 | NA | 4.05e-10 | NA |
7. B | Q2FHY1 | Spermidine/putrescine import ATP-binding protein PotA | 1.85e-09 | NA | 2.87e-13 | NA |
7. B | Q71WH8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.77e-09 | NA | 7.00e-16 | NA |
7. B | O34900 | L-cystine import ATP-binding protein TcyN | 6.93e-12 | NA | 2.20e-13 | NA |
7. B | Q1CFV9 | Phosphonates import ATP-binding protein PhnC | 2.35e-08 | NA | 4.75e-07 | NA |
7. B | Q1C9L0 | Phosphonates import ATP-binding protein PhnC | 5.50e-08 | NA | 4.75e-07 | NA |
7. B | Q12XW6 | Phosphate import ATP-binding protein PstB | 3.31e-13 | NA | 2.70e-20 | NA |
7. B | Q2YZ26 | Putative hemin import ATP-binding protein HrtA | 8.62e-11 | NA | 2.80e-10 | NA |
7. B | O54187 | Putative ABC transporter ATP-binding protein SCO5958 | 1.88e-09 | NA | 2.30e-08 | NA |
7. B | D3ZCM3 | ATP-binding cassette subfamily G member 4 | 1.58e-02 | NA | 7.74e-07 | NA |
7. B | Q5WC31 | Ribose import ATP-binding protein RbsA | 8.53e-04 | NA | 1.93e-08 | NA |
7. B | Q03ZQ0 | Spermidine/putrescine import ATP-binding protein PotA | 9.10e-10 | NA | 7.52e-13 | NA |
7. B | Q1GHY4 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.07e-07 | NA | 2.05e-04 | NA |
7. B | Q329I3 | Phosphonates import ATP-binding protein PhnC | 9.93e-11 | NA | 0.019 | NA |
7. B | Q2K0S7 | Ribose import ATP-binding protein RbsA 3 | 6.64e-04 | NA | 3.28e-05 | NA |
7. B | Q1B8U4 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.06e-07 | NA | 2.73e-07 | NA |
7. B | Q8XA06 | Thiamine import ATP-binding protein ThiQ | 8.95e-12 | NA | 1.14e-10 | NA |
7. B | Q97LQ1 | UvrABC system protein A | 6.75e-02 | NA | 0.015 | NA |
7. B | Q6GKG3 | Phosphonates import ATP-binding protein PhnC | 5.61e-11 | NA | 4.26e-12 | NA |
7. B | Q73KT5 | Putative ABC transporter ATP-binding protein TDE_2132 | 3.01e-11 | NA | 1.76e-06 | NA |
7. B | O26096 | Methionine import ATP-binding protein MetN | 1.59e-11 | NA | 2.53e-16 | NA |
7. B | Q21XK2 | Methionine import ATP-binding protein MetN | 3.12e-08 | NA | 5.61e-16 | NA |
7. B | Q2SVU4 | Ribose import ATP-binding protein RbsA 1 | 1.84e-03 | NA | 0.012 | NA |
7. B | Q9XBG1 | Phosphate import ATP-binding protein PstB | 7.78e-10 | NA | 3.17e-15 | NA |
7. B | Q04B25 | Methionine import ATP-binding protein MetN | 1.70e-10 | NA | 1.14e-13 | NA |
7. B | Q31ZH4 | Lipoprotein-releasing system ATP-binding protein LolD | 1.53e-10 | NA | 4.87e-08 | NA |
7. B | Q2GFZ6 | Zinc import ATP-binding protein ZnuC | 4.30e-09 | NA | 0.012 | NA |
7. B | Q12R52 | Hemin import ATP-binding protein HmuV | 4.04e-10 | NA | 6.94e-05 | NA |
7. B | P78966 | Mating factor M secretion protein mam1 | 0.00e+00 | NA | 1.50e-31 | NA |
7. B | O26543 | UvrABC system protein A | 1.43e-02 | NA | 0.006 | NA |
7. B | Q87DT9 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.91e-10 | NA | 5.94e-10 | NA |
7. B | Q0TBX8 | Nickel import ATP-binding protein NikE | 5.21e-11 | NA | 1.25e-12 | NA |
7. B | Q0T6D3 | Glutathione import ATP-binding protein GsiA | 2.64e-04 | NA | 1.16e-10 | NA |
7. B | Q9HT70 | Methionine import ATP-binding protein MetN 2 | 2.74e-12 | NA | 1.25e-13 | NA |
7. B | Q04FM1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 4.48e-09 | NA | 3.52e-13 | NA |
7. B | Q8FWP1 | Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 | 1.13e-09 | NA | 1.03e-10 | NA |
7. B | A0KPH6 | Zinc import ATP-binding protein ZnuC | 3.76e-09 | NA | 2.09e-09 | NA |
7. B | Q164K3 | Ribose import ATP-binding protein RbsA | 9.36e-04 | NA | 5.54e-08 | NA |
7. B | Q9S4Z0 | Methionine import ATP-binding protein MetN | 9.46e-09 | NA | 4.31e-10 | NA |
7. B | Q668E1 | Phosphate import ATP-binding protein PstB 1 | 2.14e-11 | NA | 4.14e-14 | NA |
7. B | Q8Z990 | Methionine import ATP-binding protein MetN 1 | 2.14e-11 | NA | 2.52e-14 | NA |
7. B | P0C0E9 | Energy-coupling factor transporter ATP-binding protein EcfA | 2.60e-09 | NA | 7.60e-12 | NA |
7. B | Q2K396 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.19e-07 | NA | 8.38e-07 | NA |
7. B | Q5XDV5 | Probable ABC transporter ATP-binding protein M6_Spy0273 | 2.53e-09 | NA | 4.08e-06 | NA |
7. B | Q8T5Z7 | ABC transporter A family member 1 | 1.78e-06 | NA | 1.03e-05 | NA |
7. B | Q10185 | ATP-binding cassette transporter abc2 | 0.00e+00 | NA | 1.17e-25 | NA |
7. B | Q55195 | Phosphate import ATP-binding protein PstB 2 | 3.54e-12 | NA | 5.60e-13 | NA |
7. B | A0KGB3 | Macrolide export ATP-binding/permease protein MacB 1 | 5.69e-02 | NA | 2.45e-08 | NA |
7. B | Q5LZU2 | Phosphate import ATP-binding protein PstB 2 | 2.76e-12 | NA | 2.71e-10 | NA |
7. B | Q8YA75 | Methionine import ATP-binding protein MetN 1 | 1.25e-10 | NA | 6.92e-13 | NA |
7. B | Q66AF5 | Arabinose import ATP-binding protein AraG | 7.82e-04 | NA | 1.01e-05 | NA |
7. B | Q5XDU4 | Oligopeptide transport ATP-binding protein OppF | 6.75e-11 | NA | 8.96e-16 | NA |
7. B | Q49ZD9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.90e-08 | NA | 4.29e-14 | NA |
7. B | Q1JBV6 | Spermidine/putrescine import ATP-binding protein PotA | 4.56e-10 | NA | 6.49e-16 | NA |
7. B | Q89NX6 | Macrolide export ATP-binding/permease protein MacB | 4.52e-02 | NA | 1.68e-06 | NA |
7. B | Q39T41 | Lipoprotein-releasing system ATP-binding protein LolD | 3.17e-11 | NA | 1.86e-12 | NA |
7. B | Q1H377 | Phosphate import ATP-binding protein PstB | 3.97e-11 | NA | 2.04e-13 | NA |
7. B | Q8YCN7 | Nickel import ATP-binding protein NikE | 3.63e-11 | NA | 3.53e-11 | NA |
7. B | Q578S7 | Nickel import ATP-binding protein NikE | 3.19e-11 | NA | 3.53e-11 | NA |
7. B | P25997 | Elongation factor 3 | 1.01e-03 | NA | 9.84e-07 | NA |
7. B | Q8DY54 | Methionine import ATP-binding protein MetN | 1.10e-10 | NA | 9.38e-15 | NA |
7. B | Q927Z7 | Phosphate import ATP-binding protein PstB 2 | 1.23e-12 | NA | 1.89e-15 | NA |
7. B | Q8RXN0 | ABC transporter G family member 11 | 1.08e-02 | NA | 1.28e-05 | NA |
7. B | O51777 | UvrABC system protein A | 4.19e-02 | NA | 0.041 | NA |
7. B | Q17VE0 | Methionine import ATP-binding protein MetN | 3.22e-12 | NA | 1.22e-15 | NA |
7. B | Q86HQ2 | ABC transporter G family member 8 | 2.10e-02 | NA | 3.68e-09 | NA |
7. B | Q831K6 | Methionine import ATP-binding protein MetN 2 | 9.12e-12 | NA | 1.01e-16 | NA |
7. B | Q4ZQZ7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.60e-08 | NA | 1.47e-08 | NA |
7. B | Q73GK9 | Zinc import ATP-binding protein ZnuC | 4.61e-06 | NA | 1.69e-05 | NA |
7. B | Q9PBK0 | Phosphate import ATP-binding protein PstB | 2.40e-12 | NA | 3.30e-15 | NA |
7. B | Q7NPP4 | Phosphate import ATP-binding protein PstB 1 | 3.25e-11 | NA | 6.33e-15 | NA |
7. B | Q66EY9 | Autoinducer 2 import ATP-binding protein LsrA | 3.04e-04 | NA | 5.14e-05 | NA |
7. B | Q18K56 | Phosphate import ATP-binding protein PstB | 1.60e-11 | NA | 4.14e-11 | NA |
7. B | P0AAG4 | Glutamate/aspartate import ATP-binding protein GltL | 2.23e-13 | NA | 6.88e-06 | NA |
7. B | Q4ZZK0 | Methionine import ATP-binding protein MetN 2 | 4.03e-06 | NA | 5.75e-17 | NA |
7. B | P50980 | Oligopeptide transport ATP-binding protein OppD | 2.59e-09 | NA | 3.27e-09 | NA |
7. B | Q7CIC2 | Zinc import ATP-binding protein ZnuC | 2.74e-09 | NA | 8.08e-10 | NA |
7. B | Q880A6 | Phosphate import ATP-binding protein PstB 1 | 2.29e-12 | NA | 2.52e-15 | NA |
7. B | Q0C0L5 | Phosphate import ATP-binding protein PstB | 4.54e-09 | NA | 9.18e-15 | NA |
7. B | P16676 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.45e-09 | NA | 8.08e-11 | NA |
7. B | Q11NG0 | Phosphate import ATP-binding protein PstB | 2.98e-13 | NA | 6.17e-12 | NA |
7. B | Q93D97 | Putative ABC transporter ATP-binding protein SMU_1934c | 1.20e-04 | NA | 4.93e-14 | NA |
7. B | Q7VMF9 | Macrolide export ATP-binding/permease protein MacB | 9.75e-02 | NA | 7.09e-12 | NA |
7. B | Q8XJX3 | Ribose import ATP-binding protein RbsA | 6.17e-04 | NA | 9.00e-09 | NA |
7. B | Q6FCW7 | Phosphate import ATP-binding protein PstB | 5.80e-09 | NA | 3.95e-13 | NA |
7. B | Q2FYQ0 | Phosphate import ATP-binding protein PstB | 6.94e-13 | NA | 4.89e-15 | NA |
7. B | Q1D320 | Phosphate import ATP-binding protein PstB | 3.22e-13 | NA | 5.30e-12 | NA |
7. B | Q47CB7 | Molybdenum import ATP-binding protein ModC | 6.06e-08 | NA | 4.90e-06 | NA |
7. B | Q54K24 | ABC transporter C family member 14 | 0.00e+00 | NA | 3.36e-26 | NA |
7. B | Q5JEB0 | Molybdate/tungstate import ATP-binding protein WtpC | 3.92e-10 | NA | 1.88e-09 | NA |
7. B | Q5LBQ4 | Phosphate import ATP-binding protein PstB | 5.67e-13 | NA | 1.53e-18 | NA |
7. B | Q9LHK4 | Putative ABC transporter B family member 8 | 0.00e+00 | NA | 2.34e-54 | NA |
7. B | F1MWM0 | Retinal-specific phospholipid-transporting ATPase ABCA4 | NA | NA | 9.86e-05 | NA |
7. B | Q1LFZ8 | Cytochrome c biogenesis ATP-binding export protein CcmA 2 | 2.38e-09 | NA | 0.015 | NA |
7. B | Q54VJ0 | ABC transporter C family member 2 | 2.22e-16 | NA | 1.54e-25 | NA |
7. B | Q6MIP7 | Phosphonates import ATP-binding protein PhnC | 3.75e-10 | NA | 5.66e-09 | NA |
7. B | Q3JYY5 | Phosphate import ATP-binding protein PstB 3 | 5.40e-13 | NA | 1.28e-14 | NA |
7. B | Q9UNQ0 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 2.40e-02 | NA | 6.70e-09 | NA |
7. B | Q576E0 | Putative ATP-binding protein BruAb2_1123 | 1.09e-08 | NA | 7.69e-06 | NA |
7. B | Q6G9I1 | Nickel import system ATP-binding protein NikE | 8.29e-12 | NA | 1.64e-14 | NA |
7. B | Q5V0G3 | Phosphate import ATP-binding protein PstB 2 | 9.07e-12 | NA | 6.04e-10 | NA |
7. B | Q1CFH7 | Methionine import ATP-binding protein MetN 2 | 1.87e-11 | NA | 6.04e-16 | NA |
7. B | Q8YUV1 | Phosphonates import ATP-binding protein PhnC 1 | 8.51e-11 | NA | 0.006 | NA |
7. B | Q66D26 | Phosphonates import ATP-binding protein PhnC | 5.70e-08 | NA | 4.75e-07 | NA |
7. B | Q8VZZ4 | ABC transporter C family member 6 | 2.64e-11 | NA | 1.14e-23 | NA |
7. B | Q2NHW1 | Phosphate import ATP-binding protein PstB | 1.80e-13 | NA | 2.62e-13 | NA |
7. B | P0A2U8 | Oligopeptide transport ATP-binding protein AmiE | 6.22e-10 | NA | 2.03e-07 | NA |
7. B | Q5Z293 | Phosphate import ATP-binding protein PstB | 3.17e-11 | NA | 0.001 | NA |
7. B | F2RSQ6 | ABC multidrug transporter MDR1 | 2.05e-03 | NA | 0.005 | NA |
7. B | Q8FHR3 | Uncharacterized ABC transporter ATP-binding protein YcjV | 3.53e-11 | NA | 2.63e-12 | NA |
7. B | H6TB12 | Sophorolipid transporter | 0.00e+00 | NA | 4.59e-63 | NA |
7. B | D4AYW0 | ABC transporter G family member ARB_01379 | 6.35e-03 | NA | 4.45e-04 | NA |
7. B | Q88XV2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 6.91e-10 | NA | 1.17e-13 | NA |
7. B | Q2QL74 | Cystic fibrosis transmembrane conductance regulator | 2.88e-11 | NA | 5.49e-20 | NA |
7. B | O83078 | Probable metal transport system ATP-binding protein TP_0035 | 1.09e-09 | NA | 2.09e-09 | NA |
7. B | Q8TSC8 | Putative ABC transporter ATP-binding protein MA_0870 | 1.03e-04 | NA | 1.41e-07 | NA |
7. B | Q57IS3 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.88e-10 | NA | 2.96e-07 | NA |
7. B | Q8XKQ2 | Galactose/methyl galactoside import ATP-binding protein MglA | 9.83e-04 | NA | 1.12e-07 | NA |
7. B | Q4QK92 | Phosphate import ATP-binding protein PstB | 2.04e-11 | NA | 1.41e-17 | NA |
7. B | Q55DR1 | ABC transporter G family member 14 | 2.93e-03 | NA | 7.68e-06 | NA |
7. B | Q13LC4 | Phosphonates import ATP-binding protein PhnC | 5.55e-10 | NA | 0.002 | NA |
7. B | Q5E5I1 | Hemin import ATP-binding protein HmuV | 5.90e-09 | NA | 0.013 | NA |
7. B | Q1MAA2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 4.37e-04 | NA | 2.67e-06 | NA |
7. B | Q9KL04 | Maltose/maltodextrin import ATP-binding protein MalK | 1.06e-10 | NA | 1.51e-13 | NA |
7. B | D4GP39 | Xylose/arabinose import ATP-binding protein XacK | 3.08e-10 | NA | 1.29e-08 | NA |
7. B | Q99PE7 | ATP-binding cassette sub-family G member 5 | 1.01e-02 | NA | 6.25e-07 | NA |
7. B | A1K323 | Macrolide export ATP-binding/permease protein MacB | 1.38e-05 | NA | 9.40e-08 | NA |
7. B | Q8D4H4 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.08e-03 | NA | 0.040 | NA |
7. B | Q9KSD1 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.76e-03 | NA | 0.008 | NA |
7. B | Q1J6D1 | Phosphate import ATP-binding protein PstB 2 | 6.52e-11 | NA | 5.44e-18 | NA |
7. B | Q9HNI8 | Phosphonates import ATP-binding protein PhnC | 6.14e-10 | NA | 5.46e-04 | NA |
7. B | P73265 | Nitrate import ATP-binding protein NrtD | 1.59e-07 | NA | 1.09e-07 | NA |
7. B | O34979 | Uncharacterized ABC transporter ATP-binding protein YvrO | 1.63e-11 | NA | 4.16e-15 | NA |
7. B | O24367 | Pleiotropic drug resistance protein TUR2 | 2.16e-03 | NA | 0.001 | NA |
7. B | Q323M3 | Macrolide export ATP-binding/permease protein MacB | 3.48e-02 | NA | 9.28e-10 | NA |
7. B | Q6AE21 | Methionine import ATP-binding protein MetN | 2.18e-11 | NA | 3.38e-18 | NA |
7. B | P07109 | Histidine transport ATP-binding protein HisP | 1.63e-11 | NA | 2.79e-07 | NA |
7. B | A0A0H2VFI8 | Energy-dependent translational throttle protein EttA | 2.98e-04 | NA | 6.77e-06 | NA |
7. B | Q49XC6 | Phosphonates import ATP-binding protein PhnC | 4.46e-11 | NA | 2.59e-10 | NA |
7. B | O74208 | Pleiotropic ABC efflux transporter of multiple drugs PDH1 | 5.71e-03 | NA | 1.40e-04 | NA |
7. B | Q7W736 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.28e-09 | NA | 2.70e-05 | NA |
7. B | Q13GD4 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 1.47e-09 | NA | 1.86e-04 | NA |
7. B | Q8EK40 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.14e-08 | NA | 0.001 | NA |
7. B | Q1QDA8 | Macrolide export ATP-binding/permease protein MacB | 1.02e-05 | NA | 2.01e-11 | NA |
7. B | Q897I2 | Putative ABC transporter ATP-binding protein CTC_00753 | 2.84e-05 | NA | 2.46e-15 | NA |
7. B | Q8D3A0 | Lipoprotein-releasing system ATP-binding protein LolD | 1.12e-10 | NA | 8.80e-08 | NA |
7. B | Q4FU75 | Macrolide export ATP-binding/permease protein MacB | 1.00e-05 | NA | 2.11e-10 | NA |
7. B | A1VYW8 | Macrolide export ATP-binding/permease protein MacB | 1.70e-02 | NA | 3.21e-08 | NA |
7. B | Q5NZT6 | Lipoprotein-releasing system ATP-binding protein LolD | 3.30e-10 | NA | 1.40e-06 | NA |
7. B | Q92W56 | Arabinose import ATP-binding protein AraG | 1.46e-03 | NA | 0.011 | NA |
7. B | Q7VLS9 | Zinc import ATP-binding protein ZnuC | 1.34e-07 | NA | 8.45e-07 | NA |
7. B | Q07LR5 | Methionine import ATP-binding protein MetN | 4.59e-10 | NA | 1.42e-10 | NA |
7. B | P16677 | Phosphonates import ATP-binding protein PhnC | 5.19e-11 | NA | 0.024 | NA |
7. B | Q6N0P7 | Molybdenum import ATP-binding protein ModC | 7.14e-08 | NA | 2.29e-10 | NA |
7. B | Q8UH62 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 9.95e-10 | NA | 4.41e-14 | NA |
7. B | Q02XM9 | Ribose import ATP-binding protein RbsA | 9.35e-04 | NA | 6.24e-05 | NA |
7. B | Q3JHC9 | Methionine import ATP-binding protein MetN 2 | 1.51e-09 | NA | 5.48e-13 | NA |
7. B | Q8NQH4 | Phosphonates import ATP-binding protein PhnC | 4.39e-10 | NA | 2.56e-08 | NA |
7. B | Q890X9 | UvrABC system protein A | 2.08e-02 | NA | 0.003 | NA |
7. B | Q8E2L2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.96e-09 | NA | 2.30e-10 | NA |
7. B | Q6G9H4 | Phosphate import ATP-binding protein PstB | 7.85e-13 | NA | 4.89e-15 | NA |
7. B | Q6CYN3 | Phosphate import ATP-binding protein PstB 2 | 2.46e-11 | NA | 1.12e-16 | NA |
7. B | A1BE50 | Macrolide export ATP-binding/permease protein MacB | 1.99e-06 | NA | 1.87e-08 | NA |
7. B | Q5QU46 | Lipoprotein-releasing system ATP-binding protein LolD | 1.11e-10 | NA | 4.31e-12 | NA |
7. B | Q92UX0 | Taurine import ATP-binding protein TauB | 1.01e-07 | NA | 5.95e-09 | NA |
7. B | Q7XA72 | ABC transporter G family member 21 | 8.67e-03 | NA | 3.31e-12 | NA |
7. B | P0CZ30 | Methionine import ATP-binding protein MetN | 7.35e-11 | NA | 1.90e-16 | NA |
7. B | Q99758 | Phospholipid-transporting ATPase ABCA3 | 9.39e-05 | NA | 6.64e-07 | NA |
7. B | Q8L1U3 | Hemin import ATP-binding protein HmuV | 4.28e-10 | NA | 6.52e-06 | NA |
7. B | Q8FVV5 | Fe(3+) ions import ATP-binding protein FbpC | 4.37e-09 | NA | 4.90e-15 | NA |
7. B | Q8Z9I6 | Thiamine import ATP-binding protein ThiQ | 2.16e-11 | NA | 6.01e-10 | NA |
7. B | Q63MM6 | Macrolide export ATP-binding/permease protein MacB | 4.51e-02 | NA | 2.83e-07 | NA |
7. B | Q7N986 | Maltose/maltodextrin import ATP-binding protein MalK | 2.65e-11 | NA | 1.51e-17 | NA |
7. B | P9WQK2 | Energy-dependent translational throttle protein EttA | 6.58e-05 | NA | 0.039 | NA |
7. B | P33931 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.20e-10 | NA | 5.83e-05 | NA |
7. B | Q552P3 | ABC transporter A family member 11 | 1.36e-05 | NA | 1.24e-08 | NA |
7. B | Q7DM58 | ABC transporter C family member 4 | 3.36e-11 | NA | 6.81e-24 | NA |
7. B | A1A9L0 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.26e-08 | NA | 1.19e-12 | NA |
7. B | Q5FMM1 | Phosphonates import ATP-binding protein PhnC | 1.12e-11 | NA | 6.60e-12 | NA |
7. B | Q9LK62 | ABC transporter C family member 7 | 8.63e-11 | NA | 1.47e-26 | NA |
7. B | O06980 | Uncharacterized ABC transporter ATP-binding protein YvcR | 2.16e-10 | NA | 1.47e-13 | NA |
7. B | Q96J66 | ATP-binding cassette sub-family C member 11 | 1.11e-16 | NA | 2.93e-29 | NA |
7. B | Q3K198 | Phosphate import ATP-binding protein PstB 2 | 2.38e-12 | NA | 1.73e-17 | NA |
7. B | P63377 | Phosphate import ATP-binding protein PstB 1 | 5.76e-12 | NA | 2.82e-09 | NA |
7. B | Q3JGG7 | Macrolide export ATP-binding/permease protein MacB | 4.62e-02 | NA | 2.83e-07 | NA |
7. B | Q7UU57 | Ribose import ATP-binding protein RbsA | 6.34e-04 | NA | 1.29e-05 | NA |
7. B | Q1CMQ3 | Thiamine import ATP-binding protein ThiQ | 2.33e-11 | NA | 1.19e-09 | NA |
7. B | Q9M2V6 | ABC transporter G family member 17 | 1.39e-02 | NA | 0.002 | NA |
7. B | P31060 | ABC transporter ATP-binding protein ModF | 1.32e-04 | NA | 6.07e-04 | NA |
7. B | Q63563 | ATP-binding cassette sub-family C member 9 | 2.97e-11 | NA | 1.57e-20 | NA |
7. B | Q8Z8R5 | Methionine import ATP-binding protein MetN 2 | 5.89e-11 | NA | 3.37e-12 | NA |
7. B | Q9K7C3 | L-arabinose transport ATP-binding protein AraG | 6.63e-04 | NA | 6.20e-07 | NA |
7. B | Q7CFR2 | Xylose import ATP-binding protein XylG | 4.50e-04 | NA | 0.005 | NA |
7. B | Q9KHT9 | Carnitine transport ATP-binding protein OpuCA | 8.59e-11 | NA | 3.66e-14 | NA |
7. B | Q1GL85 | Zinc import ATP-binding protein ZnuC | 2.60e-10 | NA | 4.54e-08 | NA |
7. B | Q7N3S7 | Hemin import ATP-binding protein HmuV | 1.00e-09 | NA | 3.87e-06 | NA |
7. B | A3DDF6 | Spermidine/putrescine import ATP-binding protein PotA | 1.60e-09 | NA | 5.58e-12 | NA |
7. B | Q8D3Z9 | Putative ABC transporter ATP-binding protein VV2_1533 | 6.00e-06 | NA | 1.34e-12 | NA |
7. B | Q81LM1 | Petrobactin import ATP-binding protein FpuC | 9.71e-10 | NA | 5.12e-06 | NA |
7. B | Q3AXX4 | Phosphate import ATP-binding protein PstB | 4.42e-12 | NA | 4.08e-13 | NA |
7. B | P75355 | Putative ABC transporter ATP-binding protein MG304 homolog | 2.78e-09 | NA | 1.57e-07 | NA |
7. B | Q4QP85 | Fe(3+) ions import ATP-binding protein FbpC | 6.36e-09 | NA | 1.64e-17 | NA |
7. B | Q604C1 | Lipoprotein-releasing system ATP-binding protein LolD | 7.66e-11 | NA | 2.48e-06 | NA |
7. B | O66911 | UvrABC system protein A | 6.32e-02 | NA | 2.92e-05 | NA |
7. B | A0PXX7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 6.88e-11 | NA | 1.45e-14 | NA |
7. B | P0A9W4 | Energy-dependent translational throttle protein EttA | 3.04e-04 | NA | 7.19e-06 | NA |
7. B | Q44613 | Lipoprotein-releasing system ATP-binding protein LolD | 3.55e-11 | NA | 1.94e-08 | NA |
7. B | Q5X627 | Spermidine/putrescine import ATP-binding protein PotA | 8.73e-10 | NA | 3.44e-15 | NA |
7. B | Q0WJP9 | Autoinducer 2 import ATP-binding protein LsrA | 6.31e-04 | NA | 7.59e-05 | NA |
7. B | Q8TTN2 | Putative ABC transporter ATP-binding protein MA_0394 | 6.52e-10 | NA | 7.13e-13 | NA |
7. B | Q67JX3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.30e-08 | NA | 3.71e-12 | NA |
7. B | Q8FVN0 | Nickel import ATP-binding protein NikE | 3.47e-11 | NA | 2.04e-11 | NA |
7. B | P76027 | Oligopeptide transport ATP-binding protein OppD | 1.10e-09 | NA | 2.70e-08 | NA |
7. B | Q13ZK7 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 7.24e-06 | NA | 8.79e-11 | NA |
7. B | Q28VL7 | Thiamine import ATP-binding protein ThiQ | 7.71e-12 | NA | 3.50e-08 | NA |
7. B | Q1GHE5 | Ribose import ATP-binding protein RbsA | 9.55e-04 | NA | 0.010 | NA |
7. B | Q7MFH3 | Putative ABC transporter ATP-binding protein VVA0347 | 4.35e-05 | NA | 1.50e-12 | NA |
7. B | Q1GC08 | Phosphonates import ATP-binding protein PhnC | 1.00e-11 | NA | 1.31e-09 | NA |
7. B | Q9Z651 | Cytochrome c biogenesis ATP-binding export protein CcmA | 9.55e-11 | NA | 2.79e-10 | NA |
7. B | Q1BT84 | Taurine import ATP-binding protein TauB | 8.62e-08 | NA | 2.58e-10 | NA |
7. B | Q9VSS1 | Protein Pixie | 3.19e-03 | NA | 0.004 | NA |
7. B | P9WQM1 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.48e-09 | NA | 2.64e-11 | NA |
7. B | Q9CIS8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.04e-08 | NA | 2.35e-14 | NA |
7. B | Q8ZX91 | Phosphate import ATP-binding protein PstB | 4.45e-13 | NA | 1.66e-10 | NA |
7. B | Q9SGY1 | ABC transporter B family member 10 | 0.00e+00 | NA | 1.06e-64 | NA |
7. B | Q5M4F2 | Phosphate import ATP-binding protein PstB 2 | 3.05e-12 | NA | 2.71e-10 | NA |
7. B | Q8XNY7 | Putative ABC transporter ATP-binding protein CPE0195 | 3.64e-09 | NA | 1.41e-08 | NA |
7. B | Q87R20 | Lipoprotein-releasing system ATP-binding protein LolD | 1.70e-09 | NA | 4.42e-07 | NA |
7. B | Q9M9E1 | ABC transporter G family member 40 | 1.69e-03 | NA | 3.47e-05 | NA |
7. B | Q9Z810 | Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563 | 1.65e-08 | NA | 1.46e-04 | NA |
7. B | Q81V82 | Petrobactin import ATP-binding protein FpuD | 8.62e-11 | NA | 6.46e-13 | NA |
7. B | Q5HVG3 | Macrolide export ATP-binding/permease protein MacB | 4.14e-02 | NA | 1.72e-08 | NA |
7. B | Q13W55 | Phosphate import ATP-binding protein PstB | 3.67e-12 | NA | 2.64e-18 | NA |
7. B | Q02R79 | Spermidine/putrescine import ATP-binding protein PotA | 1.24e-09 | NA | 6.21e-11 | NA |
7. B | Q4ZQE3 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.10e-06 | NA | 1.84e-04 | NA |
7. B | Q8XZX8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.64e-10 | NA | 2.15e-10 | NA |
7. B | Q07PZ0 | Phosphonates import ATP-binding protein PhnC 1 | 5.65e-10 | NA | 1.15e-09 | NA |
7. B | B9G5Y5 | ABC transporter G family member 25 | 1.92e-04 | NA | 3.42e-06 | NA |
7. B | Q0TUN8 | Energy-coupling factor transporter ATP-binding protein EcfA3 | 3.42e-09 | NA | 3.37e-08 | NA |
7. B | O69051 | Phosphite import ATP-binding protein PxtA | 5.20e-10 | NA | 2.43e-07 | NA |
7. B | Q6LR20 | Spermidine/putrescine import ATP-binding protein PotA | 2.46e-09 | NA | 1.44e-15 | NA |
7. B | Q665B6 | Aliphatic sulfonates import ATP-binding protein SsuB | 9.60e-08 | NA | 1.38e-10 | NA |
7. B | Q4QN44 | Ribose import ATP-binding protein RbsA | 6.58e-04 | NA | 6.09e-05 | NA |
7. B | Q6N7Y6 | Hemin import ATP-binding protein HmuV | 6.24e-10 | NA | 2.78e-04 | NA |
7. B | Q71X09 | Methionine import ATP-binding protein MetN 2 | 1.45e-11 | NA | 4.23e-12 | NA |
7. B | Q8CRI7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.93e-08 | NA | 3.53e-12 | NA |
7. B | P44513 | Fe(3+) ions import ATP-binding protein FbpC 2 | 2.92e-09 | NA | 5.23e-18 | NA |
7. B | Q8X5N2 | Hemin import ATP-binding protein HmuV | 1.42e-09 | NA | 3.20e-05 | NA |
7. B | Q5FL41 | Spermidine/putrescine import ATP-binding protein PotA | 2.37e-10 | NA | 2.82e-15 | NA |
7. B | Q3E9B8 | ABC transporter G family member 23 | 4.96e-02 | NA | 1.78e-07 | NA |
7. B | Q88ZJ6 | Spermidine/putrescine import ATP-binding protein PotA | 1.45e-09 | NA | 1.08e-15 | NA |
7. B | P0CI33 | Methionine import ATP-binding protein MetN | 1.72e-10 | NA | 4.18e-17 | NA |
7. B | Q8X6U5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.94e-10 | NA | 9.08e-08 | NA |
7. B | Q21BF6 | Molybdenum import ATP-binding protein ModC | 2.50e-07 | NA | 3.65e-07 | NA |
7. B | A5F1V0 | Vitamin B12 import ATP-binding protein BtuD | 1.41e-08 | NA | 5.68e-06 | NA |
7. B | Q87UN4 | Methionine import ATP-binding protein MetN 2 | 1.69e-11 | NA | 4.14e-15 | NA |
7. B | D4GP38 | Xylose/arabinose import ATP-binding protein XacJ | 1.17e-10 | NA | 4.19e-10 | NA |
7. B | A0K739 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 8.66e-06 | NA | 1.11e-09 | NA |
7. B | Q1MCN6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 | 9.69e-11 | NA | 2.75e-08 | NA |
7. B | Q8G195 | Lipoprotein-releasing system ATP-binding protein LolD | 9.28e-11 | NA | 2.59e-06 | NA |
7. B | Q4ZZS2 | Zinc import ATP-binding protein ZnuC | 1.42e-09 | NA | 9.21e-06 | NA |
7. B | Q8T683 | ABC transporter G family member 9 | 7.99e-03 | NA | 3.42e-05 | NA |
7. B | Q8Y0X3 | Methionine import ATP-binding protein MetN | 1.46e-10 | NA | 3.33e-13 | NA |
7. B | Q8D7T7 | Ribose import ATP-binding protein RbsA | 8.94e-04 | NA | 0.001 | NA |
7. B | Q4A9E1 | Spermidine/putrescine import ATP-binding protein PotA | 1.62e-04 | NA | 4.38e-05 | NA |
7. B | P16521 | Elongation factor 3A | 7.29e-04 | NA | 1.60e-05 | NA |
7. B | Q65TH4 | Macrolide export ATP-binding/permease protein MacB | 6.01e-02 | NA | 1.51e-07 | NA |
7. B | Q48CA0 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 9.91e-08 | NA | 4.72e-10 | NA |
7. B | Q3ATY5 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 1.21e-10 | NA | 2.21e-09 | NA |
7. B | P0A9T9 | Uncharacterized ABC transporter ATP-binding protein YbbA | 8.82e-11 | NA | 3.10e-12 | NA |
7. B | P74548 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.32e-09 | NA | 1.56e-15 | NA |
7. B | Q9FJH6 | ABC transporter F family member 1 | 8.69e-03 | NA | 2.12e-06 | NA |
7. B | Q0ASQ1 | Phosphonates import ATP-binding protein PhnC | 7.22e-10 | NA | 4.92e-05 | NA |
7. B | Q98DW6 | Taurine import ATP-binding protein TauB | 2.76e-08 | NA | 1.82e-05 | NA |
7. B | Q160Y9 | Zinc import ATP-binding protein ZnuC | 4.54e-10 | NA | 7.21e-10 | NA |
7. B | Q02QE8 | Phosphonates import ATP-binding protein PhnC 2 | 1.76e-11 | NA | 6.18e-07 | NA |
7. B | Q65E55 | Ribose import ATP-binding protein RbsA | 5.10e-04 | NA | 8.16e-06 | NA |
7. B | Q9CNP9 | Thiamine import ATP-binding protein ThiQ | 2.40e-10 | NA | 1.48e-09 | NA |
7. B | Q8UB29 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 | 4.02e-11 | NA | 2.33e-09 | NA |
7. B | Q7NTN6 | Ribose import ATP-binding protein RbsA | 8.15e-04 | NA | 4.96e-05 | NA |
7. B | Q8U4L3 | Putative ABC transporter ATP-binding protein PF0068 | 1.34e-11 | NA | 1.74e-15 | NA |
7. B | Q7ME63 | Molybdenum import ATP-binding protein ModC | 1.93e-08 | NA | 1.43e-10 | NA |
7. B | Q5P6D5 | Macrolide export ATP-binding/permease protein MacB | 2.87e-06 | NA | 7.30e-07 | NA |
7. B | Q8DMX9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.97e-09 | NA | 2.98e-11 | NA |
7. B | O51587 | Spermidine/putrescine import ATP-binding protein PotA | 8.25e-10 | NA | 5.60e-13 | NA |
7. B | Q4JXC5 | Phosphate import ATP-binding protein PstB | 2.43e-11 | NA | 1.49e-04 | NA |
7. B | Q8UIW7 | Phosphonates import ATP-binding protein PhnC | 3.93e-11 | NA | 2.06e-11 | NA |
7. B | Q2RWA3 | Methionine import ATP-binding protein MetN | 1.24e-10 | NA | 2.21e-13 | NA |
7. B | Q3YVL7 | Phosphate import ATP-binding protein PstB | 2.44e-11 | NA | 5.39e-19 | NA |
7. B | Q8FB37 | Maltose/maltodextrin import ATP-binding protein MalK | 4.17e-11 | NA | 5.05e-12 | NA |
7. B | Q8PC11 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.04e-09 | NA | 1.35e-08 | NA |
7. B | A1AGY1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.04e-10 | NA | 5.11e-06 | NA |
7. B | Q1R528 | Xylose import ATP-binding protein XylG | 7.59e-04 | NA | 0.002 | NA |
7. B | P18766 | Oligopeptide transport ATP-binding protein AmiF | 6.20e-11 | NA | 2.50e-14 | NA |
7. B | Q89KN0 | Lipoprotein-releasing system ATP-binding protein LolD | 8.12e-11 | NA | 6.09e-07 | NA |
7. B | Q4FMG5 | Taurine import ATP-binding protein TauB | 3.92e-10 | NA | 3.24e-13 | NA |
7. B | Q3KF57 | Macrolide export ATP-binding/permease protein MacB 1 | 1.40e-05 | NA | 8.51e-12 | NA |
7. B | Q3Z3I7 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.38e-08 | NA | 9.95e-12 | NA |
7. B | Q54DT1 | ABC transporter A family member 9 | 5.97e-07 | NA | 2.84e-06 | NA |
7. B | Q13U53 | Arabinose import ATP-binding protein AraG | 1.17e-03 | NA | 7.18e-05 | NA |
7. B | Q8CTB2 | Methionine import ATP-binding protein MetN 1 | 1.56e-11 | NA | 1.25e-13 | NA |
7. B | Q48TC2 | Phosphate import ATP-binding protein PstB 2 | 6.38e-11 | NA | 5.44e-18 | NA |
7. B | Q5L5Z1 | Methionine import ATP-binding protein MetN | 6.52e-11 | NA | 5.45e-12 | NA |
7. B | Q21XJ9 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.55e-08 | NA | 3.54e-13 | NA |
7. B | Q555Z5 | ABC transporter A family member 4 | 1.08e-04 | NA | 1.31e-08 | NA |
7. B | Q0TKS1 | Taurine import ATP-binding protein TauB | 4.48e-08 | NA | 2.28e-09 | NA |
7. B | Q0I4A9 | Zinc import ATP-binding protein ZnuC | 1.83e-10 | NA | 3.32e-06 | NA |
7. B | Q7MKU3 | Spermidine/putrescine import ATP-binding protein PotA | 6.48e-07 | NA | 1.03e-17 | NA |
7. B | Q7MNI7 | Phosphate import ATP-binding protein PstB 1 | 2.86e-11 | NA | 3.06e-16 | NA |
7. B | Q8Z4V6 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.27e-09 | NA | 4.82e-10 | NA |
7. B | Q5HCL3 | Putative ABC transporter ATP-binding protein SACOL2708 | 8.19e-05 | NA | 8.75e-10 | NA |
7. B | C0SP98 | Putative oligopeptide transport ATP-binding protein YkfD | 7.90e-11 | NA | 1.85e-14 | NA |
7. B | P30750 | Methionine import ATP-binding protein MetN | 1.35e-11 | NA | 2.37e-14 | NA |
7. B | Q88CL2 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.32e-10 | NA | 3.42e-13 | NA |
7. B | Q1BY14 | Methionine import ATP-binding protein MetN 1 | 2.52e-08 | NA | 5.87e-13 | NA |
7. B | Q32I01 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.05e-10 | NA | 3.43e-07 | NA |
7. B | Q3JNY2 | Phosphonates import ATP-binding protein PhnC | 8.75e-10 | NA | 0.013 | NA |
7. B | Q579Z3 | Molybdenum import ATP-binding protein ModC | 1.48e-07 | NA | 1.49e-05 | NA |
7. B | P95487 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.47e-09 | NA | 3.41e-07 | NA |
7. B | Q1CA99 | Macrolide export ATP-binding/permease protein MacB 1 | 2.68e-02 | NA | 5.34e-10 | NA |
7. B | Q3B276 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 3.66e-11 | NA | 6.75e-08 | NA |
7. B | Q03EE4 | Energy-coupling factor transporter ATP-binding protein EcfA | 6.45e-10 | NA | 3.19e-15 | NA |
7. B | Q1MA70 | Molybdenum import ATP-binding protein ModC | 1.90e-07 | NA | 1.18e-10 | NA |
7. B | Q0RKH4 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 4.13e-08 | NA | 1.37e-09 | NA |
7. B | Q8DUF7 | Spermidine/putrescine import ATP-binding protein PotA | 2.15e-09 | NA | 5.37e-15 | NA |
7. B | Q2NSZ1 | Macrolide export ATP-binding/permease protein MacB | 3.63e-02 | NA | 3.30e-11 | NA |
7. B | Q1GB17 | Spermidine/putrescine import ATP-binding protein PotA | 4.41e-10 | NA | 9.36e-14 | NA |
7. B | Q92WJ0 | Fe(3+) ions import ATP-binding protein FbpC 1 | 1.15e-09 | NA | 5.52e-15 | NA |
7. B | Q3KDI1 | Phosphonates import ATP-binding protein PhnC | 5.08e-10 | NA | 7.43e-07 | NA |
7. B | Q9SW08 | ABC transporter G family member 4 | 4.00e-02 | NA | 2.03e-09 | NA |
7. B | Q4L885 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.13e-10 | NA | 3.21e-14 | NA |
7. B | A1B9H9 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 4.84e-08 | NA | 3.48e-09 | NA |
7. B | O85818 | Spermidine/putrescine import ATP-binding protein PotA | 5.46e-09 | NA | 5.38e-17 | NA |
7. B | Q5D1Z7 | Cystic fibrosis transmembrane conductance regulator | 1.76e-11 | NA | 4.64e-19 | NA |
7. B | Q0HYN8 | Molybdenum import ATP-binding protein ModC | 4.24e-09 | NA | 1.32e-10 | NA |
7. B | Q89UD2 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.51e-10 | NA | 1.14e-15 | NA |
7. B | Q3J1N0 | Methionine import ATP-binding protein MetN | 2.32e-10 | NA | 2.06e-11 | NA |
7. B | O34677 | Glutamine transport ATP-binding protein GlnQ | 8.70e-14 | NA | 8.06e-14 | NA |
7. B | Q722B1 | Spermidine/putrescine import ATP-binding protein PotA | 1.92e-09 | NA | 7.07e-15 | NA |
7. B | Q6G0L7 | Phosphate import ATP-binding protein PstB | 5.13e-13 | NA | 1.36e-16 | NA |
7. B | Q48KB2 | Macrolide export ATP-binding/permease protein MacB | 7.84e-02 | NA | 3.64e-10 | NA |
7. B | Q9SIT6 | ABC transporter G family member 5 | 1.95e-02 | NA | 4.60e-06 | NA |
7. B | Q2YJE7 | Xylose import ATP-binding protein XylG | 1.04e-03 | NA | 0.016 | NA |
7. B | Q88YN5 | Phosphonates import ATP-binding protein PhnC | 6.79e-11 | NA | 1.76e-06 | NA |
7. B | P0A2V4 | Oligopeptide transport ATP-binding protein OppF | 2.98e-10 | NA | 2.92e-13 | NA |
7. B | Q730R7 | Phosphate import ATP-binding protein PstB | 6.28e-13 | NA | 3.00e-14 | NA |
7. B | D5ARH0 | Biotin transport ATP-binding protein BioM | 1.46e-09 | NA | 0.003 | NA |
7. B | P9WQK0 | Uncharacterized ABC transporter ATP-binding protein MT1014 | 6.19e-11 | NA | 3.25e-08 | NA |
7. B | P0AAF9 | Arginine transport ATP-binding protein ArtP | 2.76e-12 | NA | 9.44e-07 | NA |
7. B | Q6F0P3 | Phosphonates import ATP-binding protein PhnC | 3.05e-11 | NA | 7.20e-10 | NA |
7. B | P57032 | Lipoprotein-releasing system ATP-binding protein LolD | 1.23e-10 | NA | 2.84e-06 | NA |
7. B | Q0AUL1 | Energy-coupling factor transporter ATP-binding protein EcfA | 1.07e-08 | NA | 9.67e-08 | NA |
7. B | Q49WM4 | Spermidine/putrescine import ATP-binding protein PotA | 1.25e-09 | NA | 7.25e-14 | NA |
7. B | Q32IZ6 | Taurine import ATP-binding protein TauB | 4.13e-08 | NA | 8.24e-09 | NA |
7. B | Q0SBZ1 | Fe(3+) ions import ATP-binding protein FbpC 1 | 2.35e-09 | NA | 3.05e-16 | NA |
7. B | Q5ZUG5 | Methionine import ATP-binding protein MetN | 8.89e-12 | NA | 2.24e-15 | NA |
7. B | P0A9U2 | Probable multidrug ABC transporter ATP-binding protein YbhF | 2.64e-05 | NA | 2.34e-09 | NA |
7. B | Q8GU86 | ABC transporter G family member 43 | 1.13e-03 | NA | 1.87e-04 | NA |
7. B | P57013 | Capsule polysaccharide export ATP-binding protein CtrD | 8.42e-08 | NA | 1.73e-05 | NA |
7. B | O14134 | mRNA export factor elf1 | 8.27e-04 | NA | 4.43e-05 | NA |
7. B | P56344 | Probable sulfate/thiosulfate import ATP-binding protein CysA | 1.04e-11 | NA | 5.80e-14 | NA |
7. B | Q2RGX2 | Xylose import ATP-binding protein XylG | 7.48e-04 | NA | 1.76e-07 | NA |
7. B | Q82MV1 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.54e-04 | NA | 7.94e-08 | NA |
7. B | Q5P1F3 | Phosphate import ATP-binding protein PstB | 1.13e-10 | NA | 2.11e-16 | NA |
7. B | Q7MPC5 | Thiamine import ATP-binding protein ThiQ | 1.13e-11 | NA | 2.94e-14 | NA |
7. B | Q9LV93 | ABC transporter F family member 5 | 4.27e-05 | NA | 4.05e-09 | NA |
7. B | Q2P3U8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.35e-08 | NA | 0.005 | NA |
7. B | Q87UN0 | Zinc import ATP-binding protein ZnuC | 1.18e-09 | NA | 5.42e-06 | NA |
7. B | P23878 | Ferric enterobactin transport ATP-binding protein FepC | 3.79e-10 | NA | 1.67e-05 | NA |
7. B | A0QFE1 | Aliphatic sulfonates import ATP-binding protein SsuB | 5.55e-06 | NA | 1.26e-05 | NA |
7. B | Q2FER7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.35e-11 | NA | 1.13e-16 | NA |
7. B | P63362 | Phosphate import ATP-binding protein PstB | 3.19e-10 | NA | 9.85e-16 | NA |
7. B | Q664X5 | Maltose/maltodextrin import ATP-binding protein MalK | 2.22e-11 | NA | 2.46e-15 | NA |
7. B | Q87GB5 | Maltose/maltodextrin import ATP-binding protein MalK | 9.94e-11 | NA | 3.81e-14 | NA |
7. B | Q5PKW4 | Phosphate import ATP-binding protein PstB | 2.55e-11 | NA | 3.79e-19 | NA |
7. B | Q0SK28 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 2.60e-07 | NA | 1.60e-11 | NA |
7. B | Q62K56 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.03e-05 | NA | 4.76e-10 | NA |
7. B | Q6DB87 | Ribose import ATP-binding protein RbsA | 1.04e-03 | NA | 4.05e-06 | NA |
7. B | Q2T4S8 | Arabinose import ATP-binding protein AraG 2 | 9.71e-04 | NA | 5.45e-05 | NA |
7. B | Q5E4V6 | Ribose import ATP-binding protein RbsA | 8.63e-04 | NA | 5.32e-04 | NA |
7. B | Q1LPJ9 | Lipoprotein-releasing system ATP-binding protein LolD | 2.12e-07 | NA | 0.001 | NA |
7. B | P33982 | Probable ABC transporter ATP-binding protein AZC_3926 | 2.41e-09 | NA | 3.64e-07 | NA |
7. B | A0A1Y0BRF0 | ABC-type transporter adrC | 1.75e-03 | NA | 4.73e-04 | NA |
7. B | Q8YYE3 | Phosphate import ATP-binding protein PstB 1 | 1.04e-12 | NA | 2.75e-10 | NA |
7. B | Q6MD10 | Lipoprotein-releasing system ATP-binding protein LolD | 4.25e-11 | NA | 9.89e-09 | NA |
7. B | P21439 | Phosphatidylcholine translocator ABCB4 | 0.00e+00 | NA | 1.96e-55 | NA |
7. B | A0A4P8GG95 | ABC transporter eupT | 1.43e-03 | NA | 0.048 | NA |
7. B | Q3K4F5 | Phosphate import ATP-binding protein PstB | 1.36e-08 | NA | 2.17e-14 | NA |
7. B | Q81CT8 | Putative ABC transporter ATP-binding protein BC_2655 | 9.37e-05 | NA | 4.49e-10 | NA |
7. B | Q0TIV6 | Lipoprotein-releasing system ATP-binding protein LolD | 1.50e-10 | NA | 1.96e-08 | NA |
7. B | Q987E7 | Ribose import ATP-binding protein RbsA 2 | 9.00e-04 | NA | 1.11e-05 | NA |
7. B | Q1D382 | Lipoprotein-releasing system ATP-binding protein LolD | 5.47e-11 | NA | 5.89e-10 | NA |
7. B | Q9PF03 | Methionine import ATP-binding protein MetN | 2.74e-11 | NA | 5.65e-15 | NA |
7. B | Q74IV9 | Methionine import ATP-binding protein MetN | 5.81e-10 | NA | 9.03e-17 | NA |
7. B | Q9C8J8 | ABC transporter G family member 13 | 1.32e-02 | NA | 1.11e-05 | NA |
7. B | Q13TV1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.56e-10 | NA | 4.44e-05 | NA |
7. B | P75612 | Putative ABC transporter ATP-binding protein MG065 homolog | 9.16e-08 | NA | 4.39e-07 | NA |
7. B | Q7MN25 | Methionine import ATP-binding protein MetN | 2.02e-11 | NA | 4.52e-15 | NA |
7. B | Q87U31 | Phosphate import ATP-binding protein PstB 2 | 1.57e-08 | NA | 1.49e-11 | NA |
7. B | Q62AW4 | Taurine import ATP-binding protein TauB | 1.13e-07 | NA | 4.33e-06 | NA |
7. B | P58428 | ATP-binding cassette sub-family G member 8 | 3.20e-02 | NA | 2.58e-05 | NA |
7. B | Q2SPI3 | Zinc import ATP-binding protein ZnuC 1 | 4.26e-09 | NA | 1.93e-07 | NA |
7. B | Q4UMZ7 | Lipoprotein-releasing system ATP-binding protein LolD | 1.97e-09 | NA | 3.14e-09 | NA |
7. B | E9RBG1 | ABC multidrug transporter C | 8.98e-04 | NA | 0.004 | NA |
7. B | P05529 | Protein McbF | 4.01e-08 | NA | 0.021 | NA |
7. B | A1JJ55 | Autoinducer 2 import ATP-binding protein LsrA | 2.13e-03 | NA | 2.17e-05 | NA |
7. B | P75552 | Oligopeptide transport ATP-binding protein OppD | 6.13e-04 | NA | 1.12e-05 | NA |
7. B | Q83KR7 | Zinc import ATP-binding protein ZnuC | 3.37e-10 | NA | 1.34e-10 | NA |
7. B | P0AAF6 | Arginine transport ATP-binding protein ArtP | 2.51e-12 | NA | 9.44e-07 | NA |
7. B | Q1WSB9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.20e-08 | NA | 5.22e-16 | NA |
7. B | Q1JEC9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.01e-10 | NA | 1.28e-13 | NA |
7. B | Q2K1C8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 | 7.30e-11 | NA | 6.94e-08 | NA |
7. B | Q31BF6 | Phosphate import ATP-binding protein PstB | 7.54e-12 | NA | 3.85e-14 | NA |
7. B | Q9ZU35 | ABC transporter G family member 7 | 3.83e-02 | NA | 0.007 | NA |
7. B | Q4QLQ1 | Thiamine import ATP-binding protein ThiQ | 2.14e-10 | NA | 6.80e-15 | NA |
7. B | Q8ZKV9 | Ribose import ATP-binding protein RbsA | 7.93e-04 | NA | 4.31e-05 | NA |
7. B | Q7UP21 | Phosphate import ATP-binding protein PstB | 3.47e-12 | NA | 1.25e-13 | NA |
7. B | P0AAG3 | Glutamate/aspartate import ATP-binding protein GltL | 2.28e-13 | NA | 6.88e-06 | NA |
7. B | Q31V51 | Xylose import ATP-binding protein XylG | 6.53e-04 | NA | 0.002 | NA |
7. B | Q5YRD1 | Methionine import ATP-binding protein MetN | 1.39e-11 | NA | 7.38e-15 | NA |
7. B | P0C0E8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.04e-09 | NA | 7.81e-12 | NA |
7. B | Q5X6P7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.21e-09 | NA | 3.06e-05 | NA |
7. B | A3DJK5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.64e-09 | NA | 1.36e-10 | NA |
7. B | Q68VV5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.09e-07 | NA | 0.006 | NA |
7. B | Q166A0 | Phosphate import ATP-binding protein PstB | 9.70e-12 | NA | 6.96e-17 | NA |
7. B | Q2W8B4 | Phosphate import ATP-binding protein PstB 1 | 8.40e-13 | NA | 4.84e-16 | NA |
7. B | Q58129 | Uncharacterized ABC transporter ATP-binding protein MJ0719 | 3.20e-03 | NA | 2.26e-05 | NA |
7. B | Q3IZT1 | Lipoprotein-releasing system ATP-binding protein LolD | 1.67e-10 | NA | 0.001 | NA |
7. B | A3CRB8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.96e-10 | NA | 6.29e-14 | NA |
7. B | A0ALT7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.72e-09 | NA | 3.21e-13 | NA |
7. B | Q9K876 | Sulfate/thiosulfate import ATP-binding protein CysA | 5.26e-10 | NA | 8.33e-11 | NA |
7. B | A0PXX8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.42e-09 | NA | 1.47e-13 | NA |
7. B | F8DT93 | Lipoprotein-releasing system ATP-binding protein LolD | 2.26e-09 | NA | 3.00e-07 | NA |
7. B | Q7N8B9 | Fe(3+) ions import ATP-binding protein FbpC | 3.66e-10 | NA | 5.59e-13 | NA |
7. B | P25885 | Uncharacterized ABC transporter ATP-binding protein R00382 | 9.04e-08 | NA | 9.22e-12 | NA |
7. B | Q2YKZ7 | Putative ATP-binding protein BAB2_0493 | 6.62e-11 | NA | 1.14e-08 | NA |
7. B | Q8ELA5 | Methionine import ATP-binding protein MetN 4 | 7.04e-11 | NA | 1.70e-13 | NA |
7. B | Q3J7S3 | Lipoprotein-releasing system ATP-binding protein LolD | 3.37e-10 | NA | 5.54e-04 | NA |
7. B | Q8T686 | ABC transporter G family member 7 | 1.04e-01 | NA | 1.15e-06 | NA |
7. B | Q49W48 | Methionine import ATP-binding protein MetN | 2.37e-11 | NA | 2.78e-13 | NA |
7. B | Q8ENJ6 | UvrABC system protein A | 1.32e-01 | NA | 0.045 | NA |
7. B | Q9KRT4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 9.87e-11 | NA | 5.20e-11 | NA |
7. B | A0A0H2ZGN6 | Di/tripeptide transport ATP-binding protein DppD | 5.84e-10 | NA | 6.82e-06 | NA |
7. B | Q9MAG3 | ABC transporter G family member 24 | 2.27e-02 | NA | 2.91e-04 | NA |
7. B | Q1J449 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.93e-09 | NA | 7.60e-12 | NA |
7. B | Q93SH7 | Hemin import ATP-binding protein HmuV | 8.42e-10 | NA | 3.89e-05 | NA |
7. B | H6WS94 | Pleiotropic drug resistance protein 1 | 8.85e-04 | NA | 0.001 | NA |
7. B | Q8PAG0 | Phosphate import ATP-binding protein PstB | 1.38e-12 | NA | 3.95e-16 | NA |
7. B | Q080S4 | Lipoprotein-releasing system ATP-binding protein LolD | 5.39e-10 | NA | 3.37e-10 | NA |
7. B | Q81J15 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.81e-09 | NA | 1.32e-10 | NA |
7. B | P53049 | Oligomycin resistance ATP-dependent permease YOR1 | 8.88e-16 | NA | 2.95e-29 | NA |
7. B | Q7TMS5 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 2.62e-02 | NA | 2.57e-09 | NA |
7. B | Q7U0Z9 | Phosphate import ATP-binding protein PstB 2 | 4.13e-13 | NA | 2.23e-11 | NA |
7. B | Q31Z24 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.22e-10 | NA | 5.83e-05 | NA |
7. B | Q2K9R2 | Lipoprotein-releasing system ATP-binding protein LolD | 1.22e-10 | NA | 4.08e-04 | NA |
7. B | P41233 | Phospholipid-transporting ATPase ABCA1 | 1.30e-02 | NA | 6.25e-06 | NA |
7. B | Q1AVD3 | Ribose import ATP-binding protein RbsA 2 | 7.68e-04 | NA | 8.00e-05 | NA |
7. B | Q609Q1 | Sulfate/thiosulfate import ATP-binding protein CysA | 8.18e-10 | NA | 3.76e-10 | NA |
7. B | Q46TK4 | Phosphonates import ATP-binding protein PhnC | 7.18e-10 | NA | 1.57e-06 | NA |
7. B | Q57HW1 | Ribose import ATP-binding protein RbsA | 7.50e-04 | NA | 4.46e-05 | NA |
7. B | Q9LID6 | ABC transporter E family member 1 | 4.69e-03 | NA | 0.003 | NA |
7. B | Q8RLB6 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.03e-07 | NA | 3.31e-11 | NA |
7. B | P45022 | Probable amino-acid ABC transporter ATP-binding protein HI_1078 | 4.23e-11 | NA | 4.16e-08 | NA |
7. B | Q8FWP2 | Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 | 2.27e-10 | NA | 8.55e-15 | NA |
7. B | Q9H172 | ATP-binding cassette sub-family G member 4 | 4.15e-02 | NA | 2.08e-07 | NA |
7. B | Q4ZZR8 | Methionine import ATP-binding protein MetN 1 | 1.58e-11 | NA | 1.29e-14 | NA |
7. B | Q7N6Z2 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.23e-09 | NA | 8.45e-12 | NA |
7. B | Q6YRJ4 | Putative ABC transporter ATP-binding protein PAM_020 | 9.02e-05 | NA | 1.36e-15 | NA |
7. B | D0MYB4 | Elongation factor 3 | 1.21e-03 | NA | 0.002 | NA |
7. B | P9WQK5 | Uncharacterized ABC transporter ATP-binding protein Rv0073 | 2.74e-09 | NA | 1.17e-06 | NA |
7. B | Q2IN45 | Phosphonates import ATP-binding protein PhnC | 4.50e-06 | NA | 1.34e-08 | NA |
7. B | D4GPW3 | Glucose import ATP-binding protein TsgD13 | 9.70e-04 | NA | 1.23e-04 | NA |
7. B | Q54LE6 | ABC transporter C family member 5 | 3.11e-15 | NA | 1.11e-18 | NA |
7. B | Q98G42 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.04e-10 | NA | 3.09e-06 | NA |
7. B | Q5QXD0 | Hemin import ATP-binding protein HmuV | 8.38e-10 | NA | 2.46e-08 | NA |
7. B | Q221H2 | Phosphate import ATP-binding protein PstB | 3.85e-11 | NA | 4.85e-16 | NA |
7. B | Q8KZQ6 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.15e-08 | NA | 4.42e-11 | NA |
7. B | Q5X2Z8 | Lipoprotein-releasing system ATP-binding protein LolD | 3.87e-11 | NA | 1.27e-06 | NA |
7. B | Q8XAW7 | Ribose import ATP-binding protein RbsA 1 | 7.19e-04 | NA | 1.81e-06 | NA |
7. B | Q8E7N9 | Ribose import ATP-binding protein RbsA | 9.96e-04 | NA | 6.75e-04 | NA |
7. B | Q6AMR9 | Lipoprotein-releasing system ATP-binding protein LolD | 2.40e-11 | NA | 2.24e-06 | NA |
7. B | Q5E3S7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 8.16e-10 | NA | 0.004 | NA |
7. B | Q3K3R2 | Ribose import ATP-binding protein RbsA | 1.44e-03 | NA | 7.62e-04 | NA |
7. B | Q49588 | Phosphate import ATP-binding protein PstB | 8.51e-13 | NA | 5.15e-12 | NA |
7. B | Q6LN52 | Methionine import ATP-binding protein MetN | 1.95e-11 | NA | 1.02e-14 | NA |
7. B | Q7A3X3 | Putative hemin import ATP-binding protein HrtA | 7.29e-11 | NA | 6.35e-10 | NA |
7. B | P25256 | Tylosin resistance ATP-binding protein TlrC | 4.00e-06 | NA | 1.82e-04 | NA |
7. B | P75370 | Probable ABC transporter ATP-binding protein p29 | 3.27e-10 | NA | 1.42e-09 | NA |
7. B | Q8Y0C6 | Lipoprotein-releasing system ATP-binding protein LolD | 1.88e-07 | NA | 3.82e-04 | NA |
7. B | Q18KE1 | Phosphonates import ATP-binding protein PhnC 1 | 1.45e-09 | NA | 1.59e-07 | NA |
7. B | P45321 | Molybdenum import ATP-binding protein ModC | 5.32e-09 | NA | 4.88e-13 | NA |
7. B | B9G300 | ABC transporter G family member 52 | 7.38e-04 | NA | 1.08e-04 | NA |
7. B | P34158 | Cystic fibrosis transmembrane conductance regulator | 3.08e-11 | NA | 1.45e-20 | NA |
7. B | Q1CDC0 | Xylose import ATP-binding protein XylG | 5.83e-04 | NA | 0.005 | NA |
7. B | Q3Z2L6 | Zinc import ATP-binding protein ZnuC | 2.77e-10 | NA | 8.36e-11 | NA |
7. B | Q9A6Z7 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 9.31e-11 | NA | 8.24e-04 | NA |
7. B | Q5WCI1 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.94e-08 | NA | 3.73e-09 | NA |
7. B | Q8XPK6 | Xylose import ATP-binding protein XylG | 1.20e-03 | NA | 0.024 | NA |
7. B | Q634R8 | Phosphate import ATP-binding protein PstB | 6.88e-13 | NA | 3.00e-14 | NA |
7. B | Q4ZLA7 | Phosphate import ATP-binding protein PstB 2 | 1.63e-08 | NA | 2.94e-15 | NA |
7. B | Q6FK23 | Pleiotropic ABC efflux transporter of multiple drugs CDR1 | 2.05e-03 | NA | 2.40e-05 | NA |
7. B | P9WQL0 | Phosphate import ATP-binding protein PstB 1 | 7.29e-12 | NA | 3.05e-05 | NA |
7. B | Q3SQZ1 | Macrolide export ATP-binding/permease protein MacB | 4.65e-06 | NA | 5.47e-05 | NA |
7. B | Q8Z5W6 | Zinc import ATP-binding protein ZnuC | 2.60e-10 | NA | 7.59e-10 | NA |
7. B | Q58664 | Probable branched-chain amino acid transport ATP-binding protein LivF | 8.31e-11 | NA | 6.39e-08 | NA |
7. B | Q68Y13 | Zinc import ATP-binding protein ZnuC | 7.82e-09 | NA | 2.07e-11 | NA |
7. B | P44808 | Probable ATP-binding protein YheS | 1.84e-04 | NA | 4.04e-04 | NA |
7. B | Q9ZB70 | Putative ABC transporter ATP-binding protein MG468.1 | 4.06e-05 | NA | 2.28e-06 | NA |
7. B | Q2A4V5 | Lipoprotein-releasing system ATP-binding protein LolD | 6.56e-11 | NA | 8.81e-10 | NA |
7. B | Q72Y96 | Methionine import ATP-binding protein MetN 3 | 1.82e-11 | NA | 2.40e-16 | NA |
7. B | Q2SVN0 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.34e-06 | NA | 3.71e-11 | NA |
7. B | Q6P542 | ATP-binding cassette sub-family F member 1 | 1.91e-05 | NA | 0.003 | NA |
7. B | Q8GU88 | ABC transporter G family member 39 | 8.76e-04 | NA | 2.03e-04 | NA |
7. B | P0AAF3 | Arabinose import ATP-binding protein AraG | 7.56e-04 | NA | 6.50e-05 | NA |
7. B | P9WER4 | ABC-type transporter braE | NA | NA | 1.66e-15 | NA |
7. B | P9WQK9 | Phosphate import ATP-binding protein PstB 2 | 2.11e-13 | NA | 2.23e-11 | NA |
7. B | Q7N8V0 | Thiamine import ATP-binding protein ThiQ | 1.17e-11 | NA | 7.27e-09 | NA |
7. B | Q8GU85 | ABC transporter G family member 40 | 8.56e-04 | NA | 1.82e-04 | NA |
7. B | Q64SQ6 | Spermidine/putrescine import ATP-binding protein PotA | 2.46e-08 | NA | 2.38e-11 | NA |
7. B | Q03ZL5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.09e-08 | NA | 9.87e-19 | NA |
7. B | Q8FUR8 | Xylose import ATP-binding protein XylG | 1.72e-03 | NA | 0.032 | NA |
7. B | Q4KC87 | Fe(3+) ions import ATP-binding protein FbpC | 2.41e-09 | NA | 3.09e-14 | NA |
7. B | Q2NRN5 | Methionine import ATP-binding protein MetN | 2.20e-11 | NA | 2.74e-17 | NA |
7. B | Q1LLB5 | Phosphate import ATP-binding protein PstB | 8.55e-12 | NA | 1.58e-15 | NA |
7. B | Q1M8R6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 | 9.47e-11 | NA | 7.50e-08 | NA |
7. B | Q9KS33 | Spermidine/putrescine import ATP-binding protein PotA | 7.89e-07 | NA | 8.82e-18 | NA |
7. B | Q2YQP3 | Putative ABC transporter ATP-binding protein BAB1_1388 | 6.43e-09 | NA | 0.002 | NA |
7. B | Q2YL69 | Nickel import ATP-binding protein NikE | 4.92e-11 | NA | 3.53e-11 | NA |
7. B | Q81IZ6 | Methionine import ATP-binding protein MetN 1 | 4.05e-11 | NA | 2.22e-14 | NA |
7. B | Q03I82 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.40e-09 | NA | 3.62e-15 | NA |
7. B | Q12B04 | Methionine import ATP-binding protein MetN | 2.56e-08 | NA | 2.37e-11 | NA |
7. B | P69878 | Phosphate import ATP-binding protein PstB | 7.37e-13 | NA | 4.89e-15 | NA |
7. B | Q3K9F9 | Lipoprotein-releasing system ATP-binding protein LolD | 3.64e-10 | NA | 7.47e-13 | NA |
7. B | Q8SRV5 | Probable ATP-binding cassette sub-family F member 3 homolog | 1.21e-02 | NA | 0.002 | NA |
7. B | P73450 | Nitrate import ATP-binding protein NrtC | 1.18e-05 | NA | 1.08e-10 | NA |
7. B | Q1BX03 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 1.18e-03 | NA | 2.52e-05 | NA |
7. B | Q6HDP8 | Phosphate import ATP-binding protein PstB | 6.22e-13 | NA | 3.00e-14 | NA |
7. B | O27739 | Energy-coupling factor transporter ATP-binding protein EcfA | 1.73e-08 | NA | 1.80e-10 | NA |
7. B | Q9ZJ34 | Methionine import ATP-binding protein MetN | 2.24e-12 | NA | 4.45e-17 | NA |
7. B | Q6G3A6 | Lipoprotein-releasing system ATP-binding protein LolD | 8.44e-11 | NA | 5.31e-08 | NA |
7. B | Q5WIL7 | Phosphonates import ATP-binding protein PhnC | 2.15e-10 | NA | 2.09e-10 | NA |
7. B | Q92LX3 | Methionine import ATP-binding protein MetN | 7.21e-11 | NA | 2.43e-12 | NA |
7. B | Q2KVK2 | Methionine import ATP-binding protein MetN | 3.19e-08 | NA | 2.24e-12 | NA |
7. B | Q0SQH5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.02e-10 | NA | 6.29e-11 | NA |
7. B | Q4FQ27 | Zinc import ATP-binding protein ZnuC | 1.05e-09 | NA | 7.07e-11 | NA |
7. B | Q5E586 | Spermidine/putrescine import ATP-binding protein PotA | 2.05e-09 | NA | 1.01e-16 | NA |
7. B | Q5PIA5 | Zinc import ATP-binding protein ZnuC | 1.80e-09 | NA | 8.49e-10 | NA |
7. B | Q02SA6 | Taurine import ATP-binding protein TauB | 8.58e-08 | NA | 7.40e-11 | NA |
7. B | Q2RU16 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 8.28e-11 | NA | 6.93e-07 | NA |
7. B | Q91WA9 | ATP-binding cassette subfamily G member 4 | 4.15e-02 | NA | 9.24e-07 | NA |
7. B | Q6GIH9 | Methionine import ATP-binding protein MetN 2 | 3.11e-11 | NA | 2.00e-13 | NA |
7. B | Q9I2N4 | Molybdenum import ATP-binding protein ModC | 6.21e-08 | NA | 4.82e-10 | NA |
7. B | Q2SSS4 | Spermidine/putrescine import ATP-binding protein PotA | 2.06e-09 | NA | 5.49e-14 | NA |
7. B | Q0ASG3 | Phosphate import ATP-binding protein PstB | 2.07e-11 | NA | 1.48e-16 | NA |
7. B | Q0HJG0 | Lipoprotein-releasing system ATP-binding protein LolD | 7.63e-11 | NA | 1.54e-05 | NA |
7. B | Q2J2E9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 8.02e-11 | NA | 3.08e-10 | NA |
7. B | Q5HJM6 | Phosphonates import ATP-binding protein PhnC | 6.42e-11 | NA | 5.18e-12 | NA |
7. B | Q8FKF5 | Taurine import ATP-binding protein TauB | 5.23e-08 | NA | 9.70e-10 | NA |
7. B | Q93YS4 | ABC transporter G family member 22 | 1.27e-01 | NA | 2.16e-07 | NA |
7. B | Q3Z5U5 | Thiamine import ATP-binding protein ThiQ | 8.55e-12 | NA | 5.68e-11 | NA |
7. B | Q73BM0 | Spermidine/putrescine import ATP-binding protein PotA | 9.00e-10 | NA | 1.93e-18 | NA |
7. B | Q5SSE9 | ATP-binding cassette sub-family A member 13 | NA | NA | 2.38e-08 | NA |
7. B | Q9UG63 | ATP-binding cassette sub-family F member 2 | 9.76e-06 | NA | 7.57e-04 | NA |
7. B | Q7CHF8 | Methionine import ATP-binding protein MetN 2 | 1.81e-10 | NA | 9.82e-14 | NA |
7. B | Q2K6L3 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 | 9.26e-11 | NA | 1.17e-07 | NA |
7. B | Q8K449 | ATP-binding cassette sub-family A member 9 | 5.95e-04 | NA | 9.15e-09 | NA |
7. B | Q4GZT4 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 2.01e-02 | NA | 1.96e-09 | NA |
7. B | Q7WP62 | Molybdenum import ATP-binding protein ModC | 1.25e-07 | NA | 1.49e-08 | NA |
7. B | Q1RAN8 | Arabinose import ATP-binding protein AraG | 6.73e-04 | NA | 6.91e-05 | NA |
7. B | A0LUE6 | Spermidine/putrescine import ATP-binding protein PotA | 5.00e-09 | NA | 6.16e-11 | NA |
7. B | A0A0M3R8G1 | ABC transporter G family member STR | 1.82e-02 | NA | 3.08e-07 | NA |
7. B | Q65SW3 | Molybdenum import ATP-binding protein ModC | 5.38e-09 | NA | 2.50e-11 | NA |
7. B | Q2YJJ9 | Putative peptide import ATP-binding protein BAB2_1052 | 2.98e-09 | NA | 2.50e-06 | NA |
7. B | Q8UCD5 | Molybdenum import ATP-binding protein ModC | 3.50e-08 | NA | 1.94e-12 | NA |
7. B | Q6D664 | Lipoprotein-releasing system ATP-binding protein LolD | 3.26e-10 | NA | 1.63e-05 | NA |
7. B | P45275 | Uncharacterized ABC transporter ATP-binding protein HI_1618 | 4.31e-10 | NA | 2.82e-04 | NA |
7. B | Q84K47 | ABC transporter A family member 2 | 7.58e-06 | NA | 2.70e-06 | NA |
7. B | P68188 | Maltose/maltodextrin import ATP-binding protein MalK | 1.29e-10 | NA | 4.70e-12 | NA |
7. B | Q82JY6 | Fe(3+) ions import ATP-binding protein FbpC | 9.34e-10 | NA | 1.90e-06 | NA |
7. B | Q3K0Y6 | Spermidine/putrescine import ATP-binding protein PotA | 1.26e-09 | NA | 1.24e-15 | NA |
7. B | Q9LFG8 | ABC transporter G family member 20 | 3.72e-02 | NA | 0.002 | NA |
7. B | P75264 | Putative ABC transporter ATP-binding protein MG187 homolog | 2.80e-05 | NA | 8.80e-06 | NA |
7. B | Q3KBH4 | Spermidine/putrescine import ATP-binding protein PotA | 3.55e-09 | NA | 9.87e-12 | NA |
7. B | P34712 | Multidrug resistance protein pgp-1 | 1.70e-13 | NA | 2.20e-62 | NA |
7. B | Q2FZZ2 | Methionine import ATP-binding protein MetN 2 | 1.03e-11 | NA | 2.86e-13 | NA |
7. B | P45843 | Protein scarlet | 1.19e-02 | NA | 4.21e-09 | NA |
7. B | Q8RBQ1 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 7.95e-04 | NA | 8.47e-09 | NA |
7. B | Q3IM36 | Phosphate import ATP-binding protein PstB 3 | 1.71e-08 | NA | 2.47e-16 | NA |
7. B | Q2S081 | Phosphate import ATP-binding protein PstB | 8.06e-13 | NA | 1.54e-11 | NA |
7. B | Q8X5I6 | Taurine import ATP-binding protein TauB | 3.89e-08 | NA | 2.69e-09 | NA |
7. B | Q0TMS7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.00e-10 | NA | 4.39e-12 | NA |
7. B | O34392 | ABC transporter ATP-binding protein YtrE | 8.71e-12 | NA | 9.25e-17 | NA |
7. B | Q3SVV2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.60e-08 | NA | 0.016 | NA |
7. B | Q53194 | Probable peptide ABC transporter ATP-binding protein y4tS | 1.52e-10 | NA | 1.29e-16 | NA |
7. B | Q5YZY9 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.07e-09 | NA | 8.24e-07 | NA |
7. B | Q5HLN4 | Putative hemin import ATP-binding protein HrtA | 9.69e-11 | NA | 1.13e-06 | NA |
7. B | Q81IN8 | Methionine import ATP-binding protein MetN 2 | 2.24e-11 | NA | 3.91e-17 | NA |
7. B | Q5E3B8 | Phosphate import ATP-binding protein PstB 2 | 1.80e-11 | NA | 1.61e-19 | NA |
7. B | Q5XDS8 | Methionine import ATP-binding protein MetN | 1.02e-10 | NA | 2.39e-16 | NA |
7. B | P63375 | Phosphate import ATP-binding protein PstB 1 | 1.06e-11 | NA | 2.82e-09 | NA |
7. B | Q66CL2 | Macrolide export ATP-binding/permease protein MacB 1 | 2.59e-02 | NA | 5.34e-10 | NA |
7. B | Q99WE1 | Methionine import ATP-binding protein MetN 1 | 7.00e-12 | NA | 5.64e-17 | NA |
7. B | Q9CMS0 | Molybdenum import ATP-binding protein ModC | 5.30e-09 | NA | 3.10e-12 | NA |
7. B | Q9USH9 | Uncharacterized ABC transporter ATP-binding protein C825.01 | 1.02e-02 | NA | 1.59e-07 | NA |
7. B | P0AAF7 | Arginine transport ATP-binding protein ArtP | 2.42e-12 | NA | 9.44e-07 | NA |
7. B | Q8NUH8 | Putative ABC transporter ATP-binding protein MW2603 | 1.36e-04 | NA | 6.40e-10 | NA |
7. B | Q13IS7 | Taurine import ATP-binding protein TauB 3 | 2.69e-08 | NA | 4.52e-06 | NA |
7. B | Q0I354 | Thiamine import ATP-binding protein ThiQ | 2.64e-10 | NA | 8.54e-11 | NA |
7. B | Q8ZRM9 | Methionine import ATP-binding protein MetN 1 | 2.13e-11 | NA | 9.93e-14 | NA |
7. B | Q5JEP9 | Phosphate import ATP-binding protein PstB | 2.41e-12 | NA | 2.06e-11 | NA |
7. B | O21280 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.61e-09 | NA | 3.41e-07 | NA |
7. B | Q9SKX0 | ABC transporter C family member 13 | 1.70e-13 | NA | 3.52e-25 | NA |
7. B | Q83HT1 | Phosphate import ATP-binding protein PstB | 8.08e-12 | NA | 4.33e-14 | NA |
7. B | P47650 | Phosphate import ATP-binding protein PstB | 4.33e-08 | NA | 6.45e-18 | NA |
7. B | Q4FQD1 | Phosphate import ATP-binding protein PstB | 1.10e-11 | NA | 2.72e-18 | NA |
7. B | P9WQL2 | Molybdenum import ATP-binding protein ModC | 9.06e-09 | NA | 3.65e-09 | NA |
7. B | Q89VF2 | Phosphate import ATP-binding protein PstB | 1.79e-12 | NA | 5.60e-18 | NA |
7. B | Q576K0 | Zinc import ATP-binding protein ZnuC | 7.51e-09 | NA | 2.41e-06 | NA |
7. B | Q54TV1 | ABC transporter G family member 6 | 3.01e-04 | NA | 1.27e-05 | NA |
7. B | Q0I3C2 | Lipoprotein-releasing system ATP-binding protein LolD | 2.32e-10 | NA | 4.03e-08 | NA |
7. B | Q8T6H8 | ABC transporter C family member 1 | 2.22e-16 | NA | 2.54e-28 | NA |
7. B | Q9V1Q4 | Putative ABC transporter ATP-binding protein PYRAB03730 | 3.80e-10 | NA | 7.07e-09 | NA |
7. B | P24136 | Oligopeptide transport ATP-binding protein OppD | 1.31e-09 | NA | 3.93e-10 | NA |
7. B | Q99LE6 | ATP-binding cassette sub-family F member 2 | 4.47e-05 | NA | 8.71e-04 | NA |
7. B | Q9C9W0 | ABC transporter I family member 17 | 2.25e-09 | NA | 4.74e-17 | NA |
7. B | Q5NHP2 | Lipoprotein-releasing system ATP-binding protein LolD | 5.68e-11 | NA | 8.81e-10 | NA |
7. B | Q2RQQ0 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 1.95e-11 | NA | 1.05e-06 | NA |
7. B | Q54CG0 | ABC transporter G family member 10 | 5.82e-03 | NA | 5.47e-04 | NA |
7. B | Q8TIW9 | Putative ABC transporter ATP-binding protein MA_4021 | 6.80e-12 | NA | 1.14e-13 | NA |
7. B | Q24PY8 | Phosphate import ATP-binding protein PstB | 7.20e-13 | NA | 9.86e-17 | NA |
7. B | Q6KIS8 | Phosphate import ATP-binding protein PstB | 1.14e-09 | NA | 1.19e-18 | NA |
7. B | P0A9S7 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 3.68e-10 | NA | 2.30e-07 | NA |
7. B | Q748K0 | Putative ABC transporter ATP-binding protein GSU3001 | 1.70e-08 | NA | 3.04e-07 | NA |
7. B | Q83MA0 | Taurine import ATP-binding protein TauB | 4.69e-08 | NA | 9.61e-07 | NA |
7. B | Q5PGR6 | Lipoprotein-releasing system ATP-binding protein LolD | 1.49e-10 | NA | 3.90e-07 | NA |
7. B | P45844 | ATP-binding cassette sub-family G member 1 | 5.68e-02 | NA | 5.35e-10 | NA |
7. B | Q3BSL0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.04e-08 | NA | 0.006 | NA |
7. B | Q7UC29 | Sulfate/thiosulfate import ATP-binding protein CysA | 9.60e-10 | NA | 6.82e-11 | NA |
7. B | P63354 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.79e-09 | NA | 3.35e-15 | NA |
7. B | Q1B8V9 | Spermidine/putrescine import ATP-binding protein PotA | 6.93e-09 | NA | 7.60e-09 | NA |
7. B | Q7N545 | Zinc import ATP-binding protein ZnuC | 9.55e-08 | NA | 6.75e-13 | NA |
7. B | Q885N4 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.08e-07 | NA | 8.88e-04 | NA |
7. B | P02915 | Histidine transport ATP-binding protein HisP | 2.30e-11 | NA | 1.56e-07 | NA |
7. B | Q0IAC3 | Phosphate import ATP-binding protein PstB | 3.35e-12 | NA | 9.08e-13 | NA |
7. B | P9WQL6 | Fluoroquinolones export ATP-binding protein MT2762 | 1.17e-09 | NA | 3.18e-10 | NA |
7. B | P42065 | Oligopeptide transport ATP-binding protein AppF | 1.33e-09 | NA | 6.24e-16 | NA |
7. B | Q5HM28 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.90e-08 | NA | 3.43e-12 | NA |
7. B | Q9KFL0 | Phosphonates import ATP-binding protein PhnC 2 | 4.25e-11 | NA | 9.03e-09 | NA |
7. B | Q9CIQ6 | Phosphonates import ATP-binding protein PhnC | 7.73e-11 | NA | 6.03e-13 | NA |
7. B | Q9K6J9 | Ribose import ATP-binding protein RbsA | 4.89e-04 | NA | 3.29e-09 | NA |
7. B | Q9FLT8 | ABC transporter A family member 12 | 1.06e-05 | NA | 2.74e-06 | NA |
7. B | Q9V2C0 | Molybdate/tungstate import ATP-binding protein WtpC | 6.10e-10 | NA | 4.41e-09 | NA |
7. B | A1B9K8 | Zinc import ATP-binding protein ZnuC | 1.22e-09 | NA | 1.19e-04 | NA |
7. B | Q8ZQM4 | Glutathione import ATP-binding protein GsiA | 6.15e-05 | NA | 3.03e-10 | NA |
7. B | Q50966 | Fe(3+) ions import ATP-binding protein FbpC | 6.77e-09 | NA | 4.57e-13 | NA |
7. B | Q31I51 | Zinc import ATP-binding protein ZnuC | 1.44e-09 | NA | 3.75e-15 | NA |
7. B | Q6G799 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.60e-11 | NA | 1.20e-16 | NA |
7. B | Q7VI92 | Methionine import ATP-binding protein MetN | 8.62e-12 | NA | 1.99e-20 | NA |
7. B | Q3MH62 | Phosphate import ATP-binding protein PstB 1 | 1.22e-10 | NA | 5.12e-13 | NA |
7. B | Q8X5U1 | Nickel import ATP-binding protein NikD | 1.05e-11 | NA | 6.99e-06 | NA |
7. B | Q5LUD0 | Lipoprotein-releasing system ATP-binding protein LolD | 2.64e-10 | NA | 3.55e-04 | NA |
7. B | A7A063 | ABC transporter NFT1 | 3.97e-12 | NA | 6.54e-27 | NA |
7. B | Q55107 | Bicarbonate transport ATP-binding protein CmpC | 1.32e-05 | NA | 1.73e-06 | NA |
7. B | P78595 | Multidrug resistance protein CDR2 | 2.30e-03 | NA | 8.14e-05 | NA |
7. B | Q0AU85 | Methionine import ATP-binding protein MetN | 1.18e-10 | NA | 1.15e-15 | NA |
7. B | P35116 | Nopaline permease ATP-binding protein P | 1.95e-11 | NA | 1.49e-09 | NA |
7. B | Q74DN5 | Putative ABC transporter ATP-binding protein GSU1281 | 1.47e-11 | NA | 3.76e-17 | NA |
7. B | P45247 | Lipoprotein-releasing system ATP-binding protein LolD | 1.46e-10 | NA | 1.81e-07 | NA |
7. B | Q8D954 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.31e-11 | NA | 1.07e-10 | NA |
7. B | Q2SMN9 | Macrolide export ATP-binding/permease protein MacB | 3.79e-02 | NA | 2.38e-10 | NA |
7. B | Q2YJB5 | Putative ATP-binding protein BAB2_1147 | 1.06e-08 | NA | 1.17e-05 | NA |
7. B | P26946 | Uncharacterized ABC transporter ATP-binding protein BpOF4_11395 | 2.27e-06 | NA | 5.93e-04 | NA |
7. B | P69877 | Spermidine/putrescine import ATP-binding protein PotA | 1.70e-09 | NA | 1.36e-15 | NA |
7. B | Q87UV4 | Methionine import ATP-binding protein MetN 1 | 2.90e-06 | NA | 2.37e-17 | NA |
7. B | Q035E0 | Phosphonates import ATP-binding protein PhnC | 2.22e-08 | NA | 9.66e-11 | NA |
7. B | Q5ZX76 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.52e-09 | NA | 3.06e-05 | NA |
7. B | Q8DIA0 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.37e-10 | NA | 1.85e-11 | NA |
7. B | Q6MMY0 | Lipoprotein-releasing system ATP-binding protein LolD | 2.37e-11 | NA | 2.49e-10 | NA |
7. B | O95477 | Phospholipid-transporting ATPase ABCA1 | 7.58e-03 | NA | 1.09e-05 | NA |
7. B | Q8KDZ5 | Phosphate import ATP-binding protein PstB | 8.41e-08 | NA | 1.12e-12 | NA |
7. B | Q3MB44 | Ribose import ATP-binding protein RbsA | 1.21e-03 | NA | 1.29e-04 | NA |
7. B | Q48V78 | Methionine import ATP-binding protein MetN | 1.00e-10 | NA | 9.89e-16 | NA |
7. B | P0A9W3 | Energy-dependent translational throttle protein EttA | 3.03e-04 | NA | 7.19e-06 | NA |
7. B | P0A2U7 | Zinc transport system ATP-binding protein AdcC | 1.67e-07 | NA | 6.90e-13 | NA |
7. B | Q50863 | O-antigen export system ATP-binding protein RfbB | 7.19e-05 | NA | 1.11e-08 | NA |
7. B | Q54U44 | ABC transporter C family member 12 | 0.00e+00 | NA | 5.30e-24 | NA |
7. B | Q578K3 | Fe(3+) ions import ATP-binding protein FbpC | 3.13e-09 | NA | 3.51e-16 | NA |
7. B | Q1QLB0 | Lipoprotein-releasing system ATP-binding protein LolD | 1.00e-10 | NA | 6.35e-07 | NA |
7. B | P0C2H3 | Macrolide export ATP-binding/permease protein MacB 2 | 9.09e-02 | NA | 2.02e-09 | NA |
7. B | Q1IGY7 | Zinc import ATP-binding protein ZnuC | 2.00e-09 | NA | 5.02e-07 | NA |
7. B | Q62K72 | Nod factor export ATP-binding protein I | 1.65e-09 | NA | 2.34e-11 | NA |
7. B | Q881C1 | Molybdenum import ATP-binding protein ModC | 1.30e-07 | NA | 2.16e-07 | NA |
7. B | Q8H1R4 | ABC transporter I family member 10 | 1.92e-05 | NA | 1.27e-08 | NA |
7. B | Q6XYZ3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.20e-08 | NA | 5.19e-09 | NA |
7. B | Q2K284 | Methionine import ATP-binding protein MetN | 7.32e-10 | NA | 7.02e-06 | NA |
7. B | B1XEA1 | Autoinducer 2 import ATP-binding protein LsrA | 6.23e-04 | NA | 3.60e-06 | NA |
7. B | Q1QYT1 | Arabinose import ATP-binding protein AraG | 1.35e-03 | NA | 0.019 | NA |
7. B | Q9AB70 | Phosphonates import ATP-binding protein PhnC | 1.36e-09 | NA | 1.71e-06 | NA |
7. B | Q5WVL8 | Methionine import ATP-binding protein MetN | 8.32e-12 | NA | 1.92e-15 | NA |
7. B | P63366 | Phosphate import ATP-binding protein PstB | 2.62e-11 | NA | 3.79e-19 | NA |
7. B | Q11JI6 | Lipoprotein-releasing system ATP-binding protein LolD | 1.96e-10 | NA | 0.003 | NA |
7. B | P94411 | Uncharacterized ABC transporter ATP-binding protein YclH | 8.92e-11 | NA | 8.16e-08 | NA |
7. B | Q04HV8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.97e-10 | NA | 4.79e-11 | NA |
7. B | Q6GCY2 | Phosphonates import ATP-binding protein PhnC | 5.62e-11 | NA | 5.18e-12 | NA |
7. B | Q7PC84 | ABC transporter G family member 39 | 9.09e-04 | NA | 1.18e-06 | NA |
7. B | P45046 | Xylose import ATP-binding protein XylG | 6.54e-04 | NA | 6.71e-06 | NA |
7. B | Q8RGC8 | Fe(3+) ions import ATP-binding protein FbpC | 8.75e-10 | NA | 1.12e-11 | NA |
7. B | Q1GBI9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.54e-08 | NA | 3.98e-09 | NA |
7. B | A1U0A9 | Macrolide export ATP-binding/permease protein MacB | 3.76e-06 | NA | 4.25e-07 | NA |
7. B | Q87FK7 | Arabinose import ATP-binding protein AraG | 1.23e-03 | NA | 3.59e-05 | NA |
7. B | Q63R24 | Phosphonates import ATP-binding protein PhnC | 8.21e-10 | NA | 0.013 | NA |
7. B | P0AAH2 | Phosphate import ATP-binding protein PstB | 2.51e-11 | NA | 5.39e-19 | NA |
7. B | Q6VMN4 | Xylose import ATP-binding protein XylG | 6.21e-04 | NA | 3.53e-07 | NA |
7. B | A0KE53 | Xylose import ATP-binding protein XylG | 9.98e-04 | NA | 0.013 | NA |
7. B | Q0S6U9 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.15e-07 | NA | 4.40e-07 | NA |
7. B | Q0BUR6 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.96e-09 | NA | 2.00e-11 | NA |
7. B | Q17320 | Protein white | 3.10e-02 | NA | 5.89e-07 | NA |
7. B | O31716 | Uncharacterized ABC transporter ATP-binding protein YkpA | 2.22e-04 | NA | 9.59e-07 | NA |
7. B | Q2A3Z2 | Methionine import ATP-binding protein MetN | 5.69e-11 | NA | 1.27e-16 | NA |
7. B | P10346 | Glutamine transport ATP-binding protein GlnQ | 2.05e-13 | NA | 2.20e-12 | NA |
7. B | Q65UG3 | Zinc import ATP-binding protein ZnuC | 3.25e-10 | NA | 4.87e-05 | NA |
7. B | Q882S0 | Phosphonates import ATP-binding protein PhnC 2 | 1.65e-09 | NA | 3.17e-04 | NA |
7. B | A1CFM0 | ABC transporter patM | 1.77e-03 | NA | 4.87e-04 | NA |
7. B | Q2G2A7 | Spermidine/putrescine import ATP-binding protein PotA | 1.88e-09 | NA | 2.87e-13 | NA |
7. B | P0A9T8 | Uncharacterized ABC transporter ATP-binding protein YbbA | 2.67e-10 | NA | 3.10e-12 | NA |
7. B | P61482 | Lipoprotein-releasing system ATP-binding protein LolD | 1.95e-10 | NA | 3.90e-07 | NA |
7. B | Q93DA2 | Methionine import ATP-binding protein MetN | 9.22e-11 | NA | 1.61e-15 | NA |
7. B | Q9KSL1 | Vitamin B12 import ATP-binding protein BtuD | 1.34e-08 | NA | 1.84e-06 | NA |
7. B | Q1GUY1 | Phosphate import ATP-binding protein PstB | 1.30e-11 | NA | 2.22e-16 | NA |
7. B | Q57293 | Fe(3+) ions import ATP-binding protein FbpC | 5.09e-10 | NA | 5.59e-14 | NA |
7. B | Q5X9B5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.07e-09 | NA | 7.60e-12 | NA |
7. B | P63363 | Phosphate import ATP-binding protein PstB 1 | 1.09e-12 | NA | 1.54e-13 | NA |
7. B | Q28QL7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.88e-11 | NA | 7.28e-12 | NA |
7. B | Q63TX3 | Nod factor export ATP-binding protein I | 1.74e-09 | NA | 2.24e-11 | NA |
7. B | Q0I2G0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.77e-08 | NA | 5.53e-04 | NA |
7. B | Q2FYQ8 | Nickel import system ATP-binding protein NikE | 7.33e-12 | NA | 1.84e-14 | NA |
7. B | P36947 | Ribose import ATP-binding protein RbsA | 7.28e-04 | NA | 4.85e-08 | NA |
7. B | Q98K15 | Ribose import ATP-binding protein RbsA 1 | 7.51e-04 | NA | 1.22e-05 | NA |
7. B | Q81C68 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.89e-07 | NA | 8.92e-11 | NA |
7. B | Q9HYL7 | Phosphonates import ATP-binding protein PhnC 2 | 2.07e-09 | NA | 0.020 | NA |
7. B | Q134N9 | Methionine import ATP-binding protein MetN | 1.91e-07 | NA | 9.67e-11 | NA |
7. B | Q9KAG5 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 7.34e-04 | NA | 2.23e-06 | NA |
7. B | Q8KF76 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 3.33e-11 | NA | 7.59e-06 | NA |
7. B | Q2RM86 | Phosphate import ATP-binding protein PstB | 2.94e-13 | NA | 2.85e-14 | NA |
7. B | Q9PPV1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.64e-09 | NA | 9.17e-17 | NA |
7. B | Q20ZP0 | Phosphonates import ATP-binding protein PhnC 1 | 3.62e-10 | NA | 4.92e-09 | NA |
7. B | Q66D71 | Molybdenum import ATP-binding protein ModC | 1.45e-08 | NA | 1.13e-12 | NA |
7. B | Q1MIN0 | Phosphate import ATP-binding protein PstB 2 | 5.70e-09 | NA | 1.16e-06 | NA |
7. B | Q6N999 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 2.46e-10 | NA | 1.06e-10 | NA |
7. B | Q82CM5 | Ribose import ATP-binding protein RbsA 1 | 1.26e-03 | NA | 0.042 | NA |
7. B | Q8P2K6 | Methionine import ATP-binding protein MetN | 1.18e-10 | NA | 4.67e-16 | NA |
7. B | Q20ZS6 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 2.85e-10 | NA | 9.26e-08 | NA |
7. B | Q8TIX0 | Putative ABC transporter ATP-binding protein MA_4020 | 5.15e-07 | NA | 1.44e-10 | NA |
7. B | Q3IQI3 | Phosphate import ATP-binding protein PstB 2 | 3.89e-11 | NA | 1.64e-09 | NA |
7. B | O34697 | Bacitracin export ATP-binding protein BceA | 2.65e-08 | NA | 1.95e-10 | NA |
7. B | Q54R52 | ABC transporter A family member 10 | 3.30e-06 | NA | 3.44e-07 | NA |
7. B | Q5HG41 | Nickel import system ATP-binding protein NikE | 5.44e-12 | NA | 1.84e-14 | NA |
7. B | A0ALT6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 4.94e-09 | NA | 3.67e-14 | NA |
7. B | Q5FM18 | Phosphate import ATP-binding protein PstB 1 | 1.20e-08 | NA | 3.43e-12 | NA |
7. B | Q6G4Q8 | Putative ABC transporter ATP-binding protein BH02760 | 4.91e-12 | NA | 1.34e-10 | NA |
7. B | Q9X051 | Ribose import ATP-binding protein RbsA 2 | 9.70e-04 | NA | 0.001 | NA |
7. B | Q1WUX1 | Phosphate import ATP-binding protein PstB 2 | 7.27e-12 | NA | 6.78e-14 | NA |
7. B | P0CZ35 | Spermidine/putrescine import ATP-binding protein PotA | 1.22e-09 | NA | 9.94e-16 | NA |
7. B | Q1IMC7 | Phosphate import ATP-binding protein PstB | 2.12e-11 | NA | 2.00e-13 | NA |
7. B | Q4A7I1 | Spermidine/putrescine import ATP-binding protein PotA | 1.69e-04 | NA | 4.34e-05 | NA |
7. B | Q99QV7 | Putative ABC transporter ATP-binding protein SAV2684 | 1.44e-04 | NA | 8.45e-10 | NA |
7. B | Q0SNU4 | Phosphate import ATP-binding protein PstB | 3.66e-13 | NA | 2.73e-12 | NA |
7. B | P63356 | Methionine import ATP-binding protein MetN | 1.45e-11 | NA | 2.41e-14 | NA |
7. B | Q8UA73 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 5.79e-10 | NA | 6.07e-12 | NA |
7. B | Q3YW49 | Nickel import ATP-binding protein NikD | 1.05e-11 | NA | 1.01e-06 | NA |
7. B | Q8CMU4 | Phosphonates import ATP-binding protein PhnC | 1.35e-10 | NA | 4.02e-09 | NA |
7. B | A0RP01 | Macrolide export ATP-binding/permease protein MacB | 3.28e-02 | NA | 5.48e-10 | NA |
7. B | Q0TJM0 | Glutathione import ATP-binding protein GsiA | 2.62e-04 | NA | 3.69e-11 | NA |
7. B | Q62H59 | Phosphonates import ATP-binding protein PhnC | 7.43e-10 | NA | 0.009 | NA |
7. B | Q97N51 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.80e-10 | NA | 1.68e-11 | NA |
7. B | P97027 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.94e-08 | NA | 6.33e-08 | NA |
7. B | P63368 | Phosphate import ATP-binding protein PstB 1 | 5.30e-12 | NA | 7.41e-13 | NA |
7. B | Q1JEC8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.95e-09 | NA | 7.60e-12 | NA |
7. B | A6QJK1 | Putative hemin import ATP-binding protein HrtA | 6.76e-11 | NA | 6.98e-10 | NA |
7. B | Q7VYN2 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.11e-10 | NA | 1.71e-09 | NA |
7. B | P45052 | Oligopeptide transport ATP-binding protein OppD | 6.57e-10 | NA | 6.10e-08 | NA |
7. B | Q981Y8 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 8.46e-08 | NA | 1.72e-08 | NA |
7. B | Q720M2 | Putative ABC transporter ATP-binding protein LMOf2365_1216 | 5.99e-10 | NA | 1.57e-07 | NA |
7. B | Q73YZ5 | Aliphatic sulfonates import ATP-binding protein SsuB | 5.67e-06 | NA | 1.26e-05 | NA |
7. B | P51533 | ATP-dependent permease PDR10 | 1.11e-03 | NA | 0.002 | NA |
7. B | Q8CPN0 | Spermidine/putrescine import ATP-binding protein PotA | 1.22e-09 | NA | 2.64e-15 | NA |
7. B | Q6LH11 | Ribose import ATP-binding protein RbsA | 9.85e-04 | NA | 3.51e-04 | NA |
7. B | Q5HV18 | Methionine import ATP-binding protein MetN | 6.49e-11 | NA | 2.15e-11 | NA |
7. B | Q8EB59 | Hemin import ATP-binding protein HmuV | 9.49e-10 | NA | 2.62e-08 | NA |
7. B | Q1GMA8 | Phosphonates import ATP-binding protein PhnC 1 | 1.10e-10 | NA | 5.14e-08 | NA |
7. B | Q02QM1 | Phosphonates import ATP-binding protein PhnC 1 | 5.44e-10 | NA | 0.023 | NA |
7. B | Q8YGM0 | Lipoprotein-releasing system ATP-binding protein LolD | 7.86e-11 | NA | 2.59e-06 | NA |
7. B | Q9LJX0 | ABC transporter B family member 19 | 0.00e+00 | NA | 7.84e-63 | NA |
7. B | Q6G1V5 | Macrolide export ATP-binding/permease protein MacB | 1.57e-05 | NA | 3.57e-14 | NA |
7. B | Q4W575 | Fe(3+) ions import ATP-binding protein FbpC | 3.28e-09 | NA | 4.19e-15 | NA |
7. B | Q2PBM3 | Autoinducer 2 import ATP-binding protein LsrA | 4.29e-04 | NA | 3.91e-06 | NA |
7. B | Q83GE8 | Phosphate import ATP-binding protein PstB | 8.89e-12 | NA | 1.52e-13 | NA |
7. B | Q0BN75 | Lipoprotein-releasing system ATP-binding protein LolD | 6.15e-11 | NA | 9.32e-10 | NA |
7. B | O31339 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.77e-10 | NA | 2.03e-11 | NA |
7. B | A1B9Q7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.59e-10 | NA | 1.32e-06 | NA |
7. B | Q0I348 | Xylose import ATP-binding protein XylG | 1.68e-03 | NA | 4.93e-05 | NA |
7. B | Q9X0Y8 | Phosphate import ATP-binding protein PstB | 6.40e-13 | NA | 1.12e-18 | NA |
7. B | Q74KF9 | Phosphate import ATP-binding protein PstB 1 | 6.25e-12 | NA | 1.12e-13 | NA |
7. B | Q0TJH0 | Macrolide export ATP-binding/permease protein MacB | 3.21e-02 | NA | 1.43e-10 | NA |
7. B | Q3A9G5 | Methionine import ATP-binding protein MetN | 1.19e-11 | NA | 3.50e-16 | NA |
7. B | P0AAG2 | Dipeptide transport ATP-binding protein DppD | 1.74e-09 | NA | 0.011 | NA |
7. B | Q97EK8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.02e-10 | NA | 9.83e-14 | NA |
7. B | O31723 | Uncharacterized ABC transporter ATP-binding protein YlmA | 5.60e-10 | NA | 1.54e-06 | NA |
7. B | Q72D73 | Putative ABC transporter ATP-binding protein DVU_1056 | 3.32e-09 | NA | 5.02e-06 | NA |
7. B | Q4ZTG9 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 5.84e-07 | NA | 3.46e-04 | NA |
7. B | Q46ZU5 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.51e-07 | NA | 2.57e-10 | NA |
7. B | P42246 | Uncharacterized ABC transporter ATP-binding protein YcbN | 1.27e-07 | NA | 4.12e-12 | NA |
7. B | Q9XDA6 | Zinc uptake system ATP-binding protein ZurA | 8.62e-10 | NA | 2.71e-07 | NA |
7. B | Q6LPK2 | Lipoprotein-releasing system ATP-binding protein LolD | 1.01e-10 | NA | 4.75e-06 | NA |
7. B | Q5H002 | Phosphate import ATP-binding protein PstB | 1.28e-12 | NA | 7.47e-17 | NA |
7. B | Q4QJQ0 | Molybdenum import ATP-binding protein ModC | 7.37e-09 | NA | 9.46e-13 | NA |
7. B | Q7NC40 | Phosphate import ATP-binding protein PstB | 1.53e-06 | NA | 1.13e-17 | NA |
7. B | Q2FED7 | Putative hemin import ATP-binding protein HrtA | 8.09e-11 | NA | 6.98e-10 | NA |
7. B | Q2SRI2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.55e-11 | NA | 7.21e-09 | NA |
7. B | Q5HM27 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 6.82e-11 | NA | 1.37e-15 | NA |
7. B | Q83KP2 | Arabinose import ATP-binding protein AraG | 1.21e-03 | NA | 1.05e-04 | NA |
7. B | Q0T5R2 | Spermidine/putrescine import ATP-binding protein PotA | 2.07e-09 | NA | 7.98e-15 | NA |
7. B | Q21E72 | Phosphate import ATP-binding protein PstB | 5.11e-07 | NA | 3.50e-13 | NA |
7. B | Q119J0 | Phosphonates import ATP-binding protein PhnC 1 | 4.72e-11 | NA | 3.55e-09 | NA |
7. B | Q9ZUT0 | ABC transporter G family member 2 | 5.83e-02 | NA | 1.77e-04 | NA |
7. B | Q8D3X4 | Phosphate import ATP-binding protein PstB 2 | 1.20e-12 | NA | 2.15e-15 | NA |
7. B | Q4L5B3 | Spermidine/putrescine import ATP-binding protein PotA | 1.58e-09 | NA | 1.22e-15 | NA |
7. B | A3DJK3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.74e-09 | NA | 8.79e-12 | NA |
7. B | Q5YRK2 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 6.05e-08 | NA | 1.94e-06 | NA |
7. B | Q0BSM2 | Lipoprotein-releasing system ATP-binding protein LolD | 1.16e-10 | NA | 1.17e-05 | NA |
7. B | Q1CFP9 | Molybdenum import ATP-binding protein ModC | 1.37e-08 | NA | 1.28e-12 | NA |
7. B | Q8ST66 | ABC transporter G family member 18 | 1.44e-03 | NA | 2.89e-06 | NA |
7. B | Q8CPA1 | Phosphate import ATP-binding protein PstB | 4.44e-09 | NA | 4.12e-14 | NA |
7. B | Q884I3 | Lipoprotein-releasing system ATP-binding protein LolD | 8.86e-10 | NA | 8.72e-14 | NA |
7. B | Q9LZJ5 | ABC transporter C family member 14 | 4.77e-15 | NA | 6.73e-24 | NA |
7. B | Q38VW6 | Spermidine/putrescine import ATP-binding protein PotA | 4.89e-09 | NA | 2.44e-19 | NA |
7. B | Q032D0 | Phosphonates import ATP-binding protein PhnC | 6.36e-11 | NA | 1.97e-13 | NA |
7. B | Q2SJB5 | Molybdenum import ATP-binding protein ModC | 1.05e-07 | NA | 4.66e-14 | NA |
7. B | Q9PKX1 | Probable metal transport system ATP-binding protein TC_0339 | 5.17e-09 | NA | 2.36e-09 | NA |
7. B | Q2YL70 | Nickel import ATP-binding protein NikD | 2.63e-10 | NA | 3.09e-07 | NA |
7. B | Q1C607 | Fe(3+) ions import ATP-binding protein FbpC | 7.73e-09 | NA | 1.83e-15 | NA |
7. B | Q8ELQ6 | Methionine import ATP-binding protein MetN 3 | 4.26e-12 | NA | 3.74e-15 | NA |
7. B | A2WSH0 | ABC transporter G family member 36 | 3.21e-03 | NA | 9.21e-05 | NA |
7. B | C7J6G6 | ABC transporter G family member 46 | 3.65e-03 | NA | 4.09e-04 | NA |
7. B | Q9JVH1 | Fe(3+) ions import ATP-binding protein FbpC | 3.29e-09 | NA | 4.19e-15 | NA |
7. B | Q8VNL9 | Energy-coupling factor transporter ATP-binding protein EcfA | 4.27e-09 | NA | 2.41e-14 | NA |
7. B | Q0RT43 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.46e-06 | NA | 1.64e-12 | NA |
7. B | Q0TAY4 | Phosphate import ATP-binding protein PstB | 2.07e-11 | NA | 5.39e-19 | NA |
7. B | Q5UW69 | Phosphonates import ATP-binding protein PhnC 2 | 2.35e-10 | NA | 6.64e-07 | NA |
7. B | O83321 | Probable riboflavin import ATP-binding protein RfuB | 4.56e-02 | NA | 1.77e-06 | NA |
7. B | P63402 | Uncharacterized ABC transporter ATP-binding protein Mb2593 | 1.18e-08 | NA | 7.74e-05 | NA |
7. B | Q8K442 | ABC-type organic anion transporter ABCA8A | 1.38e-03 | NA | 1.64e-05 | NA |
7. B | P10091 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.15e-11 | NA | 3.57e-08 | NA |
7. B | Q47C66 | Lipoprotein-releasing system ATP-binding protein LolD | 2.15e-10 | NA | 7.70e-10 | NA |
7. B | Q28K97 | Taurine import ATP-binding protein TauB | 1.22e-07 | NA | 5.76e-10 | NA |
7. B | Q8D653 | Sulfate/thiosulfate import ATP-binding protein CysA | 5.50e-10 | NA | 1.07e-11 | NA |
7. B | P38045 | Nitrate import ATP-binding protein NrtC | 1.60e-05 | NA | 6.07e-08 | NA |
7. B | Q8T6J5 | ABC transporter A family member 2 | 1.61e-03 | NA | 5.74e-08 | NA |
7. B | Q7WMC3 | Phosphate import ATP-binding protein PstB | 3.45e-12 | NA | 4.77e-16 | NA |
7. B | Q2Y9Q1 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.34e-09 | NA | 6.16e-07 | NA |
7. B | Q89ER4 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.70e-09 | NA | 1.89e-09 | NA |
7. B | Q58418 | Phosphate import ATP-binding protein PstB | 5.13e-13 | NA | 8.33e-18 | NA |
7. B | Q579H8 | Methionine import ATP-binding protein MetN | 3.36e-10 | NA | 1.58e-10 | NA |
7. B | Q9C8H0 | ABC transporter C family member 12 | 5.55e-16 | NA | 2.35e-20 | NA |
7. B | Q9CL63 | Ribose import ATP-binding protein RbsA 2 | 6.63e-04 | NA | 1.93e-06 | NA |
7. B | O68877 | Hemin import ATP-binding protein HmuV | 2.58e-10 | NA | 4.36e-04 | NA |
7. B | Q8LQX2 | ABC transporter G family member 32 | 9.32e-04 | NA | 0.004 | NA |
7. B | Q1GCR8 | Thiamine import ATP-binding protein ThiQ | 9.92e-11 | NA | 7.16e-04 | NA |
7. B | Q9A1E3 | Methionine import ATP-binding protein MetN | 1.06e-10 | NA | 9.89e-16 | NA |
7. B | Q98K23 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.40e-09 | NA | 1.52e-08 | NA |
7. B | A0R8K8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.10e-09 | NA | 1.80e-18 | NA |
7. B | Q81A96 | Phosphonates import ATP-binding protein PhnC | 2.42e-11 | NA | 4.31e-10 | NA |
7. B | Q8XDM1 | Xylose import ATP-binding protein XylG | 6.54e-04 | NA | 0.002 | NA |
7. B | Q8ENB3 | Ribose import ATP-binding protein RbsA | 8.82e-04 | NA | 7.21e-07 | NA |
7. B | Q1BXC3 | Phosphate import ATP-binding protein PstB | 3.85e-12 | NA | 2.13e-17 | NA |
7. B | Q2YK62 | Putative peptide import ATP-binding protein BAB2_0818 | 1.60e-10 | NA | 8.55e-15 | NA |
7. B | Q81TH8 | Spermidine/putrescine import ATP-binding protein PotA | 9.63e-10 | NA | 1.74e-18 | NA |
7. B | Q6LQ00 | Putative ABC transporter ATP-binding protein PBPRA2240 | 1.18e-05 | NA | 5.44e-12 | NA |
7. B | Q9KGD6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 4.84e-08 | NA | 2.13e-10 | NA |
7. B | Q8R420 | Phospholipid-transporting ATPase ABCA3 | 2.36e-04 | NA | 5.19e-06 | NA |
7. B | Q0HTE5 | Phosphate import ATP-binding protein PstB | 1.11e-11 | NA | 9.98e-16 | NA |
7. B | Q0TFU2 | Galactose/methyl galactoside import ATP-binding protein MglA | 8.53e-04 | NA | 4.77e-06 | NA |
7. B | P0A2V6 | Oligopeptide transport ATP-binding protein OppF | 8.22e-11 | NA | 8.96e-16 | NA |
7. B | Q98KS7 | Lipoprotein-releasing system ATP-binding protein LolD | 9.97e-11 | NA | 6.87e-05 | NA |
7. B | Q2SY12 | Methionine import ATP-binding protein MetN | 2.03e-08 | NA | 5.24e-12 | NA |
7. B | Q97KS6 | Spermidine/putrescine import ATP-binding protein PotA | 9.94e-10 | NA | 2.44e-14 | NA |
7. B | Q3SRG8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.15e-10 | NA | 3.17e-07 | NA |
7. B | Q8CPY9 | UvrABC system protein A | 2.08e-02 | NA | 0.008 | NA |
7. B | P0A9R8 | Cell division ATP-binding protein FtsE | 3.79e-10 | NA | 2.11e-11 | NA |
7. B | Q9KFN9 | Phosphonates import ATP-binding protein PhnC 1 | 3.92e-11 | NA | 1.84e-13 | NA |
7. B | Q7YR37 | ATP-binding cassette sub-family F member 1 | 1.48e-03 | NA | 0.005 | NA |
7. B | Q94A18 | ABC transporter G family member 29 | 3.58e-03 | NA | 6.24e-04 | NA |
7. B | Q8IZY2 | Phospholipid-transporting ATPase ABCA7 | 3.75e-03 | NA | 1.30e-06 | NA |
7. B | P08183 | ATP-dependent translocase ABCB1 | 0.00e+00 | NA | 4.38e-56 | NA |
7. B | O83590 | Lipoprotein-releasing system ATP-binding protein LolD | 7.43e-11 | NA | 0.016 | NA |
7. B | Q2YUY7 | Phosphonates import ATP-binding protein PhnC | 6.78e-11 | NA | 7.81e-12 | NA |
7. B | Q6RCE0 | Phosphonates import ATP-binding protein PhnC | 1.32e-09 | NA | 0.005 | NA |
7. B | P39459 | Nitrate transport protein NasD | 2.27e-08 | NA | 5.17e-09 | NA |
7. B | O34314 | Uncharacterized ABC transporter ATP-binding protein YtlC | 2.38e-07 | NA | 4.45e-08 | NA |
7. B | Q9P5N0 | Vacuolar heme ABC transmembrane exporter abc3 | 1.11e-16 | NA | 8.98e-20 | NA |
7. B | Q5WCL2 | Teichoic acids export ATP-binding protein TagH | 1.26e-05 | NA | 4.16e-10 | NA |
7. B | Q7A6M2 | Methionine import ATP-binding protein MetN 2 | 1.99e-11 | NA | 3.53e-13 | NA |
7. B | O34641 | ABC transporter ATP-binding protein YtrB | 1.17e-08 | NA | 1.57e-06 | NA |
7. B | Q8U648 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.80e-07 | NA | 1.15e-09 | NA |
7. B | F2PLH2 | ABC multidrug transporter MDR1 | 9.17e-04 | NA | 0.005 | NA |
7. B | Q8NE71 | ATP-binding cassette sub-family F member 1 | 2.08e-04 | NA | 0.005 | NA |
7. B | Q3JTS8 | Phosphate import ATP-binding protein PstB | 9.10e-09 | NA | 1.53e-17 | NA |
7. B | Q110U3 | Spermidine/putrescine import ATP-binding protein PotA | 3.07e-09 | NA | 5.85e-13 | NA |
7. B | Q8X4L6 | Nickel import ATP-binding protein NikE | 2.78e-11 | NA | 7.20e-13 | NA |
7. B | Q84M24 | ABC transporter A family member 1 | 2.59e-03 | NA | 6.40e-08 | NA |
7. B | Q1IEK7 | Phosphonates import ATP-binding protein PhnC | 4.73e-11 | NA | 5.18e-06 | NA |
7. B | Q891M1 | Ribose import ATP-binding protein RbsA | 7.04e-04 | NA | 7.51e-08 | NA |
7. B | P0CZ33 | Oligopeptide transport ATP-binding protein OppF | 7.49e-11 | NA | 8.96e-16 | NA |
7. B | Q1R5D8 | Nickel import ATP-binding protein NikE | 1.42e-10 | NA | 1.25e-12 | NA |
7. B | Q1J983 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.16e-10 | NA | 1.28e-13 | NA |
7. B | Q2QLA3 | Cystic fibrosis transmembrane conductance regulator | 4.08e-11 | NA | 1.03e-18 | NA |
7. B | Q832Y6 | Methionine import ATP-binding protein MetN 1 | 2.03e-11 | NA | 2.78e-15 | NA |
7. B | Q3YSY7 | Lipoprotein-releasing system ATP-binding protein LolD | 2.21e-10 | NA | 1.82e-08 | NA |
7. B | Q9SZR9 | ABC transporter G family member 9 | 1.19e-02 | NA | 1.55e-07 | NA |
7. B | Q50316 | Putative ABC transporter ATP-binding protein MG468.1 homolog | 3.83e-04 | NA | 2.99e-06 | NA |
7. B | Q6LTB1 | Zinc import ATP-binding protein ZnuC | 1.67e-10 | NA | 4.01e-08 | NA |
7. B | Q21BU8 | Methionine import ATP-binding protein MetN | 2.56e-10 | NA | 2.00e-12 | NA |
7. B | Q7CN92 | Spermidine/putrescine import ATP-binding protein PotA | 2.25e-09 | NA | 2.45e-16 | NA |
7. B | Q03AH0 | Spermidine/putrescine import ATP-binding protein PotA | 1.02e-09 | NA | 3.32e-14 | NA |
7. B | Q5HBR8 | Zinc import ATP-binding protein ZnuC | 7.86e-09 | NA | 0.004 | NA |
7. B | P42954 | Teichoic acids export ATP-binding protein TagH | 3.38e-05 | NA | 8.29e-07 | NA |
7. B | Q0K9I2 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.94e-07 | NA | 1.03e-11 | NA |
7. B | Q325N3 | Taurine import ATP-binding protein TauB | 4.13e-08 | NA | 1.27e-08 | NA |
7. B | P0A2U6 | Zinc transport system ATP-binding protein AdcC | 8.63e-08 | NA | 6.90e-13 | NA |
7. B | Q04JW0 | Spermidine/putrescine import ATP-binding protein PotA | 1.30e-09 | NA | 4.77e-15 | NA |
7. B | A0K5N5 | Methionine import ATP-binding protein MetN 1 | 2.54e-08 | NA | 5.87e-13 | NA |
7. B | A2RI77 | Dipeptide transport ATP-binding protein DppD | 1.21e-09 | NA | 6.90e-10 | NA |
7. B | Q5M397 | Spermidine/putrescine import ATP-binding protein PotA | 1.58e-09 | NA | 1.88e-15 | NA |
7. B | Q51546 | Phosphate import ATP-binding protein PstB | 1.41e-08 | NA | 5.92e-15 | NA |
7. B | Q9G4F5 | Sulfate/thiosulfate import ATP-binding protein cysA | 2.10e-10 | NA | 6.88e-10 | NA |
7. B | Q04EY4 | Energy-coupling factor transporter ATP-binding protein EcfA3 | 5.86e-09 | NA | 1.25e-12 | NA |
7. B | Q63E84 | Spermidine/putrescine import ATP-binding protein PotA | 9.19e-10 | NA | 1.93e-18 | NA |
7. B | Q8U4K3 | Molybdate/tungstate import ATP-binding protein WtpC | 4.07e-10 | NA | 1.69e-09 | NA |
7. B | Q54BT5 | ABC transporter A family member 3 | 1.76e-04 | NA | 1.62e-08 | NA |
7. B | P45167 | ATP-binding protein Uup-like | 8.29e-05 | NA | 0.031 | NA |
7. B | Q3Z3V4 | Glutathione import ATP-binding protein GsiA | 2.32e-04 | NA | 6.78e-11 | NA |
7. B | Q8PZN0 | Putative ABC transporter ATP-binding protein MM_0462 | 1.51e-09 | NA | 1.25e-12 | NA |
7. B | Q8YCN8 | Nickel import ATP-binding protein NikD | 2.36e-10 | NA | 3.09e-07 | NA |
7. B | Q9CK97 | Methionine import ATP-binding protein MetN | 1.04e-11 | NA | 4.19e-16 | NA |
7. B | Q5HKQ8 | Phosphonates import ATP-binding protein PhnC | 1.27e-10 | NA | 4.02e-09 | NA |
7. B | Q67JX4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.46e-08 | NA | 3.36e-10 | NA |
7. B | Q31KE8 | Phosphate import ATP-binding protein PstB | 2.65e-12 | NA | 4.39e-13 | NA |
7. B | Q6GAB5 | Spermidine/putrescine import ATP-binding protein PotA | 1.60e-09 | NA | 2.87e-13 | NA |
7. B | Q2KVS6 | Macrolide export ATP-binding/permease protein MacB | 5.85e-02 | NA | 1.14e-08 | NA |
7. B | Q4KG27 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.24e-09 | NA | 5.58e-10 | NA |
7. B | Q23868 | Serine protease/ABC transporter B family protein tagC | 3.53e-13 | NA | 8.24e-45 | NA |
7. B | Q5A762 | Multiple drug resistance-associated protein-like transporter 1 | 3.00e-15 | NA | 1.01e-23 | NA |
7. B | Q6F1W5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.32e-09 | NA | 9.39e-19 | NA |
7. B | Q5LX21 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.18e-10 | NA | 2.88e-09 | NA |
7. B | Q83L12 | Autoinducer 2 import ATP-binding protein LsrA | 4.24e-04 | NA | 7.02e-06 | NA |
7. B | Q4UT63 | Phosphate import ATP-binding protein PstB | 1.45e-12 | NA | 3.95e-16 | NA |
7. B | Q3SJQ8 | Phosphate import ATP-binding protein PstB | 1.98e-11 | NA | 1.41e-18 | NA |
7. B | Q75EV6 | Elongation factor 3 | 2.40e-04 | NA | 1.77e-08 | NA |
7. B | Q08972 | [NU+] prion formation protein 1 | 2.75e-03 | NA | 7.91e-05 | NA |
7. B | Q8XZP8 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.60e-10 | NA | 3.87e-11 | NA |
7. B | Q48J74 | Xylose import ATP-binding protein XylG | 1.06e-03 | NA | 5.41e-05 | NA |
7. B | Q8NR12 | Ribose import ATP-binding protein RbsA | 3.89e-04 | NA | 0.014 | NA |
7. B | Q02151 | Uncharacterized ABC transporter ATP-binding protein YmeB | 1.38e-09 | NA | 3.58e-09 | NA |
7. B | Q0TAW0 | Ribose import ATP-binding protein RbsA | 7.28e-04 | NA | 1.87e-06 | NA |
7. B | Q4ZSS5 | Molybdenum import ATP-binding protein ModC | 7.82e-08 | NA | 3.07e-08 | NA |
7. B | Q09429 | ATP-binding cassette sub-family C member 8 | 6.67e-13 | NA | 5.84e-18 | NA |
7. B | Q55463 | Bicarbonate transport ATP-binding protein CmpD | 8.63e-08 | NA | 1.83e-11 | NA |
7. B | P9WQL3 | Molybdenum import ATP-binding protein ModC | 6.18e-10 | NA | 3.65e-09 | NA |
7. B | Q57TF5 | Thiamine import ATP-binding protein ThiQ | 1.45e-11 | NA | 1.59e-10 | NA |
7. B | Q2RS21 | Nickel import ATP-binding protein NikD | 3.55e-10 | NA | 5.55e-07 | NA |
7. B | Q5QVB0 | Phosphate import ATP-binding protein PstB | 1.58e-11 | NA | 1.18e-14 | NA |
7. B | P43569 | CCR4-associated factor 16 | 2.77e-05 | NA | 0.002 | NA |
7. B | Q9M0M2 | ABC transporter B family member 9 | 0.00e+00 | NA | 1.12e-56 | NA |
7. B | Q6MSQ2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.25e-10 | NA | 2.54e-08 | NA |
7. B | Q0JLC5 | ABC transporter G family member 36 | 5.72e-03 | NA | 9.29e-05 | NA |
7. B | O05519 | Putative ATP-binding protein YdiF | 5.14e-05 | NA | 3.46e-09 | NA |
7. B | Q2YQT8 | Phosphate import ATP-binding protein PstB | 2.14e-09 | NA | 9.85e-16 | NA |
7. B | A1TAI4 | Spermidine/putrescine import ATP-binding protein PotA | 3.17e-09 | NA | 1.26e-07 | NA |
7. B | Q9A7X1 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.84e-10 | NA | 2.21e-07 | NA |
7. B | P0A9X1 | Zinc import ATP-binding protein ZnuC | 2.82e-10 | NA | 8.36e-11 | NA |
7. B | Q8T674 | ABC transporter G family member 20 | 6.53e-03 | NA | 4.66e-09 | NA |
7. B | P0AAH8 | Putrescine export system ATP-binding protein SapF | 8.45e-11 | NA | 1.10e-14 | NA |
7. B | Q87G35 | Putative ABC transporter ATP-binding protein VPA1482 | 4.20e-05 | NA | 2.04e-11 | NA |
7. B | Q8NWT5 | Nickel import system ATP-binding protein NikD | 1.59e-09 | NA | 1.73e-09 | NA |
7. B | Q9STT7 | ABC transporter A family member 5 | 2.08e-05 | NA | 7.91e-06 | NA |
7. B | P0A2V5 | Oligopeptide transport ATP-binding protein OppF | 3.56e-10 | NA | 2.92e-13 | NA |
7. B | Q97IE0 | Phosphate import ATP-binding protein PstB | 2.30e-12 | NA | 1.12e-13 | NA |
7. B | Q57QC8 | Spermidine/putrescine import ATP-binding protein PotA | 1.91e-09 | NA | 9.39e-15 | NA |
7. B | Q2K3Y7 | Arabinose import ATP-binding protein AraG | 1.44e-03 | NA | 2.25e-04 | NA |
7. B | Q9HX79 | Taurine import ATP-binding protein TauB | 1.65e-09 | NA | 5.45e-11 | NA |
7. B | Q089M3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.44e-08 | NA | 0.001 | NA |
7. B | P63396 | Uncharacterized ABC transporter ATP-binding protein Mb1312c | 1.49e-04 | NA | 1.40e-09 | NA |
7. B | P77622 | Probable D,D-dipeptide transport ATP-binding protein DdpF | 8.86e-10 | NA | 1.04e-15 | NA |
7. B | Q1BRZ8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.76e-10 | NA | 9.87e-10 | NA |
7. B | Q8G5P8 | Methionine import ATP-binding protein MetN | 2.66e-10 | NA | 2.45e-13 | NA |
7. B | Q0APW8 | Lipoprotein-releasing system ATP-binding protein LolD | 2.63e-10 | NA | 0.001 | NA |
7. B | Q0C1N8 | Macrolide export ATP-binding/permease protein MacB | 2.01e-06 | NA | 5.65e-07 | NA |
7. B | Q66A01 | Vitamin B12 import ATP-binding protein BtuD | 3.00e-08 | NA | 2.68e-08 | NA |
7. B | Q02QT6 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.34e-06 | NA | 5.53e-06 | NA |
7. B | Q2G1L8 | Phosphonates import ATP-binding protein PhnC | 5.51e-11 | NA | 5.18e-12 | NA |
7. B | Q1CDR0 | Aliphatic sulfonates import ATP-binding protein SsuB | 6.78e-08 | NA | 5.00e-11 | NA |
7. B | P57445 | ATP-binding protein Uup | 1.66e-02 | NA | 5.25e-10 | NA |
7. B | Q9GTN7 | Serine protease/ABC transporter B family protein tagA | 0.00e+00 | NA | 9.93e-66 | NA |
7. B | A2RH11 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.98e-09 | NA | 7.60e-12 | NA |
7. B | P41234 | ATP-binding cassette sub-family A member 2 | 8.86e-03 | NA | 2.30e-04 | NA |
7. B | Q6HLQ9 | Spermidine/putrescine import ATP-binding protein PotA | 1.09e-09 | NA | 1.77e-18 | NA |
7. B | Q9KL34 | Hemin import ATP-binding protein HmuV | 1.47e-09 | NA | 1.17e-04 | NA |
7. B | Q92V71 | Phosphonates import ATP-binding protein PhnC | 3.66e-11 | NA | 7.46e-10 | NA |
7. B | Q2YXZ0 | Nickel import system ATP-binding protein NikE | 4.25e-12 | NA | 2.31e-14 | NA |
7. B | Q7GB25 | ABC transporter C family member 5 | 1.33e-15 | NA | 2.44e-24 | NA |
7. B | Q21JQ9 | Lipoprotein-releasing system ATP-binding protein LolD | 1.42e-10 | NA | 3.25e-13 | NA |
7. B | Q2FVF0 | Metal-staphylopine import system ATP-binding protein CntD | 2.50e-11 | NA | 2.11e-08 | NA |
7. B | P0CE68 | ABC transporter NFT1 | 4.88e-09 | NA | 3.19e-09 | NA |
7. B | P75551 | Oligopeptide transport ATP-binding protein OppF | 7.15e-04 | NA | 3.07e-06 | NA |
7. B | Q3ZA58 | Phosphate import ATP-binding protein PstB | 8.59e-13 | NA | 9.70e-18 | NA |
7. B | Q9RYZ3 | Phosphate import ATP-binding protein PstB | 4.07e-12 | NA | 8.15e-13 | NA |
7. B | Q8X5Q4 | Ribose import ATP-binding protein RbsA 2 | 6.81e-04 | NA | 3.05e-07 | NA |
7. B | P45289 | Peptide transport system ATP-binding protein SapF | 5.49e-11 | NA | 2.00e-08 | NA |
7. B | Q8CG09 | Multidrug resistance-associated protein 1 | 1.44e-15 | NA | 3.09e-28 | NA |
7. B | O88563 | ATP-binding cassette sub-family C member 3 | 5.55e-16 | NA | 2.94e-25 | NA |
7. B | Q0SSJ0 | Ribose import ATP-binding protein RbsA | 6.30e-04 | NA | 5.53e-09 | NA |
7. B | Q04G50 | Spermidine/putrescine import ATP-binding protein PotA | 1.09e-09 | NA | 1.21e-16 | NA |
7. B | Q4ZSF3 | Xylose import ATP-binding protein XylG | 1.08e-03 | NA | 1.04e-04 | NA |
7. B | Q1WSB8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.04e-10 | NA | 2.62e-11 | NA |
7. B | Q8RFV0 | Lipoprotein-releasing system ATP-binding protein LolD | 1.41e-10 | NA | 5.37e-05 | NA |
7. B | Q32EY4 | Spermidine/putrescine import ATP-binding protein PotA | 2.46e-09 | NA | 1.82e-14 | NA |
7. B | Q65HB9 | Phosphate import ATP-binding protein PstB 2 | 1.15e-11 | NA | 2.21e-14 | NA |
7. B | Q2J220 | Phosphate import ATP-binding protein PstB | 1.53e-12 | NA | 5.10e-17 | NA |
7. B | P23888 | Polysialic acid transport ATP-binding protein KpsT | 7.09e-07 | NA | 0.021 | NA |
7. B | Q1LQF6 | Methionine import ATP-binding protein MetN | 1.29e-10 | NA | 4.78e-12 | NA |
7. B | Q18CJ0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 8.97e-11 | NA | 4.96e-16 | NA |
7. B | P9WQK1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 7.82e-11 | NA | 3.25e-08 | NA |
7. B | P26361 | Cystic fibrosis transmembrane conductance regulator | 6.24e-10 | NA | 1.52e-21 | NA |
7. B | Q1CAK4 | Methionine import ATP-binding protein MetN 1 | 2.04e-11 | NA | 6.04e-16 | NA |
7. B | Q3Z2Z3 | Spermidine/putrescine import ATP-binding protein PotA | 2.63e-09 | NA | 8.39e-16 | NA |
7. B | A0KMJ3 | Macrolide export ATP-binding/permease protein MacB 2 | 2.36e-06 | NA | 3.24e-14 | NA |
7. B | O70014 | Hemin import ATP-binding protein HmuV | 1.37e-09 | NA | 4.16e-05 | NA |
7. B | Q2FNX9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.48e-10 | NA | 2.80e-10 | NA |
7. B | P0A2V2 | Octopine permease ATP-binding protein P | 3.10e-12 | NA | 2.24e-08 | NA |
7. B | O34338 | Manganese transport system ATP-binding protein MntB | 4.82e-09 | NA | 8.52e-14 | NA |
7. B | Q9TKX3 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.09e-10 | NA | 4.70e-12 | NA |
7. B | Q54HM0 | ABC transporter G family member 16 | 1.79e-03 | NA | 5.01e-07 | NA |
7. B | Q1JBJ5 | Phosphate import ATP-binding protein PstB 1 | 9.32e-12 | NA | 2.70e-09 | NA |
7. B | Q6RH47 | Taurine import ATP-binding protein TauB | 6.92e-08 | NA | 1.62e-06 | NA |
7. B | Q8EUR3 | Spermidine/putrescine import ATP-binding protein PotA | 1.09e-04 | NA | 2.62e-06 | NA |
7. B | Q14J44 | Lipoprotein-releasing system ATP-binding protein LolD | 6.48e-11 | NA | 8.81e-10 | NA |
7. B | P33527 | Multidrug resistance-associated protein 1 | 1.67e-15 | NA | 2.04e-26 | NA |
7. B | P0A9V3 | Lipopolysaccharide export system ATP-binding protein LptB | 7.67e-11 | NA | 1.09e-04 | NA |
7. B | Q88RA1 | Taurine import ATP-binding protein TauB | 6.28e-08 | NA | 1.79e-08 | NA |
7. B | Q8WWZ7 | Cholesterol transporter ABCA5 | 4.69e-04 | NA | 2.09e-07 | NA |
7. B | Q2SUW7 | Phosphate import ATP-binding protein PstB | 9.54e-09 | NA | 1.53e-17 | NA |
7. B | Q13LD8 | Methionine import ATP-binding protein MetN 2 | 9.53e-08 | NA | 4.98e-15 | NA |
7. B | Q21UI2 | Molybdenum import ATP-binding protein ModC | 3.77e-07 | NA | 1.41e-09 | NA |
7. B | Q1RE44 | Macrolide export ATP-binding/permease protein MacB | 3.66e-02 | NA | 1.38e-10 | NA |
7. B | Q0SZJ4 | Nickel import ATP-binding protein NikD | 1.03e-11 | NA | 1.25e-05 | NA |
7. B | Q98FL5 | Phosphate import ATP-binding protein PstB | 1.02e-12 | NA | 4.14e-16 | NA |
7. B | Q3KJS6 | Methionine import ATP-binding protein MetN 2 | 9.74e-11 | NA | 6.62e-18 | NA |
7. B | Q8T673 | ABC transporter G family member 21 | 5.58e-04 | NA | 1.36e-06 | NA |
7. B | Q39S52 | Phosphate import ATP-binding protein PstB | 1.80e-12 | NA | 3.46e-10 | NA |
7. B | Q5PFQ7 | Putative 2-aminoethylphosphonate import ATP-binding protein PhnT | 2.43e-09 | NA | 1.20e-17 | NA |
7. B | P47433 | Putative ABC transporter ATP-binding protein MG187 | 1.98e-05 | NA | 1.62e-06 | NA |
7. B | O34992 | Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA | 2.58e-11 | NA | 1.41e-14 | NA |
7. B | O34946 | High-affinity zinc uptake system ATP-binding protein ZnuC | 1.16e-08 | NA | 8.88e-15 | NA |
7. B | Q2YKR8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.16e-11 | NA | 6.88e-12 | NA |
7. B | Q98PL2 | UvrABC system protein A | 2.39e-02 | NA | 0.021 | NA |
7. B | Q6NDA6 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.13e-07 | NA | 3.30e-05 | NA |
7. B | Q5T3U5 | ATP-binding cassette sub-family C member 10 | 5.55e-16 | NA | 2.31e-19 | NA |
7. B | Q8EPK1 | Methionine import ATP-binding protein MetN 1 | 8.02e-11 | NA | 2.07e-15 | NA |
7. B | Q18C09 | Methionine import ATP-binding protein MetN | 8.39e-12 | NA | 3.07e-15 | NA |
7. B | A0RFA4 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.19e-07 | NA | 1.96e-09 | NA |
7. B | Q6FFZ1 | Aliphatic sulfonates import ATP-binding protein SsuB | 5.53e-07 | NA | 1.05e-13 | NA |
7. B | Q2FKB7 | Phosphonates import ATP-binding protein PhnC | 5.27e-11 | NA | 5.18e-12 | NA |
7. B | Q8F6Z1 | Sulfate/thiosulfate import ATP-binding protein CysA | 9.11e-10 | NA | 6.24e-10 | NA |
7. B | Q8YDN0 | Xylose import ATP-binding protein XylG | 1.10e-03 | NA | 0.007 | NA |
7. B | Q8EUL1 | UvrABC system protein A | 1.09e-02 | NA | 0.012 | NA |
7. B | Q3KKA1 | Zinc import ATP-binding protein ZnuC | 1.75e-09 | NA | 9.36e-11 | NA |
7. B | Q3ATR5 | Macrolide export ATP-binding/permease protein MacB | 1.74e-06 | NA | 8.73e-10 | NA |
7. B | Q9ZCM4 | Lipoprotein-releasing system ATP-binding protein LolD | 8.87e-10 | NA | 9.57e-09 | NA |
7. B | Q8XK20 | Putative ABC transporter ATP-binding protein CPE1583 | 4.10e-05 | NA | 9.08e-15 | NA |
7. B | Q043Y8 | Methionine import ATP-binding protein MetN | 6.74e-10 | NA | 4.02e-17 | NA |
7. B | A3CRB9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.58e-09 | NA | 1.72e-15 | NA |
7. B | Q5HAV5 | Phosphate import ATP-binding protein PstB | 6.02e-13 | NA | 9.88e-19 | NA |
7. B | Q8D3V0 | Maltose/maltodextrin import ATP-binding protein MalK | 9.01e-11 | NA | 6.67e-12 | NA |
7. B | Q5N1G5 | Phosphate import ATP-binding protein PstB | 2.87e-12 | NA | 7.00e-13 | NA |
7. B | P75059 | Spermidine/putrescine import ATP-binding protein PotA | 2.65e-03 | NA | 7.84e-08 | NA |
7. B | O57896 | Molybdate/tungstate import ATP-binding protein WtpC | 2.83e-10 | NA | 3.91e-07 | NA |
7. B | Q9SYI2 | ABC transporter B family member 3 | 0.00e+00 | NA | 4.28e-51 | NA |
7. B | Q57213 | Uncharacterized ABC transporter ATP-binding protein HI_1474 | 2.08e-12 | NA | 1.96e-14 | NA |
7. B | Q30PC0 | Phosphate import ATP-binding protein PstB | 4.41e-13 | NA | 1.28e-12 | NA |
7. B | Q46Y69 | Methionine import ATP-binding protein MetN | 2.57e-08 | NA | 2.65e-12 | NA |
7. B | Q7NIW1 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.77e-09 | NA | 1.34e-09 | NA |
7. B | Q81N53 | Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 | 1.35e-04 | NA | 1.89e-09 | NA |
7. B | Q9CPN2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.50e-08 | NA | 2.94e-05 | NA |
7. B | Q8ZJ07 | UvrABC system protein A | 6.32e-02 | NA | 0.042 | NA |
7. B | Q48QM2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.02e-09 | NA | 7.81e-12 | NA |
7. B | Q02DK9 | Zinc import ATP-binding protein ZnuC | 1.61e-09 | NA | 1.65e-08 | NA |
7. B | Q65SC9 | Thiamine import ATP-binding protein ThiQ | 9.78e-10 | NA | 1.28e-10 | NA |
7. B | Q9LSJ8 | ABC transporter B family member 16 | 0.00e+00 | NA | 4.34e-58 | NA |
7. B | Q8XZQ4 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.26e-08 | NA | 2.41e-08 | NA |
7. B | Q2YJJ8 | Putative peptide import ATP-binding protein BAB2_1053 | 2.26e-10 | NA | 3.20e-14 | NA |
7. B | Q9AML4 | Phosphate import ATP-binding protein PstB | 1.82e-11 | NA | 7.92e-18 | NA |
7. B | Q6FFL0 | Zinc import ATP-binding protein ZnuC | 2.33e-10 | NA | 1.40e-11 | NA |
7. B | Q07LY2 | Phosphonates import ATP-binding protein PhnC 2 | 4.75e-11 | NA | 1.39e-09 | NA |
7. B | Q8DQY5 | Putative ABC transporter ATP-binding protein spr0430 | 1.63e-04 | NA | 8.30e-15 | NA |
7. B | Q8YE15 | Molybdenum import ATP-binding protein ModC | 1.84e-07 | NA | 1.22e-05 | NA |
7. B | P42360 | Manganese import ATP-binding protein ScaC | 5.71e-09 | NA | 2.08e-08 | NA |
7. B | Q08234 | Uncharacterized ABC transporter ATP-binding protein/permease YOL075C | 1.68e-03 | NA | 4.44e-10 | NA |
7. B | P10640 | ATP-binding protein BexA | 8.77e-08 | NA | 4.12e-07 | NA |
7. B | Q6LY93 | Phosphate import ATP-binding protein PstB | 4.03e-13 | NA | 4.59e-18 | NA |
7. B | E9PX95 | ATP-binding cassette sub-family A member 17 | 3.97e-03 | NA | 1.45e-07 | NA |
7. B | Q1JLH7 | Phosphate import ATP-binding protein PstB 1 | 1.17e-11 | NA | 2.70e-09 | NA |
7. B | P10090 | Protein white | 1.80e-02 | NA | 2.04e-07 | NA |
7. B | P33302 | Pleiotropic ABC efflux transporter of multiple drugs | 1.04e-03 | NA | 5.84e-05 | NA |
7. B | P0A9U5 | Probable ATP-binding protein YbiT | 1.05e-05 | NA | 7.61e-11 | NA |
7. B | Q5Z9S8 | ABC transporter G family member 42 | 3.39e-04 | NA | 0.007 | NA |
7. B | P55453 | Uncharacterized ABC transporter ATP-binding protein y4fO | 6.10e-09 | NA | 1.23e-08 | NA |
7. B | Q97Q34 | Phosphate import ATP-binding protein PstB 2 | 5.28e-11 | NA | 1.46e-15 | NA |
7. B | O35600 | Retinal-specific phospholipid-transporting ATPase ABCA4 | 1.03e-02 | NA | 9.22e-05 | NA |
7. B | Q8T664 | ABC transporter H family member 2 | 1.71e-06 | NA | 1.22e-10 | NA |
7. B | Q471U2 | Taurine import ATP-binding protein TauB | 5.45e-08 | NA | 6.01e-08 | NA |
7. B | Q5LT05 | Spermidine/putrescine import ATP-binding protein PotA | 9.11e-10 | NA | 4.38e-12 | NA |
7. B | Q87UH7 | Taurine import ATP-binding protein TauB | 7.04e-08 | NA | 1.11e-07 | NA |
7. B | Q729H7 | Lipoprotein-releasing system ATP-binding protein LolD | 2.83e-11 | NA | 8.51e-08 | NA |
7. B | Q47YG8 | Lipoprotein-releasing system ATP-binding protein LolD | 4.55e-10 | NA | 5.66e-10 | NA |
7. B | Q1IGZ0 | Methionine import ATP-binding protein MetN 2 | 1.10e-11 | NA | 1.15e-16 | NA |
7. B | Q87J32 | Hemin import ATP-binding protein HmuV | 6.09e-09 | NA | 4.25e-05 | NA |
7. B | Q81VQ1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.52e-09 | NA | 1.56e-11 | NA |
7. B | Q8RCU0 | Phosphate import ATP-binding protein PstB 1 | 1.61e-13 | NA | 3.30e-16 | NA |
7. B | Q10V16 | Phosphonates import ATP-binding protein PhnC 2 | 9.63e-12 | NA | 1.82e-08 | NA |
7. B | Q82VR4 | Phosphate import ATP-binding protein PstB | 4.78e-12 | NA | 5.88e-16 | NA |
7. B | Q7NWX3 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 1.72e-09 | NA | 7.28e-09 | NA |
7. B | Q8ZLF4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.66e-10 | NA | 1.80e-07 | NA |
7. B | O34756 | Putative ABC transporter ATP-binding protein YjkB | 4.13e-12 | NA | 3.77e-10 | NA |
7. B | Q89L46 | UvrABC system protein A | 4.42e-02 | NA | 0.024 | NA |
7. B | P43245 | ATP-dependent translocase ABCB1 | 3.00e-14 | NA | 5.27e-56 | NA |
7. B | Q89C51 | Phosphonates import ATP-binding protein PhnC | 5.15e-11 | NA | 5.74e-08 | NA |
7. B | Q48TP4 | Spermidine/putrescine import ATP-binding protein PotA | 9.21e-10 | NA | 9.94e-16 | NA |
7. B | P0DJA1 | Lipoprotein-releasing system ATP-binding protein LolD | 2.04e-09 | NA | 8.17e-08 | NA |
7. B | Q9FHF1 | ABC transporter B family member 7 | 0.00e+00 | NA | 1.21e-56 | NA |
7. B | Q10YP7 | Phosphate import ATP-binding protein PstB | 7.23e-12 | NA | 6.64e-19 | NA |
7. B | Q65P77 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.48e-08 | NA | 7.64e-15 | NA |
7. B | Q65V02 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.77e-09 | NA | 0.006 | NA |
7. B | Q99RR8 | Putative hemin import ATP-binding protein HrtA | 8.22e-11 | NA | 6.35e-10 | NA |
7. B | Q3YVK8 | Ribose import ATP-binding protein RbsA | 7.04e-04 | NA | 1.84e-06 | NA |
7. B | A8A066 | Autoinducer 2 import ATP-binding protein LsrA | 6.81e-04 | NA | 1.01e-05 | NA |
7. B | Q8Z1U0 | Maltose/maltodextrin import ATP-binding protein MalK | 3.71e-11 | NA | 4.47e-12 | NA |
7. B | Q39KB9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.80e-10 | NA | 5.24e-09 | NA |
7. B | Q9PDN2 | Sulfate/thiosulfate import ATP-binding protein CysA | 8.11e-10 | NA | 1.86e-09 | NA |
7. B | Q9ZUT8 | ABC transporter G family member 33 | 1.67e-03 | NA | 0.012 | NA |
7. B | O68106 | Cobalt import ATP-binding protein CbiO | 1.71e-08 | NA | 5.78e-10 | NA |
7. B | Q1RE96 | Glutathione import ATP-binding protein GsiA | 6.52e-05 | NA | 3.72e-11 | NA |
7. B | Q82VK1 | Macrolide export ATP-binding/permease protein MacB | 6.16e-02 | NA | 9.79e-10 | NA |
7. B | Q601T6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.83e-08 | NA | 2.42e-05 | NA |
7. B | P0A9U3 | Probable ATP-binding protein YbiT | 2.12e-05 | NA | 7.61e-11 | NA |
7. B | Q5FT15 | Phosphate import ATP-binding protein PstB | 2.24e-12 | NA | 6.65e-15 | NA |
7. B | Q6G4T6 | Phosphate import ATP-binding protein PstB | 6.48e-13 | NA | 5.65e-16 | NA |
7. B | Q57I19 | Putative bifunctional cytochrome c-type biogenesis protein CcmAE | 4.37e-09 | NA | 0.019 | NA |
7. B | Q9SYI3 | ABC transporter B family member 5 | 0.00e+00 | NA | 1.67e-53 | NA |
7. B | Q9PQU3 | Phosphate import ATP-binding protein PstB | 2.31e-07 | NA | 1.70e-16 | NA |
7. B | O35379 | Multidrug resistance-associated protein 1 | 2.00e-15 | NA | 1.40e-27 | NA |
7. B | Q47538 | Taurine import ATP-binding protein TauB | 4.62e-08 | NA | 7.44e-09 | NA |
7. B | O59672 | Uncharacterized ABC transporter ATP-binding protein C29A3.09c | 1.30e-05 | NA | 5.26e-08 | NA |
7. B | P24137 | Oligopeptide transport ATP-binding protein OppF | 8.47e-11 | NA | 9.39e-14 | NA |
7. B | Q98QH4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.89e-09 | NA | 4.10e-08 | NA |
7. B | P0AAF5 | Arabinose import ATP-binding protein AraG | 1.11e-03 | NA | 6.50e-05 | NA |
7. B | Q5F6V6 | Macrolide export ATP-binding/permease protein MacB | 2.65e-02 | NA | 3.24e-09 | NA |
7. B | Q50293 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.17e-07 | NA | 1.49e-11 | NA |
7. B | Q8YDH0 | Putative peptide import ATP-binding protein BMEII0206 | 2.88e-09 | NA | 3.50e-06 | NA |
7. B | Q39LW7 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 3.60e-07 | NA | 3.41e-07 | NA |
7. B | Q2SRI1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 6.27e-08 | NA | 9.13e-18 | NA |
7. B | Q5WJP0 | Methionine import ATP-binding protein MetN 2 | 1.48e-11 | NA | 2.50e-14 | NA |
7. B | Q4UVG2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.39e-08 | NA | 1.24e-04 | NA |
7. B | Q55791 | Probable ATP-dependent transporter slr0075 | 5.90e-07 | NA | 5.60e-04 | NA |
7. B | Q51719 | Putative ABC transporter ATP-binding protein in cobA 5'region | 1.37e-07 | NA | 7.06e-09 | NA |
7. B | Q0T7M2 | Taurine import ATP-binding protein TauB | 5.05e-08 | NA | 6.10e-06 | NA |
7. B | Q2KJA2 | ATP-binding cassette sub-family F member 2 | 5.44e-03 | NA | 0.003 | NA |
7. B | Q1J6Q6 | Spermidine/putrescine import ATP-binding protein PotA | 6.83e-10 | NA | 6.49e-16 | NA |
7. B | Q92EZ6 | Methionine import ATP-binding protein MetN 1 | 9.96e-11 | NA | 7.46e-14 | NA |
7. B | Q04EY5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.82e-10 | NA | 1.11e-13 | NA |
7. B | Q8DRF9 | Methionine import ATP-binding protein MetN | 1.01e-10 | NA | 4.96e-17 | NA |
7. B | Q20WP4 | Phosphate import ATP-binding protein PstB | 3.01e-12 | NA | 1.22e-17 | NA |
7. B | Q4KES7 | Macrolide export ATP-binding/permease protein MacB 1 | 2.33e-02 | NA | 1.53e-08 | NA |
7. B | P94374 | Uncharacterized ABC transporter ATP-binding protein YxlF | 2.59e-08 | NA | 3.93e-07 | NA |
7. B | Q7CG00 | Ribose import ATP-binding protein RbsA | 6.78e-04 | NA | 1.58e-04 | NA |
7. B | Q6D201 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.28e-10 | NA | 4.37e-17 | NA |
7. B | Q44848 | Uncharacterized ABC transporter ATP-binding protein BB_0318 | 6.63e-03 | NA | 0.007 | NA |
7. B | Q5X9B6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.50e-10 | NA | 1.28e-13 | NA |
7. B | C8ZCR2 | ABC transporter NFT1 | 3.94e-12 | NA | 1.17e-26 | NA |
7. B | Q2J3T0 | Hemin import ATP-binding protein HmuV | 8.91e-10 | NA | 3.37e-05 | NA |
7. B | Q00748 | Multidrug resistance protein homolog 65 | 0.00e+00 | NA | 5.06e-57 | NA |
7. B | Q81XB3 | Petrobactin import ATP-binding protein FatE | 2.29e-10 | NA | 1.72e-04 | NA |
7. B | Q58429 | Uncharacterized ABC transporter ATP-binding protein MJ1023 | 9.85e-07 | NA | 3.19e-05 | NA |
7. B | P37624 | Ribosome-associated ATPase | 2.89e-03 | NA | 2.15e-08 | NA |
7. B | Q30V33 | Spermidine/putrescine import ATP-binding protein PotA | 1.24e-10 | NA | 4.17e-14 | NA |
7. B | Q2FJI0 | Methionine import ATP-binding protein MetN 1 | 7.39e-12 | NA | 1.75e-17 | NA |
7. B | Q8ZR89 | Methionine import ATP-binding protein MetN 2 | 5.80e-11 | NA | 4.19e-12 | NA |
7. B | Q146E7 | Taurine import ATP-binding protein TauB 1 | 9.13e-08 | NA | 2.07e-10 | NA |
7. B | Q65QT6 | Maltose/maltodextrin import ATP-binding protein MalK | 6.59e-11 | NA | 2.96e-14 | NA |
7. B | Q82TL6 | Spermidine/putrescine import ATP-binding protein PotA | 1.09e-09 | NA | 8.32e-11 | NA |
7. B | Q6HFB5 | Phosphonates import ATP-binding protein PhnC | 2.66e-11 | NA | 4.56e-10 | NA |
7. B | P63367 | Phosphate import ATP-binding protein PstB 1 | 4.19e-12 | NA | 7.41e-13 | NA |
7. B | Q6LHL2 | Molybdenum import ATP-binding protein ModC | 1.20e-08 | NA | 3.90e-11 | NA |
7. B | Q2W4W1 | Zinc import ATP-binding protein ZnuC | 1.92e-09 | NA | 7.32e-08 | NA |
7. B | Q9WXX0 | Ribose import ATP-binding protein RbsA 1 | 7.06e-04 | NA | 1.20e-08 | NA |
7. B | Q66CQ3 | Methionine import ATP-binding protein MetN 1 | 1.99e-10 | NA | 9.82e-14 | NA |
7. B | A1JIE0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.36e-10 | NA | 6.23e-10 | NA |
7. B | Q323W5 | Glutathione import ATP-binding protein GsiA | 2.60e-04 | NA | 4.39e-11 | NA |
7. B | Q98QE1 | Spermidine/putrescine import ATP-binding protein PotA | 3.39e-04 | NA | 1.60e-04 | NA |
7. B | Q9P7V2 | ATP-binding cassette transporter abc4 | 1.89e-15 | NA | 9.59e-25 | NA |
7. B | P54933 | ATP-binding transport protein SmoK | 1.06e-10 | NA | 2.55e-13 | NA |
7. B | Q6LK87 | Maltose/maltodextrin import ATP-binding protein MalK | 1.63e-11 | NA | 3.44e-12 | NA |
7. B | Q6MUF4 | Phosphonates import ATP-binding protein PhnC | 5.68e-11 | NA | 2.54e-11 | NA |
7. B | P96063 | Putative 2-aminoethylphosphonate import ATP-binding protein PhnT | 2.96e-09 | NA | 2.98e-17 | NA |
7. B | Q5M4F3 | Phosphate import ATP-binding protein PstB 1 | 3.08e-12 | NA | 7.92e-16 | NA |
7. B | Q1C6Q8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.39e-10 | NA | 3.34e-08 | NA |
7. B | Q1C7J0 | Arabinose import ATP-binding protein AraG | 6.94e-04 | NA | 1.01e-05 | NA |
7. B | Q87BH8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.44e-08 | NA | 0.001 | NA |
7. B | Q8DU23 | Phosphate import ATP-binding protein PstB 2 | 4.81e-12 | NA | 1.89e-17 | NA |
7. B | Q5WET7 | Phosphate import ATP-binding protein PstB 2 | 1.09e-11 | NA | 2.88e-12 | NA |
7. B | P0C0E2 | Lantibiotic transport ATP-binding protein SrtF | 5.30e-08 | NA | 2.31e-12 | NA |
7. B | F2SHL1 | ABC multidrug transporter MDR1 | 1.83e-02 | NA | 0.004 | NA |
7. B | P47425 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 5.82e-10 | NA | 7.57e-19 | NA |
7. B | A0A0H3JT74 | Metal-staphylopine import system ATP-binding protein CntF | 1.65e-11 | NA | 1.41e-09 | NA |
7. B | P0A9V4 | Lipopolysaccharide export system ATP-binding protein LptB | 7.60e-11 | NA | 1.09e-04 | NA |
7. B | Q7A169 | Spermidine/putrescine import ATP-binding protein PotA | 2.43e-09 | NA | 2.87e-13 | NA |
7. B | Q0BQ80 | Molybdenum import ATP-binding protein ModC | 6.67e-08 | NA | 2.00e-07 | NA |
7. B | Q31YV7 | Galactose/methyl galactoside import ATP-binding protein MglA | 4.74e-04 | NA | 4.98e-06 | NA |
7. B | Q88ZH4 | Teichoic acids export ATP-binding protein TagH | 1.11e-05 | NA | 1.65e-07 | NA |
7. B | P69881 | Phosphate import ATP-binding protein PstB | 7.64e-13 | NA | 4.89e-15 | NA |
7. B | A1SWH9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.12e-11 | NA | 1.13e-11 | NA |
7. B | Q7MFA1 | Hemin import ATP-binding protein HmuV | 2.90e-09 | NA | 4.57e-04 | NA |
7. B | Q3KDW2 | Xylose import ATP-binding protein XylG | 9.68e-04 | NA | 0.002 | NA |
7. B | Q4A8A1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.28e-08 | NA | 1.56e-05 | NA |
7. B | Q926D8 | Zinc uptake system ATP-binding protein ZurA | 6.59e-10 | NA | 6.96e-08 | NA |
7. B | A9YWR6 | ABC transporter G family member STR2 | 8.81e-03 | NA | 6.22e-04 | NA |
7. B | Q85A69 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.09e-10 | NA | 2.06e-09 | NA |
7. B | Q03A07 | Methionine import ATP-binding protein MetN | 6.04e-11 | NA | 9.82e-17 | NA |
7. B | Q1R5H8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.99e-10 | NA | 5.11e-06 | NA |
7. B | Q6XYZ4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 5.17e-11 | NA | 3.72e-15 | NA |
7. B | Q28P50 | Ribose import ATP-binding protein RbsA | 1.09e-03 | NA | 1.86e-06 | NA |
7. B | Q9JZW0 | Sulfate/thiosulfate import ATP-binding protein CysA | 5.60e-10 | NA | 8.42e-14 | NA |
7. B | Q6LUY1 | Xylose import ATP-binding protein XylG | 8.59e-04 | NA | 2.49e-04 | NA |
7. B | Q74LQ3 | Phosphonates import ATP-binding protein PhnC | 9.94e-12 | NA | 1.54e-11 | NA |
7. B | Q97KD5 | Methionine import ATP-binding protein MetN | 1.52e-10 | NA | 4.38e-11 | NA |
7. B | P94440 | Linearmycin resistance ATP-binding protein LnrL | 2.65e-11 | NA | 1.90e-05 | NA |
7. B | Q1CGD7 | Macrolide export ATP-binding/permease protein MacB 2 | 2.61e-02 | NA | 5.34e-10 | NA |
7. B | Q6D3A9 | Glutathione import ATP-binding protein GsiA | 2.86e-04 | NA | 2.09e-10 | NA |
7. B | Q47T99 | Spermidine/putrescine import ATP-binding protein PotA | 1.32e-06 | NA | 2.82e-10 | NA |
7. B | Q9H222 | ATP-binding cassette sub-family G member 5 | 1.09e-02 | NA | 0.001 | NA |
7. B | Q5LZU3 | Phosphate import ATP-binding protein PstB 1 | 3.37e-12 | NA | 7.92e-16 | NA |
7. B | Q13ER6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.69e-11 | NA | 3.97e-08 | NA |
7. B | Q8RDH4 | Dipeptide transport ATP-binding protein DppD | 2.66e-10 | NA | 1.31e-04 | NA |
7. B | P06795 | ATP-dependent translocase ABCB1 | 2.66e-12 | NA | 5.25e-58 | NA |
7. B | Q47A37 | Phosphate import ATP-binding protein PstB | 4.00e-11 | NA | 8.37e-14 | NA |
7. B | Q62GY9 | Arabinose import ATP-binding protein AraG | 6.98e-04 | NA | 0.002 | NA |
7. B | P0C560 | Phosphate import ATP-binding protein PstB | 8.15e-12 | NA | 0.008 | NA |
7. B | Q0BFQ0 | Aliphatic sulfonates import ATP-binding protein SsuB | 4.50e-06 | NA | 4.82e-09 | NA |
7. B | Q5PGK9 | Macrolide export ATP-binding/permease protein MacB | 2.89e-02 | NA | 1.21e-12 | NA |
7. B | Q82B58 | Putative ABC transporter ATP-binding protein SAV_5847 | 2.77e-04 | NA | 7.98e-11 | NA |
7. B | Q6YUU5 | Putative multidrug resistance protein | 0.00e+00 | NA | 6.17e-61 | NA |
7. B | O69063 | Hypophosphite import ATP-binding protein HtxD | 1.46e-09 | NA | 7.00e-08 | NA |
7. B | Q1GBJ0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.78e-09 | NA | 2.97e-14 | NA |
7. B | Q7N2D9 | Autoinducer 2 import ATP-binding protein LsrA | 1.25e-03 | NA | 7.08e-05 | NA |
7. B | Q8DRR9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.12e-09 | NA | 1.31e-15 | NA |
7. B | Q8FFU7 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.49e-03 | NA | 4.77e-06 | NA |
7. B | Q3SJC6 | Molybdenum import ATP-binding protein ModC | 8.84e-08 | NA | 5.67e-08 | NA |
7. B | Q8U8D6 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.32e-07 | NA | 6.48e-17 | NA |
7. B | Q1WVG9 | Methionine import ATP-binding protein MetN | 1.92e-10 | NA | 5.85e-17 | NA |
7. B | Q2FH58 | Nickel import system ATP-binding protein NikE | 4.77e-12 | NA | 1.84e-14 | NA |
7. B | Q7PC88 | ABC transporter G family member 31 | 2.50e-03 | NA | 2.24e-07 | NA |
7. B | Q8DE95 | Thiamine import ATP-binding protein ThiQ | 7.77e-12 | NA | 2.94e-14 | NA |
7. B | Q1IGL4 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.25e-07 | NA | 7.99e-10 | NA |
7. B | P42423 | ABC transporter ATP-binding protein YxdL | 1.01e-10 | NA | 4.03e-11 | NA |
7. B | Q9LK64 | ABC transporter C family member 3 | 1.11e-15 | NA | 4.36e-25 | NA |
7. B | Q8K9M6 | Zinc import ATP-binding protein ZnuC | 2.30e-09 | NA | 3.82e-04 | NA |
7. B | Q81XL3 | Methionine import ATP-binding protein MetN 3 | 1.93e-11 | NA | 5.91e-16 | NA |
7. B | Q9Z8Q8 | Methionine import ATP-binding protein MetN | 3.79e-10 | NA | 3.08e-13 | NA |
7. B | P70970 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.95e-08 | NA | 4.41e-11 | NA |
7. B | Q2KUC0 | Hemin import ATP-binding protein HmuV | 5.22e-10 | NA | 6.52e-06 | NA |
7. B | Q38UT9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.89e-10 | NA | 1.39e-13 | NA |
7. B | Q3JSQ0 | Nod factor export ATP-binding protein I | 1.70e-09 | NA | 2.34e-11 | NA |
7. B | Q2NVW9 | Thiamine import ATP-binding protein ThiQ | 1.36e-11 | NA | 5.26e-12 | NA |
7. B | Q6G5Z1 | Putative ABC transporter ATP-binding protein SAS2569 | 4.41e-05 | NA | 6.40e-10 | NA |
7. B | Q8ELT4 | Phosphate import ATP-binding protein PstB | 4.93e-13 | NA | 2.31e-13 | NA |
7. B | Q9Z3R9 | Alpha-glucoside transport ATP-binding protein AglK | 2.12e-10 | NA | 2.71e-12 | NA |
7. B | Q7WNT8 | Phosphonates import ATP-binding protein PhnC | 2.08e-10 | NA | 1.05e-08 | NA |
7. B | Q92CV8 | Teichoic acids export ATP-binding protein TagH | 7.89e-06 | NA | 3.85e-09 | NA |
7. B | Q7N3A6 | Lipoprotein-releasing system ATP-binding protein LolD | 1.71e-10 | NA | 2.48e-06 | NA |
7. B | Q7VM95 | Methionine import ATP-binding protein MetN | 9.28e-12 | NA | 1.24e-16 | NA |
7. B | Q09428 | ATP-binding cassette sub-family C member 8 | 5.73e-13 | NA | 3.45e-18 | NA |
7. B | Q0TTG6 | Phosphate import ATP-binding protein PstB | 6.12e-13 | NA | 3.03e-14 | NA |
7. B | Q9C6W5 | ABC transporter G family member 14 | 1.69e-02 | NA | 1.71e-08 | NA |
7. B | P0CAT6 | Phosphate import ATP-binding protein PstB | 5.53e-09 | NA | 5.40e-17 | NA |
7. B | Q8EUJ1 | Phosphate import ATP-binding protein PstB | 1.07e-08 | NA | 1.17e-15 | NA |
7. B | Q9HZL7 | Lipoprotein-releasing system ATP-binding protein LolD | 2.53e-10 | NA | 5.25e-10 | NA |
7. B | Q1GKZ0 | Phosphonates import ATP-binding protein PhnC 2 | 1.07e-08 | NA | 3.80e-06 | NA |
7. B | P63388 | Intermembrane phospholipid transport system ATP-binding protein MlaF | 5.00e-13 | NA | 0.015 | NA |
7. B | P0AAH9 | Peptide transport system ATP-binding protein SapF | 8.16e-11 | NA | 1.10e-14 | NA |
7. B | Q2JGF5 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.83e-05 | NA | 6.65e-10 | NA |
7. B | Q8T6H3 | ABC transporter C family member 6 | 0.00e+00 | NA | 7.26e-27 | NA |
7. B | Q9CIS9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.35e-10 | NA | 1.53e-11 | NA |
7. B | Q8K440 | ABC-type organic anion transporter ABCA8B | 3.53e-04 | NA | 1.00e-07 | NA |
7. B | P47426 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.78e-08 | NA | 1.91e-09 | NA |
7. B | P9WQJ5 | Uncharacterized ABC transporter ATP-binding protein Rv1281c | 1.53e-04 | NA | 1.40e-09 | NA |
7. B | P75444 | Putative ABC transporter ATP-binding protein MPN_334 | 8.55e-07 | NA | 7.07e-06 | NA |
7. B | Q9R1S7 | ATP-binding cassette sub-family C member 6 | 0.00e+00 | NA | 6.68e-22 | NA |
7. B | Q80W57 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 2.56e-02 | NA | 1.88e-09 | NA |
7. B | O32487 | Phosphate import ATP-binding protein PstB | 3.47e-12 | NA | 1.43e-17 | NA |
7. B | A5VU87 | Putative peptide import ATP-binding protein BOV_A0348 | 1.52e-09 | NA | 4.48e-10 | NA |
7. B | Q3KCC5 | Fe(3+) ions import ATP-binding protein FbpC | 1.55e-10 | NA | 5.87e-17 | NA |
7. B | Q2KVN7 | Phosphate import ATP-binding protein PstB | 2.83e-12 | NA | 3.80e-16 | NA |
7. B | Q98QH5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.81e-12 | NA | 7.53e-16 | NA |
7. B | Q6MU19 | Spermidine/putrescine import ATP-binding protein PotA | 2.41e-10 | NA | 4.30e-14 | NA |
7. B | Q87JM4 | Macrolide export ATP-binding/permease protein MacB | 4.29e-02 | NA | 1.53e-11 | NA |
7. B | Q6AAX3 | Phosphate import ATP-binding protein PstB | 2.68e-11 | NA | 6.04e-10 | NA |
7. B | Q6FZX3 | Lipoprotein-releasing system ATP-binding protein LolD | 1.18e-10 | NA | 2.36e-08 | NA |
7. B | Q8ZNV7 | Zinc import ATP-binding protein ZnuC | 2.47e-10 | NA | 8.41e-10 | NA |
7. B | Q9LK50 | ABC transporter G family member 26 | 1.99e-02 | NA | 2.64e-08 | NA |
7. B | Q7VKP7 | Molybdenum import ATP-binding protein ModC | 2.44e-08 | NA | 3.84e-09 | NA |
7. B | Q1CBH2 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.38e-10 | NA | 4.16e-10 | NA |
7. B | Q2YIN5 | Molybdenum import ATP-binding protein ModC | 1.74e-07 | NA | 1.49e-05 | NA |
7. B | P57066 | Lipoprotein-releasing system ATP-binding protein LolD | 2.48e-10 | NA | 8.49e-06 | NA |
7. B | Q1J3P2 | Ribose import ATP-binding protein RbsA | 1.03e-03 | NA | 6.85e-04 | NA |
7. B | Q8PP41 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 2.88e-07 | NA | 4.09e-10 | NA |
7. B | Q8DWR3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.71e-09 | NA | 2.30e-10 | NA |
7. B | P9WQI3 | Trehalose import ATP-binding protein SugC | 1.85e-10 | NA | 7.76e-12 | NA |
7. B | Q8EBC3 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 8.99e-10 | NA | 5.36e-12 | NA |
7. B | Q9KD30 | Manganese transport system ATP-binding protein MntB | 9.13e-09 | NA | 1.14e-05 | NA |
7. B | Q7NAQ6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.34e-10 | NA | 1.33e-16 | NA |
7. B | Q5V225 | Phosphate import ATP-binding protein PstB 1 | 2.86e-09 | NA | 1.82e-15 | NA |
7. B | Q1QX72 | Lipoprotein-releasing system ATP-binding protein LolD | 1.56e-10 | NA | 8.47e-07 | NA |
7. B | Q8RD43 | Ribose import ATP-binding protein RbsA | 1.04e-03 | NA | 1.12e-08 | NA |
7. B | A1VZQ5 | Probable ABC transporter ATP-binding protein PEB1C | 8.32e-13 | NA | 6.67e-09 | NA |
7. B | Q4KGX6 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 2.80e-08 | NA | 0.006 | NA |
7. B | Q57DS9 | Lipoprotein-releasing system ATP-binding protein LolD | 9.88e-11 | NA | 2.59e-06 | NA |
7. B | P48255 | Probable ATP-dependent transporter ycf16 | 3.70e-07 | NA | 8.75e-06 | NA |
7. B | Q58206 | Uncharacterized ABC transporter ATP-binding protein MJ0796 | 3.16e-11 | NA | 6.57e-14 | NA |
7. B | P52218 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.85e-07 | NA | 0.048 | NA |
7. B | Q664G2 | Ribose import ATP-binding protein RbsA | 6.92e-04 | NA | 1.56e-04 | NA |
7. B | Q6G529 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.27e-08 | NA | 1.64e-04 | NA |
7. B | A1A967 | Glutathione import ATP-binding protein GsiA | 2.59e-04 | NA | 3.14e-10 | NA |
7. B | Q6KIP2 | Spermidine/putrescine import ATP-binding protein PotA | 5.61e-04 | NA | 3.00e-04 | NA |
7. B | Q83J78 | Nickel import ATP-binding protein NikD | 8.57e-12 | NA | 1.23e-05 | NA |
7. B | P63371 | Phosphate import ATP-binding protein PstB 3 | 7.17e-13 | NA | 1.27e-14 | NA |
7. B | Q9KQB8 | Zinc import ATP-binding protein ZnuC | 7.86e-11 | NA | 1.01e-07 | NA |
7. B | P55339 | ABC-type transporter ATP-binding protein EcsA | 1.01e-07 | NA | 8.42e-06 | NA |
7. B | Q3B2U2 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 7.86e-10 | NA | 3.66e-04 | NA |
7. B | Q7PC81 | ABC transporter G family member 43 | 1.94e-03 | NA | 1.70e-04 | NA |
7. B | Q10RX7 | ABC transporter C family member 13 | 1.67e-15 | NA | 8.17e-26 | NA |
7. B | Q609Z8 | Phosphate import ATP-binding protein PstB | 2.55e-12 | NA | 3.90e-14 | NA |
7. B | Q32AQ1 | Nickel import ATP-binding protein NikE | 6.56e-11 | NA | 3.82e-12 | NA |
7. B | Q2YK63 | Putative peptide import ATP-binding protein BAB2_0817 | 1.46e-09 | NA | 2.24e-10 | NA |
7. B | Q7N6R3 | Molybdenum import ATP-binding protein ModC | 2.82e-08 | NA | 1.80e-11 | NA |
7. B | Q1CJW8 | Macrolide export ATP-binding/permease protein MacB 1 | 6.43e-02 | NA | 3.63e-11 | NA |
7. B | Q9C8T1 | ABC transporter I family member 1 | 1.59e-08 | NA | 3.04e-08 | NA |
7. B | Q0TLD2 | Methionine import ATP-binding protein MetN | 1.45e-11 | NA | 2.50e-14 | NA |
7. B | Q5FUV5 | Lipoprotein-releasing system ATP-binding protein LolD | 1.93e-10 | NA | 0.001 | NA |
7. B | Q4KKK4 | Zinc import ATP-binding protein ZnuC | 1.64e-09 | NA | 2.72e-10 | NA |
7. B | Q9PAP0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.61e-05 | NA | 0.039 | NA |
7. B | P17328 | Glycine betaine/proline betaine transport system ATP-binding protein ProV | 8.75e-11 | NA | 1.10e-18 | NA |
7. B | Q99UA3 | Nickel import system ATP-binding protein NikE | 4.91e-12 | NA | 9.61e-14 | NA |
7. B | Q88EX5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.50e-09 | NA | 2.78e-07 | NA |
7. B | Q8EEV5 | Lipoprotein-releasing system ATP-binding protein LolD | 5.32e-11 | NA | 1.85e-06 | NA |
7. B | Q8DAV6 | Lipoprotein-releasing system ATP-binding protein LolD | 5.75e-10 | NA | 1.22e-06 | NA |
7. B | A1BCE9 | Macrolide export ATP-binding/permease protein MacB 3 | 2.40e-02 | NA | 1.53e-04 | NA |
7. B | Q2YIV5 | Methionine import ATP-binding protein MetN | 2.70e-10 | NA | 1.58e-10 | NA |
7. B | Q8ENU2 | Methionine import ATP-binding protein MetN 2 | 9.28e-12 | NA | 8.17e-16 | NA |
7. B | Q0ST95 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.52e-03 | NA | 6.23e-07 | NA |
7. B | A0K3S5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.90e-10 | NA | 9.87e-10 | NA |
7. B | Q8U3E0 | Putative ABC transporter ATP-binding protein PF0528 | 5.81e-09 | NA | 1.17e-08 | NA |
7. B | Q02785 | ATP-dependent permease PDR12 | 1.63e-03 | NA | 0.002 | NA |
7. B | Q6D5H7 | Methionine import ATP-binding protein MetN 1 | 3.52e-11 | NA | 2.50e-17 | NA |
7. B | Q39CJ6 | Taurine import ATP-binding protein TauB | 9.20e-08 | NA | 1.11e-10 | NA |
7. B | Q9K6Y0 | UvrABC system protein A | 1.93e-01 | NA | 3.02e-04 | NA |
7. B | P0A193 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 2.90e-10 | NA | 3.34e-06 | NA |
7. B | Q65WJ1 | Arabinose import ATP-binding protein AraG | 1.18e-03 | NA | 6.94e-06 | NA |
7. B | Q2LVM2 | Lipoprotein-releasing system ATP-binding protein LolD | 8.34e-12 | NA | 3.69e-13 | NA |
7. B | Q39GT7 | Nod factor export ATP-binding protein I | 1.65e-09 | NA | 1.18e-12 | NA |
7. B | O57872 | Putative ABC transporter ATP-binding protein PH0132 | 4.66e-12 | NA | 5.35e-12 | NA |
7. B | Q9CP06 | Spermidine/putrescine import ATP-binding protein PotA | 1.11e-08 | NA | 1.03e-17 | NA |
7. B | Q8GEH7 | Methionine import ATP-binding protein MetN | 5.51e-10 | NA | 2.80e-11 | NA |
7. B | Q7NRX5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.78e-11 | NA | 2.71e-09 | NA |
7. B | Q6GC27 | Methionine import ATP-binding protein MetN 1 | 9.46e-12 | NA | 5.76e-18 | NA |
7. B | A1JRI2 | Zinc import ATP-binding protein ZnuC | 3.36e-10 | NA | 1.45e-10 | NA |
7. B | Q6D3Q6 | Methionine import ATP-binding protein MetN 2 | 7.43e-11 | NA | 7.67e-20 | NA |
7. B | Q8Z0H0 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.16e-10 | NA | 3.15e-10 | NA |
7. B | Q74E68 | Phosphate import ATP-binding protein PstB | 2.96e-12 | NA | 1.67e-14 | NA |
7. B | Q8FXI7 | Molybdenum import ATP-binding protein ModC | 1.64e-07 | NA | 2.46e-05 | NA |
7. B | Q0VT01 | Macrolide export ATP-binding/permease protein MacB | 4.51e-06 | NA | 3.66e-10 | NA |
7. B | A0B3Z7 | Arabinose import ATP-binding protein AraG 2 | 1.19e-03 | NA | 1.36e-06 | NA |
7. B | Q7M816 | Methionine import ATP-binding protein MetN | 2.09e-10 | NA | 5.44e-10 | NA |
7. B | P9WQJ4 | Uncharacterized ABC transporter ATP-binding protein MT1318 | 1.53e-04 | NA | 1.40e-09 | NA |
7. B | Q5E284 | Zinc import ATP-binding protein ZnuC 2 | 2.46e-09 | NA | 0.007 | NA |
7. B | Q8PUE7 | Putative ABC transporter ATP-binding protein MM_2387 | 8.63e-05 | NA | 4.25e-08 | NA |
7. B | Q9WYI7 | Uncharacterized ABC transporter ATP-binding protein TM_0352 | 1.90e-11 | NA | 6.74e-07 | NA |
7. B | Q92XW1 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 1.35e-09 | NA | 9.32e-13 | NA |
7. B | Q1CK45 | Phosphate import ATP-binding protein PstB 1 | 2.08e-11 | NA | 4.14e-14 | NA |
7. B | Q084V3 | Phosphate import ATP-binding protein PstB | 1.22e-11 | NA | 2.37e-16 | NA |
7. B | P69875 | Spermidine/putrescine import ATP-binding protein PotA | 2.22e-09 | NA | 1.36e-15 | NA |
7. B | Q48HL2 | Phosphonates import ATP-binding protein PhnC 2 | 2.14e-09 | NA | 4.89e-05 | NA |
7. B | Q5HQQ9 | Methionine import ATP-binding protein MetN 2 | 2.01e-11 | NA | 3.66e-14 | NA |
7. B | Q8IUA7 | ATP-binding cassette sub-family A member 9 | 7.14e-04 | NA | 2.39e-09 | NA |
7. B | Q9JVR5 | Macrolide export ATP-binding/permease protein MacB | 2.69e-02 | NA | 1.47e-09 | NA |
7. B | Q2YAD6 | Spermidine/putrescine import ATP-binding protein PotA | 8.17e-10 | NA | 3.07e-09 | NA |
7. B | Q3SGJ8 | Phosphonates import ATP-binding protein PhnC | 4.71e-11 | NA | 2.51e-06 | NA |
7. B | Q3JMW7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.05e-10 | NA | 3.82e-07 | NA |
7. B | Q0TA26 | Maltose/maltodextrin import ATP-binding protein MalK | 4.15e-11 | NA | 3.37e-12 | NA |
7. B | Q02FW7 | Hemin import ATP-binding protein HmuV | 2.60e-10 | NA | 4.36e-04 | NA |
7. B | O81016 | ABC transporter G family member 32 | 3.70e-03 | NA | 6.57e-04 | NA |
7. B | Q2FVF1 | Metal-staphylopine import system ATP-binding protein CntF | 1.39e-11 | NA | 2.32e-09 | NA |
7. B | Q9C8H1 | ABC transporter C family member 11 | 0.00e+00 | NA | 7.86e-24 | NA |
7. B | Q6G1D9 | Putative ABC transporter ATP-binding protein BQ02700 | 3.26e-12 | NA | 7.81e-10 | NA |
7. B | Q669P3 | Lipoprotein-releasing system ATP-binding protein LolD | 1.34e-10 | NA | 5.07e-08 | NA |
7. B | Q0S0Z3 | Fe(3+) ions import ATP-binding protein FbpC 2 | 2.09e-09 | NA | 1.74e-16 | NA |
7. B | Q743D1 | Phosphate import ATP-binding protein PstB | 2.71e-11 | NA | 2.76e-05 | NA |
7. B | P63387 | Intermembrane phospholipid transport system ATP-binding protein MlaF | 4.78e-13 | NA | 0.015 | NA |
7. B | Q8Z824 | Macrolide export ATP-binding/permease protein MacB | 2.93e-02 | NA | 1.27e-12 | NA |
7. B | Q83MC5 | Methionine import ATP-binding protein MetN | 1.30e-11 | NA | 1.34e-13 | NA |
7. B | Q46ZM0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.02e-10 | NA | 9.99e-11 | NA |
7. B | A0A0G2K1Q8 | Phospholipid-transporting ATPase ABCA3 | 1.42e-04 | NA | 1.63e-06 | NA |
7. B | Q81V36 | Ribose import ATP-binding protein RbsA | 5.76e-04 | NA | 2.06e-07 | NA |
7. B | Q8ETV7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.31e-10 | NA | 4.68e-20 | NA |
7. B | Q7UBD0 | Maltose/maltodextrin import ATP-binding protein MalK | 3.79e-11 | NA | 4.78e-12 | NA |
7. B | Q5ZT78 | Lipoprotein-releasing system ATP-binding protein LolD | 5.65e-11 | NA | 2.32e-07 | NA |
7. B | Q9XIE2 | ABC transporter G family member 36 | 7.76e-04 | NA | 1.30e-04 | NA |
7. B | Q7A7E3 | Methionine import ATP-binding protein MetN 1 | 7.65e-12 | NA | 5.64e-17 | NA |
7. B | Q8ST87 | ABC transporter C family member 10 | 0.00e+00 | NA | 4.42e-22 | NA |
7. B | Q88G95 | Molybdenum import ATP-binding protein ModC | 1.20e-07 | NA | 2.57e-09 | NA |
7. B | Q9Z411 | Phosphate import ATP-binding protein PstB | 1.06e-08 | NA | 1.80e-14 | NA |
7. B | Q47Y12 | Phosphate import ATP-binding protein PstB | 2.44e-11 | NA | 6.10e-15 | NA |
7. B | Q312H8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.60e-11 | NA | 5.88e-09 | NA |
7. B | Q6MCV4 | Spermidine/putrescine import ATP-binding protein PotA | 2.24e-09 | NA | 2.16e-12 | NA |
7. B | D3GE74 | ABC transporter G family member STR | 1.48e-02 | NA | 2.47e-07 | NA |
7. B | P94360 | Oligosaccharides import ATP-binding protein MsmX | 6.83e-11 | NA | 5.85e-07 | NA |
7. B | Q9HT73 | Zinc import ATP-binding protein ZnuC | 1.58e-09 | NA | 1.65e-08 | NA |
7. B | Q4ZRC6 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 1.55e-03 | NA | 1.09e-05 | NA |
7. B | Q8UII7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 | 7.48e-11 | NA | 3.28e-07 | NA |
7. B | Q54EK2 | ABC transporter C family member 7 | 1.99e-13 | NA | 3.80e-24 | NA |
7. B | Q6GH21 | Phosphate import ATP-binding protein PstB | 7.40e-13 | NA | 4.58e-15 | NA |
7. B | Q21GS5 | Molybdenum import ATP-binding protein ModC | 8.75e-08 | NA | 2.11e-10 | NA |
7. B | Q63NI4 | Methionine import ATP-binding protein MetN 2 | 1.78e-09 | NA | 5.38e-13 | NA |
7. B | Q73F66 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.13e-09 | NA | 1.20e-11 | NA |
7. B | Q4KB64 | Molybdenum import ATP-binding protein ModC | 1.78e-08 | NA | 2.95e-09 | NA |
7. B | Q92SA1 | Phosphate import ATP-binding protein PstB | 4.52e-09 | NA | 2.56e-15 | NA |
7. B | Q1QQH1 | Phosphate import ATP-binding protein PstB | 9.59e-13 | NA | 1.23e-17 | NA |
7. B | Q8TI16 | Energy-coupling factor transporter ATP-binding protein EcfA | 2.17e-09 | NA | 1.07e-11 | NA |
7. B | Q3M4H6 | Phosphate import ATP-binding protein PstB 4 | 1.27e-12 | NA | 1.45e-09 | NA |
7. B | Q329G7 | Ribose import ATP-binding protein RbsA | 1.07e-03 | NA | 4.61e-06 | NA |
7. B | Q0SRL2 | Spermidine/putrescine import ATP-binding protein PotA | 1.67e-09 | NA | 1.91e-14 | NA |
7. B | P75110 | Putative ABC transporter ATP-binding protein MG467 homolog | 6.75e-06 | NA | 6.65e-06 | NA |
7. B | Q1R4I3 | Ribose import ATP-binding protein RbsA | 7.05e-04 | NA | 1.87e-06 | NA |
7. B | P37388 | Xylose import ATP-binding protein XylG | 6.55e-04 | NA | 0.002 | NA |
7. B | Q3ICT8 | Hemin import ATP-binding protein HmuV | 1.19e-09 | NA | 0.004 | NA |
7. B | P57383 | Lipoprotein-releasing system ATP-binding protein LolD | 2.27e-11 | NA | 1.46e-11 | NA |
7. B | Q57NA5 | Zinc import ATP-binding protein ZnuC | 1.29e-09 | NA | 8.49e-10 | NA |
7. B | Q12BB2 | Phosphate import ATP-binding protein PstB | 3.28e-12 | NA | 3.96e-17 | NA |
7. B | Q8PKT0 | Lipoprotein-releasing system ATP-binding protein LolD | 3.29e-10 | NA | 9.55e-07 | NA |
7. B | Q6BEX0 | Galactofuranose transporter ATP-binding protein YtfR | 8.74e-04 | NA | 1.45e-04 | NA |
7. B | Q8T6J2 | ABC transporter A family member 5 | 5.77e-04 | NA | 5.96e-08 | NA |
7. B | Q96J65 | ATP-binding cassette sub-family C member 12 | 0.00e+00 | NA | 2.25e-29 | NA |
7. B | Q2W7J9 | Phosphate import ATP-binding protein PstB 2 | 6.70e-12 | NA | 1.77e-16 | NA |
7. B | Q8P0V3 | Phosphate import ATP-binding protein PstB 2 | 6.99e-11 | NA | 8.39e-18 | NA |
7. B | Q82G23 | Phosphate import ATP-binding protein PstB | 6.67e-12 | NA | 4.32e-12 | NA |
7. B | P45095 | Dipeptide transport ATP-binding protein DppD | 1.67e-09 | NA | 5.34e-05 | NA |
7. B | Q2UD41 | ABC multidrug transporter atrH | 1.01e-03 | NA | 0.011 | NA |
7. B | Q2YA30 | Phosphate import ATP-binding protein PstB | 1.13e-08 | NA | 6.35e-16 | NA |
7. B | A0R8K9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.26e-09 | NA | 1.96e-11 | NA |
7. B | P21440 | Phosphatidylcholine translocator ABCB4 | 0.00e+00 | NA | 1.11e-57 | NA |
7. B | Q2YJH4 | Zinc import ATP-binding protein ZnuC | 4.56e-09 | NA | 2.41e-06 | NA |
7. B | Q6A6X6 | Methionine import ATP-binding protein MetN | 4.14e-08 | NA | 5.05e-15 | NA |
7. B | A1AC19 | Zinc import ATP-binding protein ZnuC | 3.05e-10 | NA | 8.36e-11 | NA |
7. B | Q8A853 | Phosphate import ATP-binding protein PstB | 6.38e-13 | NA | 1.71e-17 | NA |
7. B | Q5WKG4 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.09e-07 | NA | 4.84e-20 | NA |
7. B | P0A9U4 | Probable ATP-binding protein YbiT | 1.04e-05 | NA | 7.61e-11 | NA |
7. B | P0AAG8 | Galactose/methyl galactoside import ATP-binding protein MglA | 8.10e-04 | NA | 5.15e-06 | NA |
7. B | Q1C0D5 | Xylose import ATP-binding protein XylG | 6.14e-04 | NA | 0.005 | NA |
7. B | Q8PM59 | Phosphate import ATP-binding protein PstB | 1.68e-12 | NA | 6.74e-17 | NA |
7. B | Q0SXQ1 | Maltose/maltodextrin import ATP-binding protein MalK | 4.52e-11 | NA | 3.00e-12 | NA |
7. B | P42332 | Bacitracin transport ATP-binding protein BcrA | 1.13e-07 | NA | 3.42e-12 | NA |
7. B | Q3JPZ4 | Methionine import ATP-binding protein MetN 1 | 2.13e-08 | NA | 3.34e-13 | NA |
7. B | H6WS93 | Pleiotropic drug resistance protein 1 | 1.52e-03 | NA | 0.001 | NA |
7. B | Q045Z7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.89e-08 | NA | 1.30e-10 | NA |
7. B | Q6N0I5 | Phosphate import ATP-binding protein PstB | 1.28e-12 | NA | 1.06e-18 | NA |
7. B | Q2FH51 | Phosphate import ATP-binding protein PstB | 7.39e-13 | NA | 4.89e-15 | NA |
7. B | Q668Q3 | Fe(3+) ions import ATP-binding protein FbpC | 5.44e-09 | NA | 1.75e-15 | NA |
7. B | Q9CIN4 | Methionine import ATP-binding protein MetN | 1.61e-10 | NA | 9.19e-16 | NA |
7. B | Q1B677 | Methionine import ATP-binding protein MetN | 2.09e-11 | NA | 1.91e-14 | NA |
7. B | Q73R11 | Putative ABC transporter ATP-binding protein TDE_0282 | 9.76e-05 | NA | 8.11e-13 | NA |
7. B | Q3AAA4 | Phosphate import ATP-binding protein PstB | 4.56e-13 | NA | 7.52e-12 | NA |
7. B | B6RAL1 | ABC transporter patM | 7.33e-04 | NA | 5.97e-04 | NA |
7. B | P39109 | Metal resistance protein YCF1 | 5.55e-16 | NA | 2.39e-26 | NA |
7. B | Q31VE6 | Nickel import ATP-binding protein NikE | 9.31e-11 | NA | 1.16e-11 | NA |
7. B | Q13CI6 | Molybdenum import ATP-binding protein ModC | 2.02e-07 | NA | 1.72e-08 | NA |
7. B | Q6MG08 | ATP-binding cassette sub-family F member 1 | 4.14e-04 | NA | 0.004 | NA |
7. B | Q3AJS9 | Phosphate import ATP-binding protein PstB | 8.79e-11 | NA | 4.09e-14 | NA |
7. B | Q1QXH6 | Phosphate import ATP-binding protein PstB 1 | 1.23e-11 | NA | 4.21e-14 | NA |
7. B | P0A9U1 | Probable multidrug ABC transporter ATP-binding protein YbhF | 2.70e-05 | NA | 2.34e-09 | NA |
7. B | P33360 | Glycine betaine uptake system ATP-binding protein YehX | 4.19e-12 | NA | 1.41e-09 | NA |
7. B | Q65P76 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.68e-09 | NA | 2.48e-12 | NA |
7. B | Q02856 | Probable ATP-dependent transporter ycf16 | 6.59e-10 | NA | 4.99e-04 | NA |
7. B | P32568 | Protein SNQ2 | 2.84e-03 | NA | 5.64e-05 | NA |
7. B | Q5E882 | Thiamine import ATP-binding protein ThiQ | 1.02e-12 | NA | 3.89e-15 | NA |
7. B | Q8Y651 | Manganese transport system ATP-binding protein MntB | 1.04e-08 | NA | 9.16e-08 | NA |
7. B | I1RL06 | ZEB2-regulated ABC transporter 1 | 1.17e-03 | NA | 0.001 | NA |
7. B | Q663R5 | Phosphate import ATP-binding protein PstB 2 | 1.99e-11 | NA | 3.27e-16 | NA |
7. B | Q2YYM5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.46e-08 | NA | 1.65e-16 | NA |
7. B | Q72PE5 | Sulfate/thiosulfate import ATP-binding protein CysA | 9.93e-10 | NA | 6.24e-10 | NA |
7. B | Q2SW38 | Xylose import ATP-binding protein XylG | 5.63e-04 | NA | 3.63e-04 | NA |
7. B | Q8NWT6 | Nickel import system ATP-binding protein NikE | 5.56e-12 | NA | 1.64e-14 | NA |
7. B | P57031 | Lipoprotein-releasing system ATP-binding protein LolD | 2.98e-10 | NA | 1.80e-05 | NA |
7. B | Q9FVV9 | Probable non-intrinsic ABC protein 5 | 5.79e-06 | NA | 1.64e-08 | NA |
7. B | Q2RFS8 | Energy-coupling factor transporter ATP-binding protein EcfA | 1.06e-09 | NA | 1.32e-18 | NA |
7. B | Q87G59 | Phosphate import ATP-binding protein PstB 2 | 2.62e-13 | NA | 1.30e-16 | NA |
7. B | Q8PNN4 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.93e-10 | NA | 1.18e-10 | NA |
7. B | Q3SI20 | Lipoprotein-releasing system ATP-binding protein LolD | 7.93e-11 | NA | 0.031 | NA |
7. B | P45073 | Lipopolysaccharide export system ATP-binding protein LptB | 1.15e-10 | NA | 2.33e-05 | NA |
7. B | Q6G9I0 | Nickel import system ATP-binding protein NikD | 6.04e-10 | NA | 1.10e-09 | NA |
7. B | Q0HNQ5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 9.45e-09 | NA | 0.006 | NA |
7. B | Q2KDV1 | Phosphonates import ATP-binding protein PhnC | 8.52e-11 | NA | 7.90e-09 | NA |
7. B | Q7VNG4 | Spermidine/putrescine import ATP-binding protein PotA | 1.85e-10 | NA | 1.80e-16 | NA |
7. B | Q03I83 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.91e-10 | NA | 1.26e-15 | NA |
7. B | Q7A848 | Phosphonates import ATP-binding protein PhnC | 6.46e-11 | NA | 5.18e-12 | NA |
7. B | Q3Z5F8 | Methionine import ATP-binding protein MetN | 1.45e-11 | NA | 2.41e-14 | NA |
7. B | Q6FQN3 | ABC multidrug transporter SNQ2 | 4.43e-03 | NA | 1.23e-05 | NA |
7. B | Q487I2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.20e-08 | NA | 0.016 | NA |
7. B | Q5KX47 | Phosphate import ATP-binding protein PstB | 2.72e-13 | NA | 2.81e-13 | NA |
7. B | Q64SM5 | Phosphate import ATP-binding protein PstB | 5.66e-13 | NA | 1.53e-18 | NA |
7. B | Q2SJK0 | Lipoprotein-releasing system ATP-binding protein LolD | 7.00e-11 | NA | 3.36e-04 | NA |
7. B | Q3M5J9 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.36e-07 | NA | 5.83e-14 | NA |
7. B | P9WQI4 | Uncharacterized ABC transporter ATP-binding protein MT2640 | 1.03e-08 | NA | 7.74e-05 | NA |
7. B | Q767L0 | ATP-binding cassette sub-family F member 1 | 5.39e-04 | NA | 0.005 | NA |
7. B | Q9I6L0 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.03e-10 | NA | 3.41e-15 | NA |
7. B | Q81Y10 | Phosphonates import ATP-binding protein PhnC | 3.27e-11 | NA | 5.00e-10 | NA |
7. B | Q9EUS2 | Phosphate import ATP-binding protein PstB | 5.49e-12 | NA | 1.02e-12 | NA |
7. B | Q9ZCF9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.38e-08 | NA | 7.91e-04 | NA |
7. B | E9Q236 | ATP-binding cassette sub-family C member 4 | 2.22e-16 | NA | 7.19e-27 | NA |
7. B | P63370 | Phosphate import ATP-binding protein PstB 2 | 2.24e-12 | NA | 1.73e-17 | NA |
7. B | Q8Y4E9 | Phosphate import ATP-binding protein PstB 2 | 1.32e-12 | NA | 2.02e-15 | NA |
7. B | A0A0H2VBH0 | Probable ATP-binding protein YheS | 1.69e-04 | NA | 2.70e-07 | NA |
7. B | Q1J0N0 | Phosphate import ATP-binding protein PstB | 4.79e-11 | NA | 1.72e-12 | NA |
7. B | Q31UX2 | Phosphate import ATP-binding protein PstB | 2.31e-11 | NA | 5.39e-19 | NA |
7. B | P08720 | Nod factor export ATP-binding protein I | 1.65e-09 | NA | 1.02e-09 | NA |
7. B | A3CVD3 | Energy-coupling factor transporter ATP-binding protein EcfA | 1.11e-08 | NA | 1.05e-09 | NA |
7. B | Q88PM5 | Phosphonates import ATP-binding protein PhnC | 3.09e-10 | NA | 8.17e-06 | NA |
7. B | Q5DZC6 | Maltose/maltodextrin import ATP-binding protein MalK | 1.03e-10 | NA | 2.77e-12 | NA |
7. B | Q9CF44 | Ribose import ATP-binding protein RbsA | 1.08e-03 | NA | 2.27e-05 | NA |
7. B | Q1BR30 | Methionine import ATP-binding protein MetN 2 | 1.29e-07 | NA | 1.31e-13 | NA |
7. B | Q9FLX5 | ABC transporter G family member 8 | 4.34e-02 | NA | 6.31e-09 | NA |
7. B | Q03CA4 | Ribose import ATP-binding protein RbsA | 1.07e-03 | NA | 4.12e-08 | NA |
7. B | Q9KN92 | Phosphate import ATP-binding protein PstB 2 | 3.59e-12 | NA | 7.17e-16 | NA |
7. B | Q92LU2 | Molybdenum import ATP-binding protein ModC | 9.32e-08 | NA | 1.21e-06 | NA |
7. B | Q55DW4 | ABC transporter G family member 1 | 1.12e-02 | NA | 2.61e-09 | NA |
7. B | Q2SVP3 | Nod factor export ATP-binding protein I | 1.90e-09 | NA | 2.81e-12 | NA |
7. B | P73788 | Phosphate import ATP-binding protein PstB 3 | 1.48e-12 | NA | 6.70e-14 | NA |
7. B | Q1LLP5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.22e-10 | NA | 7.51e-09 | NA |
7. B | Q7VN12 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.26e-08 | NA | 6.74e-08 | NA |
7. B | P72297 | Octopine permease ATP-binding protein P | 8.72e-12 | NA | 9.41e-09 | NA |
7. B | Q5WKL3 | Methionine import ATP-binding protein MetN 1 | 3.78e-12 | NA | 4.91e-18 | NA |
7. B | Q9KU04 | Phosphate import ATP-binding protein PstB 1 | 1.70e-11 | NA | 6.69e-18 | NA |
7. B | Q58762 | Molybdate/tungstate import ATP-binding protein WtpC | 7.94e-10 | NA | 3.87e-12 | NA |
7. B | Q92L55 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.24e-07 | NA | 6.23e-06 | NA |
7. B | Q217L2 | Macrolide export ATP-binding/permease protein MacB | 4.60e-02 | NA | 6.91e-11 | NA |
7. B | P55662 | Probable amino-acid ABC transporter ATP-binding protein y4tH | 7.71e-13 | NA | 5.68e-08 | NA |
7. B | Q9A502 | Methionine import ATP-binding protein MetN | 2.56e-11 | NA | 7.63e-15 | NA |
7. B | Q4ZV10 | Macrolide export ATP-binding/permease protein MacB 1 | 7.62e-02 | NA | 3.33e-09 | NA |
7. B | Q5FKL2 | Methionine import ATP-binding protein MetN | 2.02e-10 | NA | 3.34e-17 | NA |
7. B | Q73KK2 | Galactose/methyl galactoside import ATP-binding protein MglA | 6.77e-04 | NA | 7.39e-06 | NA |
7. B | P0A9S8 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 3.29e-10 | NA | 2.30e-07 | NA |
7. B | Q7MU65 | Lipoprotein-releasing system ATP-binding protein LolD | 6.02e-11 | NA | 2.20e-08 | NA |
7. B | Q890R2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.69e-11 | NA | 2.97e-12 | NA |
7. B | Q67RE7 | Phosphate import ATP-binding protein PstB 2 | 1.18e-12 | NA | 8.93e-12 | NA |
7. B | Q5WDP1 | Methionine import ATP-binding protein MetN 3 | 3.01e-11 | NA | 1.27e-13 | NA |
7. B | Q2G0V2 | Methionine import ATP-binding protein MetN 1 | 6.77e-12 | NA | 1.75e-17 | NA |
7. B | Q8FCQ2 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.44e-10 | NA | 5.30e-06 | NA |
7. B | Q1JJD0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.78e-10 | NA | 1.28e-13 | NA |
7. B | Q637E2 | Phosphonates import ATP-binding protein PhnC | 1.42e-11 | NA | 6.37e-10 | NA |
7. B | Q1AS06 | Spermidine/putrescine import ATP-binding protein PotA | 1.52e-07 | NA | 3.37e-10 | NA |
7. B | Q3JYF5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.48e-10 | NA | 3.47e-13 | NA |
7. B | Q1JJC9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.95e-09 | NA | 7.81e-12 | NA |
7. B | Q6D2D5 | Phosphate import ATP-binding protein PstB 1 | 2.10e-11 | NA | 1.66e-11 | NA |
7. B | D8KFN1 | Methionine import ATP-binding protein MetN | 1.50e-10 | NA | 4.18e-17 | NA |
7. B | Q88AS5 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.04e-10 | NA | 1.38e-14 | NA |
7. B | P44986 | Thiamine import ATP-binding protein ThiQ | 2.14e-10 | NA | 3.59e-15 | NA |
7. B | Q9RRL9 | Putative ABC transporter ATP-binding protein DR_2469 | 1.33e-11 | NA | 9.27e-09 | NA |
7. B | P47326 | Oligopeptide transport ATP-binding protein OppF | 5.46e-04 | NA | 1.24e-06 | NA |
7. B | Q8REG7 | Phosphonates import ATP-binding protein PhnC | 3.84e-11 | NA | 1.09e-06 | NA |
7. B | P36619 | Leptomycin B resistance protein pmd1 | 0.00e+00 | NA | 3.68e-62 | NA |
7. B | Q97EK9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.14e-09 | NA | 1.64e-16 | NA |
7. B | Q9L1C3 | Methionine import ATP-binding protein MetN | 1.21e-10 | NA | 9.23e-14 | NA |
7. B | Q5LVM5 | Taurine import ATP-binding protein TauB | 1.16e-07 | NA | 5.45e-10 | NA |
7. B | Q1CE65 | Hemin import ATP-binding protein HmuV | 1.66e-09 | NA | 9.24e-06 | NA |
7. B | P63386 | Intermembrane phospholipid transport system ATP-binding protein MlaF | 6.44e-13 | NA | 0.015 | NA |
7. B | Q3A6U0 | Phosphate import ATP-binding protein PstB | 3.38e-12 | NA | 7.92e-12 | NA |
7. B | Q6NBT1 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.11e-10 | NA | 2.66e-13 | NA |
7. B | Q2JLH7 | Phosphonates import ATP-binding protein PhnC 2 | 1.67e-10 | NA | 8.53e-14 | NA |
7. B | Q8ZCX5 | Phosphate import ATP-binding protein PstB 1 | 1.74e-11 | NA | 4.14e-14 | NA |
7. B | Q3MGT2 | Phosphonates import ATP-binding protein PhnC | 7.51e-10 | NA | 3.61e-10 | NA |
7. B | Q0TLS2 | Thiamine import ATP-binding protein ThiQ | 1.69e-11 | NA | 3.78e-10 | NA |
7. B | Q8ES39 | Putative ABC transporter ATP-binding protein OB0804 | 9.43e-05 | NA | 6.09e-08 | NA |
7. B | P63299 | Galactofuranose transporter ATP-binding protein YtfR | 1.57e-03 | NA | 1.52e-04 | NA |
7. B | Q7N0N3 | Putative ABC transporter ATP-binding protein plu3849 | 2.66e-12 | NA | 5.04e-13 | NA |
7. B | Q8YBN5 | Putative peptide import ATP-binding protein BMEII0864 | 1.42e-10 | NA | 8.55e-15 | NA |
7. B | Q8K441 | ATP-binding cassette sub-family A member 6 | 1.57e-03 | NA | 3.11e-05 | NA |
7. B | Q0B775 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 | 9.80e-03 | NA | 7.10e-05 | NA |
7. B | Q2K353 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 7.92e-04 | NA | 7.10e-05 | NA |
7. B | Q54P13 | ABC transporter C family member 8 | 0.00e+00 | NA | 9.46e-26 | NA |
7. B | Q577J4 | Putative peptide import ATP-binding protein BruAb2_0797 | 3.13e-10 | NA | 8.55e-15 | NA |
7. B | Q92CK1 | Putative ABC transporter ATP-binding protein lin1170 | 4.99e-10 | NA | 2.20e-07 | NA |
7. B | A0QQ70 | Phosphate-import ATP-binding protein PhnC | 1.81e-10 | NA | 0.017 | NA |
7. B | Q1RKE4 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.43e-08 | NA | 0.001 | NA |
7. B | Q5MZ54 | Bicarbonate transport ATP-binding protein CmpC | 8.92e-06 | NA | 1.73e-06 | NA |
7. B | A1JPQ1 | Vitamin B12 import ATP-binding protein BtuD | 2.10e-08 | NA | 1.73e-06 | NA |
7. B | B8GYG4 | Phosphate import ATP-binding protein PstB | 4.61e-09 | NA | 5.40e-17 | NA |
7. B | Q2VYP7 | Phosphate import ATP-binding protein PstB 3 | 1.46e-12 | NA | 1.84e-16 | NA |
7. B | Q9STT5 | ABC transporter A family member 7 | 2.87e-05 | NA | 3.05e-06 | NA |
7. B | P0A9R9 | Cell division ATP-binding protein FtsE | 1.42e-10 | NA | 2.11e-11 | NA |
7. B | P75957 | Lipoprotein-releasing system ATP-binding protein LolD | 1.37e-10 | NA | 2.87e-08 | NA |
7. B | Q7PC83 | ABC transporter G family member 41 | 1.40e-03 | NA | 3.97e-04 | NA |
7. B | Q6GDC0 | Putative ABC transporter ATP-binding protein SAR2766 | 5.58e-05 | NA | 6.18e-10 | NA |
7. B | Q6N5P8 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 9.73e-11 | NA | 1.16e-04 | NA |
7. B | A5VU86 | Putative peptide import ATP-binding protein BOV_A0347 | 1.37e-10 | NA | 8.55e-15 | NA |
7. B | Q6NA00 | Phosphonates import ATP-binding protein PhnC 2 | 7.50e-07 | NA | 1.63e-05 | NA |
7. B | Q07DW5 | Cystic fibrosis transmembrane conductance regulator | 7.54e-10 | NA | 7.71e-20 | NA |
7. B | Q1C970 | Methionine import ATP-binding protein MetN 2 | 2.01e-10 | NA | 9.82e-14 | NA |
7. B | Q8PHQ3 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.56e-07 | NA | 1.65e-05 | NA |
7. B | P44531 | Fe(3+) ions import ATP-binding protein FbpC 1 | 1.36e-10 | NA | 1.35e-13 | NA |
7. B | Q07733 | Oligopeptide transport ATP-binding protein OppD | 1.31e-09 | NA | 5.27e-09 | NA |
7. B | Q2U0M6 | ABC multidrug transporter atrG | 3.50e-03 | NA | 6.24e-04 | NA |
7. B | Q8RHL0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.19e-09 | NA | 1.02e-16 | NA |
7. B | Q720Z5 | Teichoic acids export ATP-binding protein TagH | 9.24e-06 | NA | 1.71e-09 | NA |
7. B | A9R074 | Autoinducer 2 import ATP-binding protein LsrA | 1.20e-03 | NA | 7.59e-05 | NA |
7. B | Q84TH5 | ABC transporter G family member 25 | 8.75e-03 | NA | 7.08e-11 | NA |
7. B | A0K6Q0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 8.45e-04 | NA | 2.52e-05 | NA |
7. B | Q2K8C8 | Fe(3+) ions import ATP-binding protein FbpC | 4.25e-09 | NA | 1.33e-14 | NA |
7. B | Q5FM63 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 3.46e-09 | NA | 1.41e-15 | NA |
7. B | Q1WUX2 | Phosphate import ATP-binding protein PstB 1 | 1.00e-11 | NA | 4.46e-15 | NA |
7. B | Q042G7 | Spermidine/putrescine import ATP-binding protein PotA | 6.84e-10 | NA | 2.46e-16 | NA |
7. B | Q5KVK2 | Methionine import ATP-binding protein MetN | 2.36e-11 | NA | 1.88e-13 | NA |
7. B | Q1RDS4 | Aliphatic sulfonates import ATP-binding protein SsuB | 4.21e-08 | NA | 1.19e-12 | NA |
7. B | Q4UV71 | Lipoprotein-releasing system ATP-binding protein LolD | 9.08e-08 | NA | 1.11e-05 | NA |
7. B | E9Q876 | Glucosylceramide transporter ABCA12 | 2.89e-03 | NA | 2.97e-06 | NA |
7. B | P0A2U9 | Oligopeptide transport ATP-binding protein AmiE | 7.11e-10 | NA | 2.03e-07 | NA |
7. B | Q8R9L8 | Putative ABC transporter ATP-binding protein TTE1589 | 1.85e-05 | NA | 3.69e-11 | NA |
7. B | Q8CUY0 | Phosphonates import ATP-binding protein PhnC 2 | 1.43e-10 | NA | 2.65e-06 | NA |
7. B | Q326G9 | Thiamine import ATP-binding protein ThiQ | 1.58e-11 | NA | 6.85e-11 | NA |
7. B | Q87H79 | Ribose import ATP-binding protein RbsA | 8.85e-04 | NA | 0.001 | NA |
7. B | Q2K164 | Taurine import ATP-binding protein TauB | 1.33e-07 | NA | 2.22e-04 | NA |
7. B | Q63S19 | Methionine import ATP-binding protein MetN 1 | 1.93e-08 | NA | 3.34e-13 | NA |
7. B | Q4UJW5 | Zinc import ATP-binding protein ZnuC | 9.02e-10 | NA | 2.15e-11 | NA |
7. B | Q827Y0 | Methionine import ATP-binding protein MetN | 1.34e-10 | NA | 2.81e-15 | NA |
7. B | P08007 | Oligopeptide transport ATP-binding protein OppF | 5.71e-10 | NA | 3.63e-12 | NA |
7. B | Q7NAQ7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.18e-06 | NA | 1.35e-07 | NA |
7. B | Q2RWI9 | Molybdenum import ATP-binding protein ModC | 3.06e-08 | NA | 3.39e-10 | NA |
7. B | B2K3G1 | Autoinducer 2 import ATP-binding protein LsrA | 8.72e-04 | NA | 5.14e-05 | NA |
7. B | Q7N9U4 | Phosphate import ATP-binding protein PstB | 1.88e-11 | NA | 1.17e-16 | NA |
7. B | Q54TV2 | ABC transporter G family member 5 | 5.42e-03 | NA | 6.53e-05 | NA |
7. B | Q6W2B1 | Taurine import ATP-binding protein TauB | 3.06e-08 | NA | 1.31e-07 | NA |
7. B | Q02QT1 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.64e-07 | NA | 2.34e-11 | NA |
7. B | Q4FTM3 | Lipoprotein-releasing system ATP-binding protein LolD | 1.15e-10 | NA | 2.06e-10 | NA |
7. B | Q05596 | Cobalt import ATP-binding protein CbiO | 1.24e-08 | NA | 0.038 | NA |
7. B | Q48QM3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.43e-10 | NA | 1.26e-13 | NA |
7. B | Q9CP24 | Zinc import ATP-binding protein ZnuC | 1.48e-10 | NA | 4.26e-07 | NA |
7. B | Q2JMJ0 | Phosphate import ATP-binding protein PstB 1 | 4.77e-09 | NA | 2.24e-12 | NA |
7. B | Q1R3Q1 | Maltose/maltodextrin import ATP-binding protein MalK | 2.52e-11 | NA | 4.70e-12 | NA |
7. B | Q83RS0 | Lipoprotein-releasing system ATP-binding protein LolD | 1.29e-10 | NA | 8.43e-08 | NA |
7. B | P63372 | Phosphate import ATP-binding protein PstB 3 | 7.46e-13 | NA | 1.27e-14 | NA |
7. B | Q8P2M5 | Probable ABC transporter ATP-binding protein spyM18_0273 | 2.52e-09 | NA | 2.19e-06 | NA |
7. B | Q74K65 | Spermidine/putrescine import ATP-binding protein PotA | 6.83e-10 | NA | 1.04e-16 | NA |
7. B | P39456 | L-cystine import ATP-binding protein TcyC | 6.26e-12 | NA | 5.10e-12 | NA |
7. B | Q52733 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.73e-07 | NA | 8.38e-07 | NA |
7. B | Q5PKZ8 | Maltose/maltodextrin import ATP-binding protein MalK | 2.82e-11 | NA | 1.28e-12 | NA |
7. B | Q45978 | ATP-binding protein Uup | 4.52e-04 | NA | 9.44e-06 | NA |
7. B | Q3K199 | Phosphate import ATP-binding protein PstB 1 | 4.16e-12 | NA | 7.41e-13 | NA |
7. B | Q15QL7 | Phosphate import ATP-binding protein PstB | 2.93e-11 | NA | 1.18e-13 | NA |
7. B | Q5M1F6 | Methionine import ATP-binding protein MetN | 5.21e-11 | NA | 5.71e-17 | NA |
7. B | Q2RPB4 | Macrolide export ATP-binding/permease protein MacB | 1.72e-06 | NA | 2.21e-11 | NA |
7. B | Q9TUQ2 | Cystic fibrosis transmembrane conductance regulator | 8.18e-10 | NA | 2.47e-19 | NA |
7. B | P0A9S9 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 1.64e-11 | NA | 2.30e-07 | NA |
7. B | Q9CN78 | Lipoprotein-releasing system ATP-binding protein LolD | 1.81e-10 | NA | 3.80e-07 | NA |
7. B | P69879 | Phosphate import ATP-binding protein PstB | 7.20e-13 | NA | 4.89e-15 | NA |
7. B | Q8KFE9 | Macrolide export ATP-binding/permease protein MacB | 2.42e-06 | NA | 2.16e-08 | NA |
7. B | Q4ZU82 | Phosphonates import ATP-binding protein PhnC 2 | 5.26e-08 | NA | 2.95e-05 | NA |
7. B | P54591 | Uncharacterized ABC transporter ATP-binding protein YhcG | 7.71e-09 | NA | 0.001 | NA |
7. B | Q8PYH5 | Putative ABC transporter ATP-binding protein MM_0887 | 7.98e-09 | NA | 1.34e-09 | NA |
7. B | Q6D2F6 | Fe(3+) ions import ATP-binding protein FbpC 2 | 2.55e-10 | NA | 1.18e-12 | NA |
7. B | Q9RKC6 | Putative ABC transporter ATP-binding protein SCO3161 | 7.47e-11 | NA | 1.20e-06 | NA |
7. B | P0CZ36 | Phosphate import ATP-binding protein PstB 1 | 8.54e-12 | NA | 2.82e-09 | NA |
7. B | P77509 | Uncharacterized ABC transporter ATP-binding protein YphE | 9.49e-04 | NA | 8.57e-09 | NA |
7. B | Q1BWL4 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 2.13e-06 | NA | 1.11e-09 | NA |
7. B | Q18CI9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 6.65e-11 | NA | 6.33e-15 | NA |
7. B | Q6ADG4 | Phosphate import ATP-binding protein PstB | 1.65e-11 | NA | 1.66e-13 | NA |
7. B | Q0TGX4 | Zinc import ATP-binding protein ZnuC | 2.97e-10 | NA | 8.36e-11 | NA |
7. B | A0KAV6 | Taurine import ATP-binding protein TauB | 8.85e-08 | NA | 2.58e-10 | NA |
7. B | Q9K0N7 | Macrolide export ATP-binding/permease protein MacB | 2.68e-02 | NA | 2.06e-09 | NA |
7. B | P45127 | Energy-dependent translational throttle protein EttA | 2.30e-04 | NA | 0.007 | NA |
7. B | Q3KFY6 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.69e-09 | NA | 1.39e-09 | NA |
7. B | Q03ZL6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.16e-10 | NA | 1.79e-13 | NA |
7. B | Q8Z8W8 | Putative 2-aminoethylphosphonate import ATP-binding protein PhnT | 2.84e-09 | NA | 1.47e-17 | NA |
7. B | Q7W8Q6 | Phosphate import ATP-binding protein PstB | 1.10e-11 | NA | 4.77e-16 | NA |
7. B | Q8DG84 | Putative ABC transporter ATP-binding protein tll2439 | 6.99e-09 | NA | 1.07e-12 | NA |
7. B | Q2FYQ7 | Nickel import system ATP-binding protein NikD | 5.98e-10 | NA | 1.10e-09 | NA |
7. B | Q5PBX2 | Lipoprotein-releasing system ATP-binding protein LolD | 1.44e-10 | NA | 3.77e-11 | NA |
7. B | Q48PV0 | Zinc import ATP-binding protein ZnuC | 1.33e-09 | NA | 4.64e-06 | NA |
7. B | Q86UQ4 | ATP-binding cassette sub-family A member 13 | NA | NA | 1.84e-08 | NA |
7. B | Q8YDR7 | Putative ATP-binding protein BMEII0108 | 2.86e-07 | NA | 0.004 | NA |
7. B | P40024 | ABC transporter ATP-binding protein ARB1 | 2.45e-05 | NA | 2.00e-05 | NA |
7. B | P55604 | Uncharacterized ABC transporter ATP-binding protein y4oS | 3.18e-08 | NA | 1.25e-11 | NA |
7. B | Q87S48 | Phosphate import ATP-binding protein PstB 1 | 2.45e-11 | NA | 7.68e-17 | NA |
7. B | Q5HC57 | Lipoprotein-releasing system ATP-binding protein LolD | 4.30e-10 | NA | 1.97e-08 | NA |
7. B | Q1M5X4 | Ribose import ATP-binding protein RbsA 2 | 1.34e-03 | NA | 3.17e-05 | NA |
7. B | Q81ZF5 | Methionine import ATP-binding protein MetN 2 | 2.00e-11 | NA | 1.67e-17 | NA |
7. B | Q660M8 | Spermidine/putrescine import ATP-binding protein PotA | 1.51e-09 | NA | 7.56e-13 | NA |
7. B | Q046T0 | Phosphonates import ATP-binding protein PhnC | 1.32e-11 | NA | 1.46e-11 | NA |
7. B | O07016 | Uncharacterized ABC transporter ATP-binding protein YvfR | 9.72e-09 | NA | 5.06e-10 | NA |
7. B | Q64Z80 | Lipoprotein-releasing system ATP-binding protein LolD | 6.95e-11 | NA | 9.33e-09 | NA |
7. B | A7ZLX1 | Putative autoinducer 2 import ATP-binding protein LsrA homolog | 6.49e-08 | NA | 3.11e-06 | NA |
7. B | Q93KD4 | Tungstate uptake system ATP-binding protein TupC | 6.09e-11 | NA | 0.002 | NA |
7. B | Q398W2 | Ribose import ATP-binding protein RbsA 2 | 1.45e-03 | NA | 0.002 | NA |
7. B | Q6D734 | Fe(3+) ions import ATP-binding protein FbpC 1 | 5.53e-10 | NA | 6.69e-13 | NA |
7. B | O34362 | Putative HMP/thiamine import ATP-binding protein YkoD | 1.05e-05 | NA | 1.41e-08 | NA |
7. B | Q8E554 | Spermidine/putrescine import ATP-binding protein PotA | 1.32e-09 | NA | 1.24e-15 | NA |
7. B | Q73F67 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.22e-09 | NA | 8.56e-19 | NA |
7. B | Q0TJC1 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.69e-08 | NA | 1.18e-12 | NA |
7. B | P22731 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 5.59e-11 | NA | 0.001 | NA |
7. B | P0AAG1 | Dipeptide transport ATP-binding protein DppD | 1.66e-09 | NA | 0.011 | NA |
7. B | Q6GB18 | Methionine import ATP-binding protein MetN 2 | 3.09e-11 | NA | 2.86e-13 | NA |
7. B | O53645 | Multidrug efflux ATP-binding/permease protein Rv0194 | 0.00e+00 | NA | 1.01e-48 | NA |
7. B | Q9UZU7 | Phosphate import ATP-binding protein PstB | 1.05e-11 | NA | 5.12e-15 | NA |
7. B | Q7PC85 | ABC transporter G family member 38 | 1.66e-03 | NA | 7.87e-05 | NA |
7. B | Q74L61 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.24e-08 | NA | 1.04e-11 | NA |
7. B | P75831 | Macrolide export ATP-binding/permease protein MacB | 3.18e-02 | NA | 1.39e-10 | NA |
7. B | Q1CC21 | Maltose/maltodextrin import ATP-binding protein MalK | 2.25e-11 | NA | 2.46e-15 | NA |
7. B | Q72AQ6 | Phosphonates import ATP-binding protein PhnC | 4.30e-10 | NA | 1.15e-10 | NA |
7. B | Q2YWP2 | Methionine import ATP-binding protein MetN 2 | 2.82e-11 | NA | 2.47e-13 | NA |
7. B | Q9CGD4 | Spermidine/putrescine import ATP-binding protein PotA | 3.43e-09 | NA | 1.16e-19 | NA |
7. B | Q2GHT4 | Lipoprotein-releasing system ATP-binding protein LolD | 3.23e-10 | NA | 1.40e-08 | NA |
7. B | Q88ZZ2 | Putative ABC transporter ATP-binding protein lp_0149 | 2.55e-05 | NA | 6.33e-13 | NA |
7. B | A3BXL8 | ABC transporter G family member 53 | 5.62e-03 | NA | 4.12e-07 | NA |
7. B | C0SPB4 | Uncharacterized ABC transporter ATP-binding protein YhaQ | 2.14e-08 | NA | 7.06e-05 | NA |
7. B | P9WQI7 | Uncharacterized ABC transporter ATP-binding protein Rv2326c | 6.58e-05 | NA | 1.29e-04 | NA |
7. B | P44871 | Cell division ATP-binding protein FtsE | 1.62e-10 | NA | 1.72e-09 | NA |
7. B | Q1QCN2 | Lipoprotein-releasing system ATP-binding protein LolD | 1.55e-10 | NA | 3.52e-10 | NA |
7. B | Q5E0B3 | Lipoprotein-releasing system ATP-binding protein LolD | 8.41e-11 | NA | 1.96e-05 | NA |
7. B | Q71WT3 | Phosphate import ATP-binding protein PstB 1 | 9.33e-13 | NA | 1.54e-13 | NA |
7. B | Q97T09 | Methionine import ATP-binding protein MetN | 7.16e-11 | NA | 5.34e-18 | NA |
7. B | Q62B84 | Methionine import ATP-binding protein MetN 2 | 5.96e-10 | NA | 5.10e-13 | NA |
7. B | Q8TK65 | Putative ABC transporter ATP-binding protein MA_3551 | 6.97e-10 | NA | 1.14e-12 | NA |
7. B | Q1Q889 | Zinc import ATP-binding protein ZnuC | 1.73e-09 | NA | 3.64e-11 | NA |
7. B | Q8DPB4 | Phosphate import ATP-binding protein PstB 2 | 5.53e-11 | NA | 1.78e-15 | NA |
7. B | Q4ZT65 | Macrolide export ATP-binding/permease protein MacB 2 | 4.23e-02 | NA | 7.89e-08 | NA |
7. B | Q13RB6 | Xylose import ATP-binding protein XylG | 6.63e-04 | NA | 3.63e-04 | NA |
7. B | Q1C2S1 | Taurine import ATP-binding protein TauB | 5.98e-08 | NA | 1.98e-06 | NA |
7. B | Q1CGT1 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.26e-03 | NA | 2.27e-05 | NA |
7. B | Q8ZFR4 | Lipoprotein-releasing system ATP-binding protein LolD | 1.40e-10 | NA | 3.34e-08 | NA |
7. B | Q63H62 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.21e-09 | NA | 1.12e-17 | NA |
7. B | Q0A9E2 | Zinc import ATP-binding protein ZnuC | 4.88e-09 | NA | 3.71e-06 | NA |
7. B | Q9M1Q9 | ABC transporter B family member 21 | 0.00e+00 | NA | 1.78e-56 | NA |
7. B | P48334 | Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region | 1.60e-09 | NA | 5.16e-12 | NA |
7. B | Q1MFL8 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.75e-06 | NA | 3.76e-11 | NA |
7. B | Q736E0 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.28e-07 | NA | 2.63e-09 | NA |
7. B | P70170 | ATP-binding cassette sub-family C member 9 | 2.49e-11 | NA | 7.04e-21 | NA |
7. B | P0CE69 | Putative uncharacterized protein YKR104W | 6.11e-15 | NA | 1.74e-24 | NA |
7. B | Q5L3R0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.81e-09 | NA | 6.00e-16 | NA |
7. B | Q2FER8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.93e-08 | NA | 1.40e-16 | NA |
7. B | Q07756 | Nod factor export ATP-binding protein I | 2.16e-09 | NA | 2.29e-05 | NA |
7. B | P0A9X2 | Zinc import ATP-binding protein ZnuC | 2.63e-10 | NA | 8.36e-11 | NA |
7. B | Q5NNN6 | Phosphate import ATP-binding protein PstB | 8.97e-12 | NA | 9.04e-14 | NA |
7. B | Q5PDF8 | Thiamine import ATP-binding protein ThiQ | 1.54e-11 | NA | 1.55e-10 | NA |
7. B | Q7VZE5 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.40e-10 | NA | 8.75e-10 | NA |
7. B | Q8K9I3 | ATP-binding protein Uup | 1.73e-04 | NA | 1.25e-09 | NA |
7. B | O34631 | Uncharacterized ABC transporter ATP-binding protein YvrA | 1.04e-08 | NA | 0.027 | NA |
7. B | P72479 | Oligopeptide transport ATP-binding protein OppF | 2.48e-11 | NA | 3.67e-13 | NA |
7. B | Q1MEG2 | Zinc import ATP-binding protein ZnuC | 1.15e-08 | NA | 0.014 | NA |
7. B | Q2LTG0 | Phosphate import ATP-binding protein PstB | 5.12e-13 | NA | 1.51e-19 | NA |
7. B | Q39HA1 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 9.41e-04 | NA | 1.37e-05 | NA |
7. B | O28437 | Putative ABC transporter ATP-binding protein AF_1841 | 5.71e-12 | NA | 2.53e-10 | NA |
7. B | P40790 | Spermidine/putrescine import ATP-binding protein PotA | 1.89e-09 | NA | 9.39e-15 | NA |
7. B | Q2NTI7 | Zinc import ATP-binding protein ZnuC | 5.71e-09 | NA | 0.003 | NA |
7. B | A0A095C325 | ABC multidrug transporter MDR1 | 0.00e+00 | NA | 2.11e-60 | NA |
7. B | Q4L8L7 | Putative hemin import ATP-binding protein HrtA | 3.51e-11 | NA | 2.62e-10 | NA |
7. B | Q2SS06 | Phosphate import ATP-binding protein PstB | 8.98e-13 | NA | 9.29e-15 | NA |
7. B | P37732 | Molybdenum import ATP-binding protein ModC 1 | 1.44e-07 | NA | 1.87e-08 | NA |
7. B | Q3ABN1 | Energy-coupling factor transporter ATP-binding protein EcfA | 7.56e-11 | NA | 9.02e-11 | NA |
7. B | Q8NR42 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.19e-07 | NA | 1.80e-09 | NA |
7. B | P21410 | Fe(3+) ions import ATP-binding protein FbpC | 3.78e-09 | NA | 3.74e-14 | NA |
7. B | Q8N139 | ATP-binding cassette sub-family A member 6 | 1.94e-03 | NA | 2.37e-04 | NA |
7. B | Q1RGL1 | Zinc import ATP-binding protein ZnuC | 2.94e-09 | NA | 1.47e-13 | NA |
7. B | Q49ZT6 | Putative hemin import ATP-binding protein HrtA | 5.60e-11 | NA | 9.54e-05 | NA |
7. B | Q54JR2 | ABC transporter C family member 3 | 1.11e-16 | NA | 1.69e-21 | NA |
7. B | P0CZ32 | Oligopeptide transport ATP-binding protein OppF | 8.42e-11 | NA | 8.96e-16 | NA |
7. B | Q0K2U3 | Taurine import ATP-binding protein TauB | 6.36e-08 | NA | 9.69e-10 | NA |
7. B | Q3JNJ9 | Arabinose import ATP-binding protein AraG | 1.10e-03 | NA | 7.46e-05 | NA |
7. B | Q2P2Y5 | Phosphate import ATP-binding protein PstB | 1.29e-12 | NA | 7.47e-17 | NA |
7. B | P47532 | Probable ABC transporter ATP-binding protein p29 | 8.45e-11 | NA | 6.83e-05 | NA |
7. B | Q4QND5 | Zinc import ATP-binding protein ZnuC | 2.19e-10 | NA | 1.11e-06 | NA |
7. B | Q1BPZ6 | Macrolide export ATP-binding/permease protein MacB | 1.03e-05 | NA | 9.26e-08 | NA |
7. B | Q38WL5 | Methionine import ATP-binding protein MetN | 7.88e-12 | NA | 8.10e-20 | NA |
7. B | Q8XIZ5 | Spermidine/putrescine import ATP-binding protein PotA | 6.36e-10 | NA | 3.18e-13 | NA |
7. B | P16678 | Putative phosphonates utilization ATP-binding protein PhnK | 1.68e-12 | NA | 6.36e-05 | NA |
7. B | Q1GID1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.04e-10 | NA | 2.09e-08 | NA |
7. B | Q5WBL0 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 9.48e-08 | NA | 6.36e-14 | NA |
7. B | P63365 | Phosphate import ATP-binding protein PstB | 2.12e-11 | NA | 3.79e-19 | NA |
7. B | Q0HVQ0 | Lipoprotein-releasing system ATP-binding protein LolD | 9.14e-11 | NA | 2.64e-05 | NA |
7. B | Q73P71 | Phosphonates import ATP-binding protein PhnC | 1.09e-11 | NA | 8.61e-12 | NA |
7. B | Q2RS22 | Nickel import ATP-binding protein NikE | 7.89e-11 | NA | 2.24e-09 | NA |
7. B | Q88JJ0 | Phosphate import ATP-binding protein PstB 1 | 6.08e-12 | NA | 1.04e-11 | NA |
7. B | A1RG29 | Macrolide export ATP-binding/permease protein MacB | 6.31e-02 | NA | 2.88e-11 | NA |
7. B | Q03Z27 | Methionine import ATP-binding protein MetN | 6.32e-11 | NA | 1.17e-19 | NA |
7. B | Q74AT2 | Lipoprotein-releasing system ATP-binding protein LolD | 1.04e-11 | NA | 7.04e-12 | NA |
7. B | Q07698 | ABC transporter protein AbcA | 3.61e-06 | NA | 1.25e-04 | NA |
7. B | P9WQM0 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.80e-09 | NA | 2.64e-11 | NA |
7. B | Q9LSJ5 | ABC transporter B family member 18 | 0.00e+00 | NA | 2.21e-62 | NA |
7. B | Q2K4V4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 | 1.33e-10 | NA | 7.74e-10 | NA |
7. B | Q6CZ34 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.75e-10 | NA | 3.12e-10 | NA |
7. B | Q733D6 | Phosphonates import ATP-binding protein PhnC | 1.91e-11 | NA | 2.80e-09 | NA |
7. B | Q7CJG3 | Macrolide export ATP-binding/permease protein MacB 2 | 3.62e-02 | NA | 3.63e-11 | NA |
7. B | Q3KC21 | Molybdenum import ATP-binding protein ModC | 1.63e-07 | NA | 2.63e-09 | NA |
7. B | Q63GR8 | Methionine import ATP-binding protein MetN 2 | 2.31e-11 | NA | 1.85e-17 | NA |
7. B | Q03JH1 | Spermidine/putrescine import ATP-binding protein PotA | 1.86e-09 | NA | 2.09e-15 | NA |
7. B | A2RH10 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.81e-10 | NA | 1.28e-13 | NA |
7. B | Q2NK31 | Spermidine/putrescine import ATP-binding protein PotA | 1.83e-05 | NA | 3.82e-07 | NA |
7. B | Q6HPM9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 6.74e-09 | NA | 1.56e-11 | NA |
7. B | Q24739 | Protein brown | NA | NA | 0.006 | NA |
7. B | O83658 | Spermidine/putrescine import ATP-binding protein PotA | 2.91e-09 | NA | 4.10e-10 | NA |
7. B | Q164Y5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.31e-11 | NA | 2.74e-10 | NA |
7. B | Q13CR0 | Phosphate import ATP-binding protein PstB | 1.24e-12 | NA | 7.00e-18 | NA |
7. B | Q82WC8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.74e-09 | NA | 5.68e-06 | NA |
7. B | Q63V79 | Phosphate import ATP-binding protein PstB | 1.20e-08 | NA | 1.53e-17 | NA |
7. B | Q13KX9 | Taurine import ATP-binding protein TauB 2 | 1.72e-07 | NA | 2.39e-07 | NA |
7. B | Q92G95 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.80e-08 | NA | 1.76e-04 | NA |
7. B | P32016 | Capsule polysaccharide export ATP-binding protein CtrD | 9.37e-08 | NA | 1.25e-05 | NA |
7. B | Q8DPC2 | Spermidine/putrescine import ATP-binding protein PotA | 1.95e-09 | NA | 4.77e-15 | NA |
7. B | Q65M34 | Methionine import ATP-binding protein MetN 1 | 3.01e-11 | NA | 4.25e-14 | NA |
7. B | Q8DZJ0 | Spermidine/putrescine import ATP-binding protein PotA | 1.33e-09 | NA | 1.24e-15 | NA |
7. B | P46920 | Glycine betaine transport ATP-binding protein OpuAA | 1.76e-10 | NA | 2.56e-16 | NA |
7. B | A0LCH8 | Zinc import ATP-binding protein ZnuC | 3.87e-08 | NA | 1.19e-09 | NA |
7. B | Q31VE7 | Nickel import ATP-binding protein NikD | 9.42e-12 | NA | 1.01e-06 | NA |
7. B | Q13LX0 | Ribose import ATP-binding protein RbsA | 5.84e-04 | NA | 0.003 | NA |
7. B | P45031 | Intermembrane phospholipid transport system ATP-binding protein MlaF | 7.72e-12 | NA | 1.06e-04 | NA |
7. B | Q9CEW7 | Phosphate import ATP-binding protein PstB 2 | 7.61e-09 | NA | 1.80e-13 | NA |
7. B | Q39IE7 | Methionine import ATP-binding protein MetN 1 | 2.64e-08 | NA | 4.35e-13 | NA |
7. B | Q8ZQE4 | Macrolide export ATP-binding/permease protein MacB | 3.28e-02 | NA | 1.32e-12 | NA |
7. B | Q8T685 | ABC transporter G family member 12 | 3.45e-02 | NA | 1.45e-09 | NA |
7. B | Q46L27 | Phosphate import ATP-binding protein PstB | 9.41e-12 | NA | 1.05e-14 | NA |
7. B | Q82CD3 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 4.98e-08 | NA | 4.55e-08 | NA |
7. B | Q88C57 | Phosphate import ATP-binding protein PstB 2 | 1.46e-08 | NA | 1.52e-14 | NA |
7. B | P75186 | Phosphate import ATP-binding protein PstB | 4.88e-07 | NA | 6.39e-18 | NA |
7. B | P68187 | Maltose/maltodextrin import ATP-binding protein MalK | 2.62e-11 | NA | 4.70e-12 | NA |
7. B | Q9M2V5 | ABC transporter G family member 18 | 3.65e-02 | NA | 0.005 | NA |
7. B | Q6GE75 | Putative hemin import ATP-binding protein HrtA | 5.44e-11 | NA | 5.01e-09 | NA |
7. B | Q035B3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.68e-11 | NA | 5.53e-14 | NA |
7. B | Q72GX5 | Phosphate import ATP-binding protein PstB | 7.40e-08 | NA | 1.81e-18 | NA |
7. B | Q7TNJ2 | ATP-binding cassette sub-family A member 7 | 1.10e-02 | NA | 1.37e-04 | NA |
7. B | Q5XCA4 | Spermidine/putrescine import ATP-binding protein PotA | 9.30e-10 | NA | 9.00e-16 | NA |
7. B | Q87ZE0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 1.13e-03 | NA | 1.66e-04 | NA |
7. B | A0B212 | Macrolide export ATP-binding/permease protein MacB | 3.69e-02 | NA | 9.10e-08 | NA |
7. B | Q7NZI7 | Phosphate import ATP-binding protein PstB | 1.55e-11 | NA | 5.82e-16 | NA |
7. B | Q6N798 | Methionine import ATP-binding protein MetN 2 | 3.08e-07 | NA | 1.50e-11 | NA |
7. B | Q9HS13 | Phosphate import ATP-binding protein PstB 1 | 1.55e-11 | NA | 4.05e-15 | NA |
7. B | Q3J376 | Phosphate import ATP-binding protein PstB | 2.28e-11 | NA | 2.85e-14 | NA |
7. B | Q4QMH4 | Methionine import ATP-binding protein MetN | 1.47e-11 | NA | 1.46e-16 | NA |
7. B | Q8A883 | Spermidine/putrescine import ATP-binding protein PotA | 2.65e-08 | NA | 7.90e-12 | NA |
7. B | O32151 | Uncharacterized ABC transporter ATP-binding protein YurJ | 5.41e-11 | NA | 2.05e-09 | NA |
7. B | Q4KK16 | Taurine import ATP-binding protein TauB | 1.06e-07 | NA | 6.45e-08 | NA |
7. B | J9VF33 | ABC multidrug transporter MDR1 | 0.00e+00 | NA | 2.99e-60 | NA |
7. B | P46342 | Phosphate import ATP-binding protein PstB 1 | 4.51e-13 | NA | 2.66e-14 | NA |
7. B | Q03P57 | Methionine import ATP-binding protein MetN | 3.99e-08 | NA | 4.22e-19 | NA |
7. B | Q12L15 | Phosphate import ATP-binding protein PstB | 1.14e-11 | NA | 1.19e-16 | NA |
7. B | Q166X0 | Phosphonates import ATP-binding protein PhnC 2 | 2.26e-10 | NA | 6.76e-07 | NA |
7. B | B1LFA2 | Autoinducer 2 import ATP-binding protein LsrA | 2.59e-03 | NA | 8.14e-06 | NA |
7. B | Q48TC3 | Phosphate import ATP-binding protein PstB 1 | 8.16e-12 | NA | 2.88e-09 | NA |
7. B | Q8FZV2 | Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 | 8.95e-09 | NA | 0.010 | NA |
7. B | Q9Z9J3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.66e-09 | NA | 1.40e-11 | NA |
7. B | Q0AGF4 | Spermidine/putrescine import ATP-binding protein PotA | 1.74e-09 | NA | 1.49e-11 | NA |
7. B | Q21CA3 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.14e-11 | NA | 1.89e-09 | NA |
7. B | P69880 | Phosphate import ATP-binding protein PstB | 7.51e-13 | NA | 4.89e-15 | NA |
7. B | Q8XBJ8 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.38e-10 | NA | 9.00e-11 | NA |
7. B | Q5WXF0 | Spermidine/putrescine import ATP-binding protein PotA | 9.69e-10 | NA | 1.96e-14 | NA |
7. B | A8AHA1 | Vitamin B12 import ATP-binding protein BtuD | 9.81e-09 | NA | 0.003 | NA |
7. B | Q88F88 | Macrolide export ATP-binding/permease protein MacB | 4.83e-02 | NA | 1.43e-08 | NA |
7. B | Q8CRI6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.67e-11 | NA | 1.37e-15 | NA |
7. B | Q28Q03 | Phosphate import ATP-binding protein PstB | 7.34e-11 | NA | 2.29e-15 | NA |
7. B | Q1MMZ3 | Phosphonates import ATP-binding protein PhnC | 6.67e-09 | NA | 4.23e-10 | NA |
7. B | P04285 | Oligopeptide transport ATP-binding protein OppD | 1.02e-09 | NA | 1.59e-08 | NA |
7. B | P53756 | ABC transporter ATP-binding protein/permease PDR18 | 1.97e-03 | NA | 5.12e-08 | NA |
7. B | Q64343 | ATP-binding cassette sub-family G member 1 | 7.63e-02 | NA | 2.29e-10 | NA |
7. B | Q8KZR4 | Taurine import ATP-binding protein TauB | 6.46e-08 | NA | 4.50e-09 | NA |
7. B | Q8T675 | ABC transporter G family member 19 | 1.71e-03 | NA | 4.93e-07 | NA |
7. B | Q6N9W0 | Methionine import ATP-binding protein MetN 1 | 3.06e-10 | NA | 1.83e-10 | NA |
7. B | P0CZ43 | Probable ABC transporter ATP-binding protein SPs0214 | 5.75e-07 | NA | 4.08e-06 | NA |
7. B | Q4ZLS1 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 9.01e-08 | NA | 9.09e-10 | NA |
7. B | Q92WD6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.25e-11 | NA | 4.13e-11 | NA |
7. B | Q0SFY5 | Methionine import ATP-binding protein MetN 1 | 1.84e-10 | NA | 3.43e-15 | NA |
7. B | Q1C1Y5 | Thiamine import ATP-binding protein ThiQ | 2.35e-11 | NA | 1.19e-09 | NA |
7. B | Q6HPN0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 4.18e-09 | NA | 1.80e-18 | NA |
7. B | G2JZ44 | Carnitine transport ATP-binding protein OpuCA | 8.45e-11 | NA | 3.66e-14 | NA |
7. B | Q73P93 | Putative ABC transporter ATP-binding protein TDE_0906 | 4.04e-05 | NA | 4.70e-10 | NA |
7. B | Q6MTC1 | Phosphate import ATP-binding protein PstB | 6.04e-12 | NA | 8.94e-10 | NA |
7. B | Q1MIJ4 | Lipoprotein-releasing system ATP-binding protein LolD | 1.29e-10 | NA | 1.32e-04 | NA |
7. B | Q880Z2 | Xylose import ATP-binding protein XylG | 1.97e-03 | NA | 3.32e-06 | NA |
7. B | P04983 | Ribose import ATP-binding protein RbsA | 6.95e-04 | NA | 1.87e-06 | NA |
7. B | Q9K8N1 | Phosphonates import ATP-binding protein PhnC 3 | 4.96e-11 | NA | 9.07e-13 | NA |
7. B | Q7ULB5 | Macrolide export ATP-binding/permease protein MacB | 2.67e-02 | NA | 1.93e-12 | NA |
7. B | Q9WXX8 | Probable metal transport system ATP-binding protein TM_0124 | 5.07e-09 | NA | 5.77e-06 | NA |
7. B | A2RI02 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.31e-08 | NA | 1.80e-15 | NA |
7. B | P12428 | Protein brown | 1.81e-02 | NA | 0.008 | NA |
7. B | Q1RD37 | Lipoprotein-releasing system ATP-binding protein LolD | 1.23e-10 | NA | 1.96e-08 | NA |
7. B | Q04182 | ATP-dependent permease PDR15 | 5.72e-04 | NA | 2.00e-04 | NA |
7. B | Q88RB3 | Methionine import ATP-binding protein MetN 2 | 5.11e-11 | NA | 2.72e-15 | NA |
7. B | Q32HA3 | Zinc import ATP-binding protein ZnuC | 2.65e-10 | NA | 8.05e-11 | NA |
7. B | Q1JDG6 | Methionine import ATP-binding protein MetN | 9.66e-11 | NA | 2.79e-16 | NA |
7. B | Q6D606 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.02e-10 | NA | 1.00e-05 | NA |
7. B | Q87C88 | Phosphate import ATP-binding protein PstB | 4.26e-09 | NA | 1.01e-14 | NA |
7. B | Q3KE48 | Macrolide export ATP-binding/permease protein MacB 2 | 2.64e-02 | NA | 1.24e-09 | NA |
7. B | Q0B6I6 | Methionine import ATP-binding protein MetN 2 | 3.72e-06 | NA | 2.87e-12 | NA |
7. B | Q94FB9 | ABC transporter D family member 1 | 1.02e-09 | NA | 4.85e-15 | NA |
7. B | Q8P8V9 | Lipoprotein-releasing system ATP-binding protein LolD | 1.08e-07 | NA | 1.11e-05 | NA |