Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54750.1

JCVISYN3A_0378

NAD(+) synthase.
M. mycoides homolog: Q6MTG8.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 49
Unique PROST Go: 24
Unique BLAST Go: 3
Unique Foldseek Go: 6

Total Homologs: 2051
Unique PROST Homologs: 1038
Unique BLAST Homologs: 16
Unique Foldseek Homologs: 656

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: nadE; NH(3)-dependent NAD(+) synthetase
Zhang et al. [4]: GO:0008795|NAD+ synthase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P0DC65 (NH(3)-dependent NAD(+) synthetase) with a FATCAT P-Value: 0 and RMSD of 2.01 angstrom. The sequence alignment identity is 27.9%.
Structural alignment shown in left. Query protein AVX54750.1 colored as red in alignment, homolog P0DC65 colored as blue. Query protein AVX54750.1 is also shown in right top, homolog P0DC65 showed in right bottom. They are colored based on secondary structures.

  AVX54750.1 ------------------MQTNLKQYLDYLVEFIQQ-TVKKAKCDGVVVGISGGIDSAVVANLAKLAFPN----------NYLTVWMPIYSSQLDY-DCA 70
      P0DC65 MTLQEEIIRQLGVKASIAPQEEIRKTVDFLKAYLRKHSFLKT----YVLGISGGQDSTLAGKLAQMAIAELREETSDQAYQFIAVRLP-YGVQTDEADAQ 95

  AVX54750.1 NEL--IKTNQLKNIEVNLEASFDAFKNSFSNLDEKPNL----LAIS-----NAKARLRMTTLYTIAQTKKYLVLGTDNLDEWHI-GYFTKYGDGGVDVVP 158
      P0DC65 KALAFIMPDQ--TLTINIKAAVD------GQVEA---LQAAGVEISDFNKGNIKARQRMISQYAIAGQMAGAVIGTDHAAE-NITGFFTKFGDGGADILP 183

  AVX54750.1 IIHLLKSEVKKAAQILNVPEIIINRKPTAGLWE---GQTDEGEIGFSY-DLIDSYLLKQNNDPEL-KK----RID-YLHKISKHKRSLAIKPKKIIR--- 245
      P0DC65 LFRLNKRQGKALLKVLGADAALYEKVPTADLEDQKPGLADEVALGVTYQD-IDDYL-----EGKLISKVAQATIEKWWHK-GQHKRHL---PITIFDDFW 273

  AVX54750.1 - 245
      P0DC65 K 274

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0004359	glutaminase activity
1. PBF	GO:0006177	GMP biosynthetic process
1. PBF	GO:0009435	NAD biosynthetic process
1. PBF	GO:0003952	NAD+ synthase (glutamine-hydrolyzing) activity
1. PBF	GO:0003921	GMP synthase activity
1. PBF	GO:0008795	NAD+ synthase activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0016462	pyrophosphatase activity
1. PBF	GO:0046872	metal ion binding
1. PBF	GO:0003922	GMP synthase (glutamine-hydrolyzing) activity
2. PF	GO:0008270	zinc ion binding
2. PF	GO:0000049	tRNA binding
3. BF	GO:0006541	glutamine metabolic process
3. BF	GO:0006734	NADH metabolic process
4. PB	GO:0005634	nucleus
5. P	GO:0016779	nucleotidyltransferase activity
5. P	GO:0051536	iron-sulfur cluster binding
5. P	GO:0005829	cytosol
5. P	GO:0032447	protein urmylation
5. P	GO:0004604	phosphoadenylyl-sulfate reductase (thioredoxin) activity
5. P	GO:0008616	queuosine biosynthetic process
5. P	GO:0019379	sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
5. P	GO:0004781	sulfate adenylyltransferase (ATP) activity
5. P	GO:0004779	sulfate adenylyltransferase activity
5. P	GO:0000103	sulfate assimilation
5. P	GO:0051539	4 iron, 4 sulfur cluster binding
5. P	GO:0070814	hydrogen sulfide biosynthetic process
5. P	GO:0002098	tRNA wobble uridine modification
5. P	GO:0016879	ligase activity, forming carbon-nitrogen bonds
5. P	GO:0019344	cysteine biosynthetic process
5. P	GO:0019419	sulfate reduction
5. P	GO:0000287	magnesium ion binding
5. P	GO:0034227	tRNA thio-modification
5. P	GO:0098624	3'-phosphoadenylylselenate reductase activity
5. P	GO:0006790	sulfur compound metabolic process
5. P	GO:0016783	sulfurtransferase activity
5. P	GO:0002143	tRNA wobble position uridine thiolation
5. P	GO:0043866	adenylyl-sulfate reductase (thioredoxin) activity
5. P	GO:0002144	cytosolic tRNA wobble base thiouridylase complex
6. F	GO:0006526	arginine biosynthetic process
6. F	GO:0000050	urea cycle
6. F	GO:0000053	argininosuccinate metabolic process
6. F	GO:0004055	argininosuccinate synthase activity
6. F	GO:0009152	purine ribonucleotide biosynthetic process
6. F	GO:0004810	tRNA adenylyltransferase activity
7. B	GO:0034355	NAD salvage
7. B	GO:0034627	'de novo' NAD biosynthetic process
7. B	GO:1900074	negative regulation of neuromuscular synaptic transmission

Uniprot GO Annotations

GO	Description
GO:0004359	glutaminase activity
GO:0009435	NAD biosynthetic process
GO:0003952	NAD+ synthase (glutamine-hydrolyzing) activity
GO:0008795	NAD+ synthase activity
GO:0016874	ligase activity
GO:0005524	ATP binding
GO:0005737	cytoplasm
GO:0046872	metal ion binding
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	P47623	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.79e-69	2.45e-60	0.9385
1. PBF	Q97WN9	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.04e-30	4.46e-39	0.8641
1. PBF	Q8E771	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.26e-35	9.85e-20	0.9075
1. PBF	B5ZA97	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.62e-37	1.15e-29	0.9178
1. PBF	A6U318	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-30	3.26e-24	0.9083
1. PBF	A6UN70	GMP synthase [glutamine-hydrolyzing] subunit B	3.02e-08	3.59e-05	0.042	0.6063
1. PBF	A6WPH7	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.42e-31	2.46e-26	0.9017
1. PBF	A7MNW9	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.50e-35	5.86e-26	0.9044
1. PBF	A8A0T1	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.13e-36	4.92e-25	0.8993
1. PBF	Q9KAK2	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.43e-36	2.79e-27	0.905
1. PBF	Q8D3T7	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.20e-36	9.47e-29	0.894
1. PBF	O29986	GMP synthase [glutamine-hydrolyzing] subunit B	2.02e-08	4.31e-05	0.010	0.6475
1. PBF	Q9CGJ4	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.89e-36	4.09e-23	0.9006
1. PBF	C1CLC7	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-37	1.23e-25	0.9055
1. PBF	B8D778	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.30e-36	3.76e-26	0.9094
1. PBF	Q87J41	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.38e-33	2.25e-30	0.8877
1. PBF	A5G7Y9	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.79e-29	5.28e-30	0.9039
1. PBF	C1CQT7	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-37	1.23e-25	0.906
1. PBF	Q8FMS2	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.53e-29	4.56e-30	0.9099
1. PBF	Q3Z287	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.19e-36	2.14e-25	0.901
1. PBF	A8AVT9	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.65e-35	3.60e-24	0.9077
1. PBF	Q49YV6	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.59e-31	1.13e-23	0.9087
1. PBF	A7X442	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-30	3.26e-24	0.9064
1. PBF	Q0S2M9	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.19e-29	9.85e-27	0.9079
1. PBF	Q6G820	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-30	3.26e-24	0.905
1. PBF	Q8EFF2	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.73e-33	1.22e-27	0.9004
1. PBF	C3LUM7	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.66e-36	7.67e-31	0.8951
1. PBF	Q8PZP6	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.79e-45	7.54e-38	0.9175
1. PBF	B0KKX4	NH(3)-dependent NAD(+) synthetase	0.00e+00	9.90e-26	1.02e-31	0.9026
1. PBF	Q5HN23	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.90e-34	1.32e-23	0.9054
1. PBF	A0B2Y5	NH(3)-dependent NAD(+) synthetase	0.00e+00	9.93e-32	5.41e-27	0.9053
1. PBF	O27554	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.49e-38	3.99e-38	0.8873
1. PBF	A7I243	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.14e-51	3.32e-34	0.8901
1. PBF	Q0T4U8	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.87e-35	4.00e-25	0.9012
1. PBF	B5RAZ4	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.04e-32	7.12e-28	0.8994
1. PBF	Q8ET75	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.53e-35	1.54e-26	0.8947
1. PBF	Q03MI7	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.47e-34	2.09e-21	0.9111
1. PBF	A7IAS7	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.73e-55	6.81e-30	0.9073
1. PBF	O57921	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.72e-35	8.35e-44	0.8584
1. PBF	Q88Z14	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.45e-30	2.35e-22	0.9032
1. PBF	A1SZH7	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.87e-33	1.19e-31	0.8888
1. PBF	B5F7I4	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.31e-33	5.28e-27	0.8997
1. PBF	Q98PU6	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.29e-51	4.84e-77	0.9544
1. PBF	Q9V2A9	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.15e-37	2.52e-34	0.8548
1. PBF	C0ZXG7	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.71e-30	4.75e-30	0.9054
1. PBF	Q99YK9	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.60e-34	1.31e-21	0.9056
1. PBF	Q5HUY2	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.54e-53	5.53e-38	0.9042
1. PBF	C1B1N8	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.25e-33	1.90e-27	0.9032
1. PBF	Q96YL5	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.45e-31	1.04e-39	0.8655
1. PBF	B1IPJ0	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.13e-36	4.92e-25	0.8991
1. PBF	B1Z0R0	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.74e-26	1.28e-28	0.9064
1. PBF	P08164	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.35e-38	1.33e-34	0.9171
1. PBF	A5VI81	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.15e-31	2.13e-33	0.9138
1. PBF	Q1WSR2	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.19e-30	1.23e-26	0.9059
1. PBF	B7USC1	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.13e-36	2.16e-25	0.8994
1. PBF	Q02F98	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.14e-26	2.34e-33	0.9199
1. PBF	P65509	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-37	1.23e-25	0.9059
1. PBF	A6VD32	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.04e-27	6.91e-33	0.924
1. PBF	Q87VL4	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.00e-28	8.49e-30	0.9149
1. PBF	Q9HUP3	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.06e-26	7.37e-33	0.9268
1. PBF	B1HTT1	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.17e-33	3.69e-31	0.9114
1. PBF	Q12PA8	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.78e-36	1.50e-25	0.9009
1. PBF	B7ITB1	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.44e-38	8.89e-38	0.9108
1. PBF	A5W9Q7	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.53e-25	7.37e-33	0.903
1. PBF	Q9KMW1	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.66e-36	7.67e-31	0.896
1. PBF	A9N269	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.76e-33	1.54e-26	0.8994
1. PBF	Q81EI2	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.08e-38	2.60e-38	0.9114
1. PBF	A3MF00	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.65e-32	6.02e-26	0.9053
1. PBF	B1J649	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.20e-27	1.60e-31	0.9033
1. PBF	Q8NZY8	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.75e-34	1.25e-20	0.9071
1. PBF	Q0AX10	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.42e-53	4.71e-53	0.935
1. PBF	B0TK55	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.94e-32	9.09e-27	0.908
1. PBF	C3P7H9	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-39	1.42e-39	0.9108
1. PBF	B4SEZ8	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.61e-33	1.56e-33	0.8827
1. PBF	O25096	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.57e-39	4.58e-31	0.9155
1. PBF	B1K5T6	NH(3)-dependent NAD(+) synthetase	0.00e+00	9.93e-32	5.41e-27	0.905
1. PBF	Q7VHF9	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.13e-34	2.37e-30	0.8655
1. PBF	A9L564	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.32e-30	4.70e-27	0.9012
1. PBF	P65507	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-30	3.26e-24	0.9064
1. PBF	Q3KIW5	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.63e-26	6.41e-28	0.917
1. PBF	Q5DZX4	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.78e-34	4.19e-30	0.9014
1. PBF	A8AHD1	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.87e-36	1.07e-25	0.9077
1. PBF	Q988H0	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.71e-22	1.07e-18	0.8706
1. PBF	A3P6S9	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.71e-32	1.91e-26	0.8932
1. PBF	Q1RB54	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.64e-36	2.14e-25	0.9012
1. PBF	Q65NN6	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.66e-34	8.89e-36	0.9123
1. PBF	B3W8T2	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.26e-29	5.77e-22	0.9046
1. PBF	B5YQ27	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.03e-36	5.52e-25	0.9037
1. PBF	Q83HW8	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.25e-39	3.78e-25	0.9107
1. PBF	A5IU80	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-30	3.26e-24	0.9063
1. PBF	P57271	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.33e-36	5.43e-26	0.9085
1. PBF	Q92TY6	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.75e-27	1.30e-13	0.8773
1. PBF	A6QIE0	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.27e-31	5.65e-24	0.9078
1. PBF	Q57PX4	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.04e-32	7.12e-28	0.8992
1. PBF	A7H439	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.95e-53	8.39e-38	0.9065
1. PBF	A8FU90	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.30e-36	4.85e-27	0.8895
1. PBF	Q6D4H8	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.66e-33	2.93e-24	0.9014
1. PBF	B7HND7	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.49e-39	2.22e-37	0.9109
1. PBF	Q8THK3	GMP synthase [glutamine-hydrolyzing] subunit B	7.19e-09	7.00e-06	2.80e-04	0.6563
1. PBF	Q9RYV5	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.80e-35	3.39e-28	0.9091
1. PBF	Q5YRN0	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.79e-34	2.02e-30	0.9064
1. PBF	Q8CNP1	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.08e-34	9.65e-24	0.9054
1. PBF	A2RL82	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.03e-35	2.81e-22	0.9052
1. PBF	A6UUS4	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.04e-39	5.97e-38	0.8798
1. PBF	Q63CG2	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-39	1.42e-39	0.9108
1. PBF	A2RXU4	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.65e-32	6.02e-26	0.9054
1. PBF	Q720Y0	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-32	3.31e-29	0.9043
1. PBF	B7MAV1	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.64e-36	2.14e-25	0.9014
1. PBF	B4TGE8	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.76e-33	1.54e-26	0.8994
1. PBF	B3QM51	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.38e-31	1.98e-31	0.8939
1. PBF	B8ZKX7	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-37	1.23e-25	0.9057
1. PBF	Q3JL79	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.71e-32	1.91e-26	0.8933
1. PBF	Q5HEK9	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.27e-31	5.65e-24	0.9082
1. PBF	A6TQC4	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.40e-64	1.72e-62	0.9239
1. PBF	A7N654	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.95e-34	2.20e-32	0.8896
1. PBF	Q9WZB3	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.06e-33	1.56e-19	0.8608
1. PBF	Q5XAM5	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.05e-34	5.42e-21	0.9076
1. PBF	B7L6L4	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.48e-36	2.77e-25	0.8994
1. PBF	A9VRQ8	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.03e-39	1.17e-38	0.9137
1. PBF	Q3IF87	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.12e-35	6.63e-27	0.9094
1. PBF	Q321N2	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.80e-36	4.72e-25	0.899
1. PBF	Q9HJR8	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.86e-57	6.58e-50	0.9094
1. PBF	B3E4K8	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.27e-30	2.27e-30	0.902
1. PBF	A7ZMK7	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.19e-36	2.14e-25	0.8995
1. PBF	Q1JFM0	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.67e-34	3.18e-22	0.9074
1. PBF	Q0TH90	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.40e-36	2.05e-25	0.8995
1. PBF	Q8PXK0	GMP synthase [glutamine-hydrolyzing] subunit B	2.62e-09	1.24e-05	0.011	0.6759
1. PBF	A0AHK4	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.25e-31	1.09e-29	0.9039
1. PBF	Q6AER9	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.70e-36	2.35e-32	0.9124
1. PBF	Q739R5	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.18e-38	1.65e-37	0.9109
1. PBF	Q6F0U4	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.55e-72	2.36e-112	0.9913
1. PBF	Q8CWY4	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.16e-33	2.40e-24	0.9049
1. PBF	B0S1S2	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.71e-64	5.03e-61	0.9401
1. PBF	C1ERC2	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.64e-39	1.52e-39	0.9115
1. PBF	B2G5Q7	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.15e-31	2.13e-33	0.9139
1. PBF	Q3ABX6	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.55e-61	4.68e-65	0.9703
1. PBF	A7Z159	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.19e-36	2.05e-32	0.912
1. PBF	A1UW43	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.65e-32	6.02e-26	0.8936
1. PBF	Q037P8	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.54e-29	6.81e-22	0.9047
1. PBF	Q9HNM7	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.78e-31	1.93e-34	0.898
1. PBF	B1LDZ1	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.11e-36	3.08e-25	0.9011
1. PBF	Q8U4I9	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.06e-33	1.38e-47	0.8644
1. PBF	Q8FH06	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.40e-36	2.05e-25	0.8996
1. PBF	Q6L0D1	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.94e-52	5.07e-35	0.8912
1. PBF	A8F9S0	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.23e-37	9.65e-31	0.9141
1. PBF	Q6GFE4	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.64e-32	3.93e-24	0.9061
1. PBF	C4ZZ96	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.13e-36	4.92e-25	0.8993
1. PBF	Q9ZMB0	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.73e-37	9.43e-30	0.9181
1. PBF	Q8REA7	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.53e-44	2.12e-33	0.8972
1. PBF	Q5PHB6	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.50e-33	1.52e-26	0.8993
1. PBF	Q3B5D4	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.14e-32	3.07e-33	0.8847
1. PBF	Q8EWK9	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.88e-60	2.38e-55	0.9226
1. PBF	B8CNP2	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.12e-33	4.77e-31	0.8841
1. PBF	A8H3E4	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.44e-33	2.30e-25	0.9025
1. PBF	B7N576	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.11e-36	3.08e-25	0.8994
1. PBF	C6DFZ6	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.31e-33	3.15e-24	0.9016
1. PBF	P0DC64	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.78e-34	1.54e-21	0.9113
1. PBF	B5E5S7	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.15e-38	4.00e-25	0.906
1. PBF	Q7MFB0	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.86e-36	8.09e-29	0.8937
1. PBF	B6JKQ6	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.40e-38	6.63e-31	0.9172
1. PBF	B5FJD0	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.04e-32	6.90e-28	0.8995
1. PBF	Q5JJ65	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-47	5.98e-39	0.8974
1. PBF	Q48NY2	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.09e-28	9.98e-31	0.905
1. PBF	B9JNG1	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.32e-23	2.99e-14	0.8252
1. PBF	C1CF07	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-37	1.23e-25	0.9057
1. PBF	Q041J1	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.47e-33	1.48e-21	0.9067
1. PBF	Q32G79	NH(3)-dependent NAD(+) synthetase	0.00e+00	9.16e-36	4.21e-25	0.9013
1. PBF	C4L5A2	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.08e-38	5.74e-33	0.9028
1. PBF	B9DV66	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.21e-35	2.10e-22	0.907
1. PBF	C1C818	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.03e-36	1.57e-25	0.9062
1. PBF	Q12V31	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.49e-33	2.42e-41	0.9113
1. PBF	A4VX00	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.11e-36	2.76e-26	0.9079
1. PBF	A3D5M3	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.32e-30	4.70e-27	0.9011
1. PBF	Q63K83	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.71e-32	1.91e-26	0.8935
1. PBF	B9IXY1	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-39	1.42e-39	0.9108
1. PBF	A1BEN4	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.63e-31	1.04e-34	0.8915
1. PBF	B3ELE3	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.44e-29	4.40e-34	0.8975
1. PBF	Q9PPB0	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.74e-53	4.56e-38	0.9045
1. PBF	A4QGT5	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-32	8.00e-31	0.9061
1. PBF	A4W9K3	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.35e-38	2.50e-25	0.904
1. PBF	C3L5J1	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-39	1.42e-39	0.9109
1. PBF	B8E735	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.32e-30	4.70e-27	0.901
1. PBF	A4SFG4	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.35e-32	2.84e-32	0.9009
1. PBF	Q04JT1	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-37	1.23e-25	0.9058
1. PBF	Q1BQX0	NH(3)-dependent NAD(+) synthetase	0.00e+00	9.93e-32	5.41e-27	0.9051
1. PBF	Q8TVH1	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.52e-39	5.94e-30	0.8988
1. PBF	Q1IYR1	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.34e-32	3.77e-32	0.9071
1. PBF	Q2YU60	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.70e-31	4.01e-24	0.908
1. PBF	Q83GA8	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.25e-39	3.78e-25	0.911
1. PBF	A1VZF8	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.54e-53	5.53e-38	0.9043
1. PBF	B1KJ47	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.97e-33	5.56e-27	0.9069
1. PBF	B1XGK1	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.13e-36	4.92e-25	0.9008
1. PBF	B2USG0	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.58e-37	4.16e-31	0.9177
1. PBF	Q7MAJ5	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.88e-45	2.86e-34	0.9022
1. PBF	Q83RG5	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.87e-35	4.00e-25	0.9012
1. PBF	C1L207	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-32	3.31e-29	0.9043
1. PBF	B2TDV9	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.20e-30	1.22e-30	0.9138
1. PBF	Q830Y9	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.62e-34	3.67e-24	0.9046
1. PBF	A8FLM3	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.08e-53	5.30e-38	0.9054
1. PBF	B7LQ52	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.15e-35	1.36e-25	0.9016
1. PBF	Q8ZXL4	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.50e-48	3.47e-24	0.8893
1. PBF	A7GNW5	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.11e-38	6.93e-35	0.9103
1. PBF	Q81RP3	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-39	1.42e-39	0.9135
1. PBF	Q5M652	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.47e-34	2.09e-21	0.9113
1. PBF	Q8Y825	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.75e-32	3.38e-29	0.9044
1. PBF	Q9RJM5	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.40e-26	8.81e-25	0.9111
1. PBF	A4Y7T2	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.21e-35	3.45e-28	0.8909
1. PBF	P99150	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-30	3.26e-24	0.908
1. PBF	B2VEK0	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.13e-35	3.71e-28	0.906
1. PBF	A3CPY9	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.60e-34	4.63e-24	0.9077
1. PBF	Q4L7M6	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.76e-33	5.32e-25	0.9007
1. PBF	A2BLB9	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.90e-33	6.56e-26	0.8976
1. PBF	B8DCC1	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-32	3.31e-29	0.9066
1. PBF	Q39AM3	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.70e-28	1.97e-28	0.9053
1. PBF	Q8ZPU5	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.04e-32	7.12e-28	0.899
1. PBF	B4EIP2	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.84e-31	3.67e-27	0.9051
1. PBF	B0R6W9	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.78e-31	1.93e-34	0.8976
1. PBF	B6ERM8	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.34e-32	4.56e-30	0.8936
1. PBF	Q6LIU7	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.26e-34	6.22e-31	0.8969
1. PBF	Q1CUH2	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.35e-38	1.13e-31	0.9173
1. PBF	B7MVL9	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.48e-36	2.77e-25	0.8995
1. PBF	Q979W4	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.42e-53	8.04e-49	0.89
1. PBF	Q9YAI1	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.22e-33	1.00e-30	0.8902
1. PBF	Q62CU8	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.65e-32	6.02e-26	0.9053
1. PBF	A8Z2S7	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.27e-31	5.65e-24	0.9058
1. PBF	B1ME26	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.65e-32	1.24e-30	0.908
1. PBF	A8MHN7	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.80e-62	9.38e-63	0.9488
1. PBF	C0MGX1	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-34	4.40e-25	0.9058
1. PBF	Q1I469	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.37e-26	1.49e-33	0.903
1. PBF	B1ICL9	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.55e-37	7.62e-26	0.9059
1. PBF	B7V1Y3	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.06e-26	7.37e-33	0.9254
1. PBF	Q4ZYV8	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.27e-28	2.66e-30	0.9156
1. PBF	B4U4I9	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.01e-36	8.57e-25	0.9058
1. PBF	A5EYT7	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.66e-36	7.67e-31	0.8952
1. PBF	B7JKI8	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-39	1.42e-39	0.9109
1. PBF	Q8KEX2	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.53e-31	1.71e-31	0.8947
1. PBF	A4VKK4	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.47e-25	3.65e-32	0.9029
1. PBF	A4XS59	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.28e-28	4.99e-36	0.9245
1. PBF	Q4JCP0	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.22e-30	3.57e-34	0.8755
1. PBF	P65506	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-30	3.26e-24	0.9063
1. PBF	B2IQN8	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-37	1.23e-25	0.9058
1. PBF	Q6HJW8	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.92e-39	4.68e-40	0.9113
1. PBF	B7NT37	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.48e-36	2.77e-25	0.9013
1. PBF	Q8NMN7	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.62e-30	1.93e-29	0.9054
1. PBF	B2U3C0	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.48e-36	5.11e-26	0.9009
1. PBF	B7HJC1	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.64e-38	2.84e-38	0.9106
1. PBF	P65508	NH(3)-dependent NAD(+) synthetase	0.00e+00	7.08e-37	1.23e-25	0.9056
1. PBF	Q65RB5	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.36e-62	1.65e-50	0.938
1. PBF	A1RIQ6	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.67e-35	3.71e-29	0.899
1. PBF	B2GA98	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.90e-33	3.69e-30	0.9124
1. PBF	Q17X65	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.57e-39	2.40e-31	0.9161
1. PBF	B8D8X4	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.33e-36	5.43e-26	0.9086
1. PBF	B5QWI3	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.37e-31	7.27e-28	0.8994
1. PBF	B5BA65	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.50e-33	1.52e-26	0.8993
1. PBF	C6A5B5	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.16e-45	2.15e-47	0.8801
1. PBF	B9KAZ2	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.28e-38	2.52e-19	0.8639
1. PBF	A1ABS1	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.64e-36	2.14e-25	0.9016
1. PBF	P75216	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.52e-69	1.91e-57	0.9551
1. PBF	C0Q6X4	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.04e-32	7.12e-28	0.8993
1. PBF	B4T4K7	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.04e-32	7.12e-28	0.8994
1. PBF	B4TUC9	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.04e-32	6.90e-28	0.8994
1. PBF	Q2NRT4	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.82e-36	2.75e-25	0.9073
1. PBF	Q084C2	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.03e-31	5.42e-28	0.8978
1. PBF	Q46D96	GMP synthase [glutamine-hydrolyzing] subunit B	2.20e-09	9.91e-06	0.040	0.6712
1. PBF	A9MFF4	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.74e-32	2.79e-26	0.9038
1. PBF	Q74I36	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.73e-33	4.38e-22	0.9072
1. PBF	Q2FFI3	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.27e-31	5.65e-24	0.9079
1. PBF	Q8XDZ9	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.03e-36	5.52e-25	0.8994
1. PBF	Q8E1Q7	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.26e-35	9.85e-20	0.9075
1. PBF	Q8TK88	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.64e-45	2.35e-38	0.9124
1. PBF	B1YJ94	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.31e-35	1.32e-26	0.9102
1. PBF	Q3K383	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.26e-35	9.85e-20	0.9073
1. PBF	A2RD51	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.05e-34	5.42e-21	0.9076
1. PBF	Q03SX9	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.07e-33	6.83e-23	0.8745
1. PBF	A0RCZ8	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.99e-39	1.42e-39	0.9108
1. PBF	Q92CU3	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.01e-32	6.83e-29	0.9048
1. PBF	B7M1F2	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.67e-36	5.92e-26	0.8995
1. PBF	B5ETZ2	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.50e-33	2.25e-30	0.9001
1. PBF	Q38VA7	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.95e-31	4.68e-29	0.9026
1. PBF	A3DP41	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.75e-40	2.20e-33	0.8903
1. PBF	A4W3A3	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.11e-36	2.76e-26	0.9082
1. PBF	C0M795	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.31e-35	1.01e-24	0.906
1. PBF	O29262	NH(3)-dependent NAD(+) synthetase	0.00e+00	6.67e-57	1.28e-37	0.8955
1. PBF	B7VQP3	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.30e-34	7.66e-32	0.9054
1. PBF	B6IBG0	NH(3)-dependent NAD(+) synthetase	0.00e+00	5.19e-36	2.14e-25	0.8994
1. PBF	B5Y8Q4	NH(3)-dependent NAD(+) synthetase	0.00e+00	4.29e-32	7.99e-24	0.8448
1. PBF	Q88DF6	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.59e-25	1.69e-33	0.9027
1. PBF	A1S5V3	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.35e-35	1.89e-28	0.8936
1. PBF	Q02Z86	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.65e-35	2.10e-22	0.9081
1. PBF	P0DC65	NH(3)-dependent NAD(+) synthetase	0.00e+00	2.78e-34	1.54e-21	0.911
1. PBF	Q8Z6G6	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.82e-33	1.76e-26	0.8998
1. PBF	Q5M1L1	NH(3)-dependent NAD(+) synthetase	0.00e+00	1.47e-34	2.09e-21	0.9112
1. PBF	Q8K9W7	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.68e-31	4.43e-20	0.8984
2. PF	O59072	GMP synthase [glutamine-hydrolyzing] subunit B	7.43e-10	1.51e-05	NA	0.7478
2. PF	Q9HP33	GMP synthase [glutamine-hydrolyzing] subunit B	7.07e-09	1.64e-04	NA	0.6648
2. PF	A3CWS6	GMP synthase [glutamine-hydrolyzing] subunit B	6.12e-09	2.70e-06	NA	0.6624
2. PF	Q5UX56	GMP synthase [glutamine-hydrolyzing] subunit B	3.62e-09	4.52e-06	NA	0.644
2. PF	Q12ZP6	GMP synthase [glutamine-hydrolyzing] subunit B	1.63e-09	5.79e-05	NA	0.6498
2. PF	Q6LYU3	GMP synthase [glutamine-hydrolyzing] subunit B	2.76e-08	1.30e-05	NA	0.7213
2. PF	Q5JFM1	GMP synthase [glutamine-hydrolyzing] subunit B	9.99e-10	5.79e-05	NA	0.7359
2. PF	A5ULR3	7-cyano-7-deazaguanine synthase	5.88e-06	2.18e-04	NA	0.4744
2. PF	A6VFI6	GMP synthase [glutamine-hydrolyzing] subunit B	3.32e-08	1.39e-06	NA	0.7141
2. PF	Q2NF51	7-cyano-7-deazaguanine synthase	3.36e-06	1.93e-02	NA	0.4486
2. PF	Q8U0R8	GMP synthase [glutamine-hydrolyzing] subunit B	7.38e-10	3.12e-04	NA	0.6848
2. PF	P73846	Uncharacterized protein slr1717	2.45e-08	3.78e-10	NA	0.7055
2. PF	Q8TYD7	GMP synthase [glutamine-hydrolyzing] subunit B	1.45e-09	1.40e-04	NA	0.607
2. PF	B8GIB2	GMP synthase [glutamine-hydrolyzing] subunit B	4.23e-09	3.31e-04	NA	0.7072
2. PF	O26806	GMP synthase [glutamine-hydrolyzing] subunit B	5.52e-09	1.24e-05	NA	0.5915
2. PF	A7IA92	GMP synthase [glutamine-hydrolyzing] subunit B	1.70e-09	4.68e-05	NA	0.6485
2. PF	Q97C09	GMP synthase [glutamine-hydrolyzing] subunit B	4.15e-08	1.71e-02	NA	0.6369
2. PF	B9LTX1	GMP synthase [glutamine-hydrolyzing] subunit B	1.36e-09	9.31e-06	NA	0.6784
2. PF	Q0W468	GMP synthase [glutamine-hydrolyzing] subunit B	8.34e-09	1.04e-05	NA	0.6455
2. PF	Q9V0I7	GMP synthase [glutamine-hydrolyzing] subunit B	1.13e-09	6.03e-06	NA	0.6773
2. PF	B0R6G1	GMP synthase [glutamine-hydrolyzing] subunit B	6.85e-09	1.64e-04	NA	0.6815
2. PF	Q3IS14	GMP synthase [glutamine-hydrolyzing] subunit B	1.10e-08	2.66e-05	NA	0.5838
3. BF	Q8ZT92	GMP synthase [glutamine-hydrolyzing]	8.45e-07	NA	0.004	0.6351
3. BF	P74292	Glutamine-dependent NAD(+) synthetase	0.00e+00	NA	1.65e-12	0.8434
3. BF	Q64XQ7	GMP synthase [glutamine-hydrolyzing]	6.42e-07	NA	0.017	0.6636
3. BF	Q2P3Q9	GMP synthase [glutamine-hydrolyzing]	3.55e-07	NA	0.019	0.5711
3. BF	Q5H0S2	GMP synthase [glutamine-hydrolyzing]	4.82e-07	NA	0.019	0.5684
3. BF	Q1H280	GMP synthase [glutamine-hydrolyzing]	7.43e-07	NA	0.039	0.596
3. BF	Q4UVC5	GMP synthase [glutamine-hydrolyzing]	6.04e-07	NA	0.041	0.5859
3. BF	B7IHI2	GMP synthase [glutamine-hydrolyzing]	5.54e-07	NA	1.71e-04	0.6948
3. BF	Q03638	Glutamine-dependent NAD(+) synthetase	0.00e+00	NA	2.73e-14	0.8712
3. BF	Q73LZ4	GMP synthase [glutamine-hydrolyzing]	1.56e-06	NA	0.009	0.5917
3. BF	O67091	Glutamine-dependent NAD(+) synthetase	2.22e-16	NA	2.57e-18	0.8656
3. BF	Q8P8Q6	GMP synthase [glutamine-hydrolyzing]	6.19e-07	NA	0.041	0.6666
3. BF	A0RQD7	GMP synthase [glutamine-hydrolyzing]	3.40e-07	NA	0.007	0.5904
3. BF	Q5LGV6	GMP synthase [glutamine-hydrolyzing]	6.36e-07	NA	0.017	0.6607
3. BF	Q8D1V0	GMP synthase [glutamine-hydrolyzing]	6.94e-07	NA	0.006	0.693
3. BF	B6EGZ6	GMP synthase [glutamine-hydrolyzing]	3.84e-07	NA	0.036	0.5988
3. BF	Q9X0Y0	Glutamine-dependent NAD(+) synthetase	2.22e-16	NA	1.69e-14	0.8357
3. BF	B0RSB6	GMP synthase [glutamine-hydrolyzing]	5.94e-07	NA	0.041	0.5749
3. BF	Q9PC24	Glutamine-dependent NAD(+) synthetase	0.00e+00	NA	1.61e-13	0.8568
3. BF	Q87D47	Glutamine-dependent NAD(+) synthetase	0.00e+00	NA	1.49e-13	0.8545
3. BF	Q4FMW8	GMP synthase [glutamine-hydrolyzing]	6.12e-07	NA	0.045	0.6025
3. BF	Q3BSP7	GMP synthase [glutamine-hydrolyzing]	5.53e-07	NA	0.044	0.6617
3. BF	B2SLG1	GMP synthase [glutamine-hydrolyzing]	7.80e-07	NA	0.017	0.5804
4. PB	Q58747	NH(3)-dependent NAD(+) synthetase	0.00e+00	8.91e-41	2.73e-36	NA
4. PB	P18843	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.13e-36	4.92e-25	NA
4. PB	Q2G236	NH(3)-dependent NAD(+) synthetase	0.00e+00	3.27e-31	5.65e-24	NA
5. P	A4VN94	7-cyano-7-deazaguanine synthase	7.44e-06	2.66e-03	NA	NA
5. P	A3M828	tRNA-cytidine(32) 2-sulfurtransferase	1.27e-05	6.60e-05	NA	NA
5. P	Q2NVM9	Sulfate adenylyltransferase subunit 2	4.49e-05	1.20e-02	NA	NA
5. P	A7MSZ6	Phosphoadenosine 5'-phosphosulfate reductase	1.83e-05	3.14e-05	NA	NA
5. P	B1HPF6	7-cyano-7-deazaguanine synthase	2.43e-06	1.91e-04	NA	NA
5. P	Q5GUF3	tRNA-cytidine(32) 2-sulfurtransferase	1.17e-05	5.51e-04	NA	NA
5. P	B1J004	7-cyano-7-deazaguanine synthase	4.72e-05	2.10e-02	NA	NA
5. P	A0L6E2	Sulfate adenylyltransferase subunit 2	4.00e-05	9.84e-03	NA	NA
5. P	Q4WVK2	Cytoplasmic tRNA 2-thiolation protein 2	3.58e-05	2.28e-03	NA	NA
5. P	P76055	tRNA-cytidine(32) 2-sulfurtransferase	1.21e-05	4.17e-03	NA	NA
5. P	B1Z7C1	Sulfate adenylyltransferase subunit 2	7.04e-06	5.36e-03	NA	NA
5. P	B5Z3V1	7-cyano-7-deazaguanine synthase	4.68e-05	1.03e-02	NA	NA
5. P	A4SLT2	7-cyano-7-deazaguanine synthase	6.55e-05	2.77e-02	NA	NA
5. P	Q4K882	tRNA-cytidine(32) 2-sulfurtransferase	5.90e-06	1.11e-05	NA	NA
5. P	Q9WY40	tRNA-5-methyluridine(54) 2-sulfurtransferase	2.87e-06	4.93e-02	NA	NA
5. P	Q6MKZ5	7-cyano-7-deazaguanine synthase	3.09e-06	9.96e-05	NA	NA
5. P	B7N6Z6	Phosphoadenosine 5'-phosphosulfate reductase	9.01e-07	1.46e-02	NA	NA
5. P	Q7CR22	7-cyano-7-deazaguanine synthase	6.69e-05	3.43e-02	NA	NA
5. P	B1JD61	7-cyano-7-deazaguanine synthase	7.17e-06	9.58e-03	NA	NA
5. P	Q6HLD4	Adenosine 5'-phosphosulfate reductase	1.34e-08	1.30e-02	NA	NA
5. P	Q8YM45	7-cyano-7-deazaguanine synthase	1.47e-05	5.66e-03	NA	NA
5. P	Q1H4T8	tRNA-cytidine(32) 2-sulfurtransferase	7.99e-07	2.20e-03	NA	NA
5. P	A5I232	7-cyano-7-deazaguanine synthase	2.18e-06	5.41e-04	NA	NA
5. P	B4TFY3	Phosphoadenosine 5'-phosphosulfate reductase	9.27e-07	1.01e-02	NA	NA
5. P	A3NQ33	7-cyano-7-deazaguanine synthase	2.19e-05	2.98e-05	NA	NA
5. P	Q7CIP8	tRNA-cytidine(32) 2-sulfurtransferase	5.62e-05	5.07e-05	NA	NA
5. P	A4Y6J4	7-cyano-7-deazaguanine synthase	1.20e-04	1.10e-04	NA	NA
5. P	B4ST23	7-cyano-7-deazaguanine synthase	5.81e-06	9.66e-04	NA	NA
5. P	A9AC62	7-cyano-7-deazaguanine synthase	1.81e-05	6.34e-05	NA	NA
5. P	A7ZXA2	7-cyano-7-deazaguanine synthase	5.31e-05	2.65e-02	NA	NA
5. P	B1XDH5	Phosphoadenosine 5'-phosphosulfate reductase	9.07e-07	1.46e-02	NA	NA
5. P	Q124R0	tRNA-cytidine(32) 2-sulfurtransferase	1.86e-06	6.67e-04	NA	NA
5. P	Q1GPS4	7-cyano-7-deazaguanine synthase 2	7.70e-06	1.18e-03	NA	NA
5. P	B5BJ71	tRNA-cytidine(32) 2-sulfurtransferase	1.23e-05	1.86e-04	NA	NA
5. P	A8G9X8	Phosphoadenosine 5'-phosphosulfate reductase	1.19e-06	3.09e-04	NA	NA
5. P	Q5X752	tRNA-cytidine(32) 2-sulfurtransferase	1.85e-05	9.84e-04	NA	NA
5. P	B2U4P9	7-cyano-7-deazaguanine synthase	5.25e-05	2.65e-02	NA	NA
5. P	A3N1A3	7-cyano-7-deazaguanine synthase	3.82e-06	4.09e-04	NA	NA
5. P	B2STI7	7-cyano-7-deazaguanine synthase	6.84e-06	4.09e-03	NA	NA
5. P	B0TSC0	7-cyano-7-deazaguanine synthase	6.56e-05	1.60e-03	NA	NA
5. P	A3QEG3	tRNA-cytidine(32) 2-sulfurtransferase	1.16e-05	2.06e-06	NA	NA
5. P	A3MND8	tRNA-cytidine(32) 2-sulfurtransferase	1.75e-05	2.07e-02	NA	NA
5. P	Q1C7C2	tRNA-cytidine(32) 2-sulfurtransferase	1.59e-05	5.07e-05	NA	NA
5. P	B5BD76	7-cyano-7-deazaguanine synthase	5.45e-05	3.67e-02	NA	NA
5. P	B7LMD5	7-cyano-7-deazaguanine synthase	6.43e-05	2.00e-02	NA	NA
5. P	A5V652	7-cyano-7-deazaguanine synthase	6.60e-06	3.77e-03	NA	NA
5. P	Q8P6F6	7-cyano-7-deazaguanine synthase	6.12e-06	5.08e-03	NA	NA
5. P	B7VI86	Phosphoadenosine 5'-phosphosulfate reductase	1.19e-06	8.46e-06	NA	NA
5. P	Q92PH1	tRNA-cytidine(32) 2-sulfurtransferase	9.82e-06	2.32e-06	NA	NA
5. P	B9M1Y2	tRNA-cytidine(32) 2-sulfurtransferase	6.02e-06	1.40e-08	NA	NA
5. P	B4RQ61	7-cyano-7-deazaguanine synthase	8.52e-07	7.13e-04	NA	NA
5. P	B7MDA3	7-cyano-7-deazaguanine synthase	4.75e-05	1.33e-02	NA	NA
5. P	Q8CTH8	7-cyano-7-deazaguanine synthase	2.17e-06	4.54e-05	NA	NA
5. P	A5IQR6	7-cyano-7-deazaguanine synthase	1.61e-06	8.01e-07	NA	NA
5. P	A7FLY8	Phosphoadenosine 5'-phosphosulfate reductase	1.10e-06	5.51e-04	NA	NA
5. P	B1LQ85	Phosphoadenosine 5'-phosphosulfate reductase	8.34e-07	9.25e-03	NA	NA
5. P	A7MJ65	Phosphoadenosine 5'-phosphosulfate reductase	1.08e-06	1.93e-03	NA	NA
5. P	Q24ZT5	7-cyano-7-deazaguanine synthase 1	1.25e-05	9.16e-03	NA	NA
5. P	Q48ED3	Sulfate adenylyltransferase subunit 2	8.22e-05	1.90e-02	NA	NA
5. P	Q4ZQ35	tRNA-cytidine(32) 2-sulfurtransferase	2.55e-05	2.15e-06	NA	NA
5. P	A6T886	tRNA-cytidine(32) 2-sulfurtransferase	1.24e-05	8.74e-05	NA	NA
5. P	Q0BYJ5	tRNA-cytidine(32) 2-sulfurtransferase	8.25e-07	3.15e-02	NA	NA
5. P	B2VG05	Phosphoadenosine 5'-phosphosulfate reductase	9.71e-07	1.57e-02	NA	NA
5. P	Q477W2	tRNA-cytidine(32) 2-sulfurtransferase	4.57e-06	9.57e-05	NA	NA
5. P	A4VJ19	tRNA-cytidine(32) 2-sulfurtransferase	4.77e-06	2.95e-05	NA	NA
5. P	A8EZR4	7-cyano-7-deazaguanine synthase	1.47e-05	3.47e-04	NA	NA
5. P	A2CDY7	7-cyano-7-deazaguanine synthase	3.14e-04	9.92e-03	NA	NA
5. P	Q6D1A3	Phosphoadenosine 5'-phosphosulfate reductase	1.03e-06	8.61e-03	NA	NA
5. P	Q74GW7	tRNA-cytidine(32) 2-sulfurtransferase	9.98e-06	1.08e-07	NA	NA
5. P	Q63E31	7-cyano-7-deazaguanine synthase	1.75e-06	4.87e-04	NA	NA
5. P	A9MQT5	tRNA-cytidine(32) 2-sulfurtransferase	1.49e-05	4.14e-05	NA	NA
5. P	Q8A7F8	7-cyano-7-deazaguanine synthase	2.13e-06	3.03e-04	NA	NA
5. P	A5N597	7-cyano-7-deazaguanine synthase	1.78e-05	4.97e-05	NA	NA
5. P	C5BCK3	7-cyano-7-deazaguanine synthase	4.40e-05	7.47e-03	NA	NA
5. P	A4SVH9	7-cyano-7-deazaguanine synthase	6.29e-06	6.01e-10	NA	NA
5. P	B7NHP6	tRNA-cytidine(32) 2-sulfurtransferase	1.20e-05	7.07e-04	NA	NA
5. P	Q2N612	7-cyano-7-deazaguanine synthase	6.42e-05	1.95e-02	NA	NA
5. P	A0KKM7	tRNA-cytidine(32) 2-sulfurtransferase	1.27e-06	4.13e-04	NA	NA
5. P	Q10270	Probable phosphoadenosine phosphosulfate reductase	1.06e-04	2.69e-03	NA	NA
5. P	Q72LF3	tRNA-5-methyluridine(54) 2-sulfurtransferase	3.59e-06	5.62e-04	NA	NA
5. P	A3N4V9	tRNA-cytidine(32) 2-sulfurtransferase	1.63e-05	2.07e-02	NA	NA
5. P	B7L0Y0	Sulfate adenylyltransferase subunit 2	7.91e-06	3.50e-03	NA	NA
5. P	Q5PFP1	7-cyano-7-deazaguanine synthase	6.09e-05	3.67e-02	NA	NA
5. P	P28603	Sulfate adenylyltransferase subunit 2	2.95e-06	1.93e-04	NA	NA
5. P	B8CSV0	Sulfate adenylyltransferase subunit 2	4.97e-06	2.30e-03	NA	NA
5. P	A7ZZT7	tRNA-cytidine(32) 2-sulfurtransferase	4.12e-05	3.86e-04	NA	NA
5. P	Q3JAS2	tRNA-cytidine(32) 2-sulfurtransferase	7.82e-06	5.31e-04	NA	NA
5. P	A7HXX1	7-cyano-7-deazaguanine synthase	1.68e-05	7.27e-04	NA	NA
5. P	Q1MQ73	7-cyano-7-deazaguanine synthase	1.02e-05	1.46e-03	NA	NA
5. P	A6UV33	7-cyano-7-deazaguanine synthase	3.10e-05	1.41e-03	NA	NA
5. P	Q58240	Uncharacterized protein MJ0830	2.38e-08	6.05e-13	NA	NA
5. P	A3D822	Sulfate adenylyltransferase subunit 2	5.26e-06	8.32e-05	NA	NA
5. P	Q9KS93	7-cyano-7-deazaguanine synthase	3.89e-05	1.69e-02	NA	NA
5. P	B4RYS5	Phosphoadenosine 5'-phosphosulfate reductase	6.85e-06	1.23e-04	NA	NA
5. P	Q07Y91	Sulfate adenylyltransferase subunit 2	1.21e-05	4.77e-05	NA	NA
5. P	A7ZLH4	tRNA-cytidine(32) 2-sulfurtransferase	1.15e-05	3.86e-04	NA	NA
5. P	Q7U3K1	7-cyano-7-deazaguanine synthase	8.23e-05	5.41e-03	NA	NA
5. P	A7MLI7	tRNA-cytidine(32) 2-sulfurtransferase	1.35e-05	2.40e-04	NA	NA
5. P	B8D7V4	Sulfate adenylyltransferase subunit 2	6.83e-06	1.74e-02	NA	NA
5. P	Q92GQ2	7-cyano-7-deazaguanine synthase	1.83e-05	1.58e-06	NA	NA
5. P	Q4FTN4	7-cyano-7-deazaguanine synthase	2.54e-05	3.93e-07	NA	NA
5. P	B1JJG7	Phosphoadenosine 5'-phosphosulfate reductase	1.06e-06	5.51e-04	NA	NA
5. P	A1VJK9	tRNA-cytidine(32) 2-sulfurtransferase	1.71e-06	5.51e-04	NA	NA
5. P	B5R4D8	tRNA-cytidine(32) 2-sulfurtransferase	1.24e-05	1.44e-04	NA	NA
5. P	Q985Q5	Sulfate adenylyltransferase subunit 2	3.45e-06	1.84e-03	NA	NA
5. P	Q4UXK8	7-cyano-7-deazaguanine synthase	6.61e-06	5.08e-03	NA	NA
5. P	Q2A3F9	tRNA-cytidine(32) 2-sulfurtransferase 2	5.70e-06	2.95e-05	NA	NA
5. P	Q8ZVX7	7-cyano-7-deazaguanine synthase	1.73e-04	4.51e-04	NA	NA
5. P	B7UHH4	Phosphoadenosine 5'-phosphosulfate reductase	8.34e-07	2.48e-02	NA	NA
5. P	A9W222	7-cyano-7-deazaguanine synthase	2.55e-05	5.36e-06	NA	NA
5. P	Q1BSY9	tRNA-cytidine(32) 2-sulfurtransferase	1.61e-05	6.53e-03	NA	NA
5. P	A8FJH9	7-cyano-7-deazaguanine synthase	3.87e-06	2.45e-03	NA	NA
5. P	B4TTX7	Phosphoadenosine 5'-phosphosulfate reductase	8.46e-07	1.82e-02	NA	NA
5. P	Q8PHW1	7-cyano-7-deazaguanine synthase	5.95e-06	5.51e-03	NA	NA
5. P	Q11IV8	tRNA-cytidine(32) 2-sulfurtransferase	8.74e-06	4.57e-06	NA	NA
5. P	Q2KZT1	7-cyano-7-deazaguanine synthase	1.18e-05	5.17e-03	NA	NA
5. P	B1HXC6	Adenosine 5'-phosphosulfate reductase	1.47e-08	1.14e-04	NA	NA
5. P	B1XFN2	7-cyano-7-deazaguanine synthase	5.08e-05	3.26e-02	NA	NA
5. P	A6VXC5	Sulfate adenylyltransferase subunit 2	4.20e-05	2.32e-03	NA	NA
5. P	A4SRG9	Sulfate adenylyltransferase subunit 2	4.61e-06	1.28e-02	NA	NA
5. P	Q7A1I5	7-cyano-7-deazaguanine synthase	1.60e-06	8.01e-07	NA	NA
5. P	B5Z0R4	tRNA-cytidine(32) 2-sulfurtransferase	1.16e-05	3.86e-04	NA	NA
5. P	B5EXJ5	7-cyano-7-deazaguanine synthase	6.72e-05	3.43e-02	NA	NA
5. P	Q68W43	7-cyano-7-deazaguanine synthase	2.29e-05	2.09e-04	NA	NA
5. P	O67728	tRNA(Ile)-lysidine synthase	8.24e-06	2.12e-02	NA	NA
5. P	Q325F7	7-cyano-7-deazaguanine synthase	5.02e-05	2.65e-02	NA	NA
5. P	B7LWK3	Sulfate adenylyltransferase subunit 2	4.27e-05	3.07e-02	NA	NA
5. P	Q9KUX2	Phosphoadenosine 5'-phosphosulfate reductase	1.14e-05	1.82e-04	NA	NA
5. P	Q2RS06	Sulfate adenylyltransferase subunit 2	5.66e-06	7.41e-04	NA	NA
5. P	Q6W2G5	7-cyano-7-deazaguanine synthase	5.52e-06	1.95e-03	NA	NA
5. P	Q6CF50	Cytoplasmic tRNA 2-thiolation protein 2	9.16e-05	3.52e-02	NA	NA
5. P	Q5N5K7	7-cyano-7-deazaguanine synthase	3.57e-05	2.81e-03	NA	NA
5. P	A1S9N7	Sulfate adenylyltransferase subunit 2	1.22e-05	8.48e-05	NA	NA
5. P	P52995	Sulfate adenylyltransferase subunit 2	2.01e-06	1.47e-02	NA	NA
5. P	B0Y1E7	Cytoplasmic tRNA 2-thiolation protein 2	3.59e-05	2.28e-03	NA	NA
5. P	B5Z711	7-cyano-7-deazaguanine synthase	3.87e-05	1.33e-05	NA	NA
5. P	B5FTU1	Phosphoadenosine 5'-phosphosulfate reductase	8.92e-07	6.08e-03	NA	NA
5. P	Q47ZY2	7-cyano-7-deazaguanine synthase 2	4.04e-06	2.02e-03	NA	NA
5. P	B0U2I4	7-cyano-7-deazaguanine synthase	8.35e-06	1.26e-02	NA	NA
5. P	Q4ZNW4	Sulfate adenylyltransferase subunit 2	6.90e-05	2.50e-02	NA	NA
5. P	B7UWY4	tRNA-cytidine(32) 2-sulfurtransferase	2.27e-05	1.09e-05	NA	NA
5. P	B1XSG8	tRNA-cytidine(32) 2-sulfurtransferase	1.16e-05	1.78e-05	NA	NA
5. P	Q7V3W6	7-cyano-7-deazaguanine synthase	9.44e-05	3.08e-03	NA	NA
5. P	B2K5E0	tRNA-cytidine(32) 2-sulfurtransferase	1.34e-05	8.83e-05	NA	NA
5. P	B5BEZ7	Phosphoadenosine 5'-phosphosulfate reductase	8.75e-07	1.49e-02	NA	NA
5. P	Q48FG8	tRNA-cytidine(32) 2-sulfurtransferase	3.63e-05	5.20e-06	NA	NA
5. P	A4WAT7	tRNA-cytidine(32) 2-sulfurtransferase	1.25e-05	2.35e-04	NA	NA
5. P	A9L1D4	tRNA-cytidine(32) 2-sulfurtransferase	8.57e-06	8.46e-06	NA	NA
5. P	B6J7A4	tRNA-cytidine(32) 2-sulfurtransferase	1.92e-05	3.24e-06	NA	NA
5. P	Q58531	GMP synthase [glutamine-hydrolyzing] subunit B	3.52e-09	4.33e-06	NA	NA
5. P	Q8ZP88	tRNA-cytidine(32) 2-sulfurtransferase	1.22e-05	2.54e-04	NA	NA
5. P	Q4UMZ0	7-cyano-7-deazaguanine synthase	9.35e-06	2.89e-05	NA	NA
5. P	Q6F9A3	7-cyano-7-deazaguanine synthase	9.71e-06	1.95e-04	NA	NA
5. P	Q4L4D0	7-cyano-7-deazaguanine synthase	1.82e-06	8.03e-06	NA	NA
5. P	Q2G1X6	7-cyano-7-deazaguanine synthase	1.36e-06	8.01e-07	NA	NA
5. P	Q2FS65	7-cyano-7-deazaguanine synthase	7.54e-06	8.79e-04	NA	NA
5. P	B0U453	tRNA-cytidine(32) 2-sulfurtransferase	1.19e-05	4.64e-04	NA	NA
5. P	A1K2H5	7-cyano-7-deazaguanine synthase	9.57e-06	5.46e-04	NA	NA
5. P	A3D4P4	tRNA-cytidine(32) 2-sulfurtransferase	9.16e-06	1.08e-05	NA	NA
5. P	Q58422	Uncharacterized protein MJ1016	1.12e-06	1.64e-09	NA	NA
5. P	A3Q3I2	Sulfate adenylyltransferase subunit 2	7.01e-05	4.73e-03	NA	NA
5. P	O07308	Sulfate adenylyltransferase subunit 2	1.83e-06	1.22e-03	NA	NA
5. P	Q59032	Uncharacterized protein MJ1638	1.15e-05	1.79e-03	NA	NA
5. P	B6IA61	tRNA-cytidine(32) 2-sulfurtransferase	1.36e-05	7.07e-04	NA	NA
5. P	A1TIG3	7-cyano-7-deazaguanine synthase	5.70e-06	4.58e-05	NA	NA
5. P	Q3AUG1	7-cyano-7-deazaguanine synthase	7.34e-05	9.76e-05	NA	NA
5. P	Q3MAK6	7-cyano-7-deazaguanine synthase	1.35e-05	2.79e-03	NA	NA
5. P	Q6HLK6	7-cyano-7-deazaguanine synthase	1.65e-06	4.87e-04	NA	NA
5. P	C1EMR8	Adenosine 5'-phosphosulfate reductase	1.49e-08	6.71e-03	NA	NA
5. P	Q0T1I6	Phosphoadenosine 5'-phosphosulfate reductase	8.36e-07	1.17e-02	NA	NA
5. P	Q7V9H8	7-cyano-7-deazaguanine synthase	5.65e-05	1.66e-03	NA	NA
5. P	A5VNC5	Sulfate adenylyltransferase subunit 2	3.36e-06	4.85e-02	NA	NA
5. P	Q5LM13	7-cyano-7-deazaguanine synthase	4.80e-06	7.60e-03	NA	NA
5. P	B1LG84	tRNA-cytidine(32) 2-sulfurtransferase	5.90e-05	3.37e-04	NA	NA
5. P	A8G7J6	7-cyano-7-deazaguanine synthase	6.10e-06	2.31e-04	NA	NA
5. P	A7I7A4	7-cyano-7-deazaguanine synthase	3.23e-06	3.24e-04	NA	NA
5. P	A6VQW6	7-cyano-7-deazaguanine synthase	4.73e-05	5.31e-04	NA	NA
5. P	B0U6V9	Phosphoadenosine 5'-phosphosulfate reductase	1.52e-09	9.31e-06	NA	NA
5. P	A0RM81	7-cyano-7-deazaguanine synthase	4.51e-06	8.23e-04	NA	NA
5. P	Q7WCA8	7-cyano-7-deazaguanine synthase	1.13e-05	2.61e-02	NA	NA
5. P	A8FVF7	tRNA-cytidine(32) 2-sulfurtransferase	1.14e-06	3.47e-04	NA	NA
5. P	C6E7E7	7-cyano-7-deazaguanine synthase	1.09e-04	1.90e-02	NA	NA
5. P	C4L8F7	tRNA-cytidine(32) 2-sulfurtransferase	6.32e-07	4.51e-04	NA	NA
5. P	P18408	Phosphoadenosine phosphosulfate reductase	2.45e-04	1.97e-04	NA	NA
5. P	Q5M4S5	7-cyano-7-deazaguanine synthase	2.32e-06	1.07e-04	NA	NA
5. P	B3R5T4	7-cyano-7-deazaguanine synthase	1.14e-05	1.59e-04	NA	NA
5. P	Q9RFS6	Adenosine 5'-phosphosulfate reductase	7.49e-07	8.29e-07	NA	NA
5. P	Q21IJ4	tRNA-cytidine(32) 2-sulfurtransferase	8.46e-06	8.23e-04	NA	NA
5. P	B1J1K3	tRNA-cytidine(32) 2-sulfurtransferase	3.38e-06	3.89e-06	NA	NA
5. P	A6VXH3	tRNA-cytidine(32) 2-sulfurtransferase	4.47e-06	5.34e-05	NA	NA
5. P	A1A8B3	7-cyano-7-deazaguanine synthase	5.14e-05	1.33e-02	NA	NA
5. P	A0RBN2	Adenosine 5'-phosphosulfate reductase	1.41e-08	1.82e-03	NA	NA
5. P	A1WSR5	7-cyano-7-deazaguanine synthase	7.86e-06	5.72e-06	NA	NA
5. P	B5RA25	tRNA-cytidine(32) 2-sulfurtransferase	1.47e-05	1.44e-04	NA	NA
5. P	A2SD77	tRNA-cytidine(32) 2-sulfurtransferase	2.10e-05	1.06e-02	NA	NA
5. P	Q81G69	7-cyano-7-deazaguanine synthase	1.71e-06	4.25e-04	NA	NA
5. P	A9R8Q5	tRNA-cytidine(32) 2-sulfurtransferase	1.23e-05	5.07e-05	NA	NA
5. P	A2STX4	7-cyano-7-deazaguanine synthase	4.92e-06	8.96e-04	NA	NA
5. P	A1V7Z5	tRNA-cytidine(32) 2-sulfurtransferase	1.73e-05	2.07e-02	NA	NA
5. P	Q83A28	7-cyano-7-deazaguanine synthase	9.84e-06	1.50e-02	NA	NA
5. P	B1L1S2	7-cyano-7-deazaguanine synthase	2.15e-06	8.30e-04	NA	NA
5. P	Q3AGF3	7-cyano-7-deazaguanine synthase	1.01e-04	1.42e-03	NA	NA
5. P	A5G8G3	Sulfate adenylyltransferase subunit 2	3.86e-06	1.61e-02	NA	NA
5. P	Q07ML3	7-cyano-7-deazaguanine synthase	1.27e-05	5.26e-04	NA	NA
5. P	Q32CG5	Phosphoadenosine 5'-phosphosulfate reductase	8.57e-07	3.32e-03	NA	NA
5. P	Q3SGT8	7-cyano-7-deazaguanine synthase	1.07e-05	4.99e-03	NA	NA
5. P	A5F888	tRNA-cytidine(32) 2-sulfurtransferase	1.38e-05	2.10e-03	NA	NA
5. P	Q1D9W6	Sulfate adenylyltransferase subunit 2	6.08e-06	5.62e-04	NA	NA
5. P	C0RIG5	tRNA-cytidine(32) 2-sulfurtransferase	7.83e-06	1.20e-05	NA	NA
5. P	B9DYU5	7-cyano-7-deazaguanine synthase	1.66e-05	4.97e-05	NA	NA
5. P	A5VQ10	tRNA-cytidine(32) 2-sulfurtransferase	1.93e-06	1.20e-05	NA	NA
5. P	B7MZ53	Sulfate adenylyltransferase subunit 2	4.58e-05	3.07e-02	NA	NA
5. P	B0CLF8	tRNA-cytidine(32) 2-sulfurtransferase	5.83e-07	2.35e-05	NA	NA
5. P	B5RDR9	Phosphoadenosine 5'-phosphosulfate reductase	8.38e-07	6.08e-03	NA	NA
5. P	Q480C9	7-cyano-7-deazaguanine synthase 1	6.30e-06	2.24e-05	NA	NA
5. P	Q7WEL6	tRNA-cytidine(32) 2-sulfurtransferase	1.65e-05	3.64e-02	NA	NA
5. P	B2FU61	tRNA-cytidine(32) 2-sulfurtransferase	9.45e-06	2.04e-03	NA	NA
5. P	B9JT86	Sulfate adenylyltransferase subunit 2	3.95e-06	4.40e-03	NA	NA
5. P	B5FGJ0	Phosphoadenosine 5'-phosphosulfate reductase	8.20e-06	1.84e-04	NA	NA
5. P	A6QF21	7-cyano-7-deazaguanine synthase	1.63e-06	8.01e-07	NA	NA
5. P	Q5HHV8	7-cyano-7-deazaguanine synthase	1.44e-06	8.01e-07	NA	NA
5. P	B2SI06	Phosphoadenosine 5'-phosphosulfate reductase	2.50e-09	5.50e-05	NA	NA
5. P	A2BTS3	7-cyano-7-deazaguanine synthase	7.65e-05	1.47e-03	NA	NA
5. P	A7HHA2	7-cyano-7-deazaguanine synthase	1.30e-05	1.14e-04	NA	NA
5. P	Q3BQG4	7-cyano-7-deazaguanine synthase	6.30e-06	8.46e-03	NA	NA
5. P	A8EWF5	7-cyano-7-deazaguanine synthase	5.13e-06	9.57e-04	NA	NA
5. P	A9KDD3	7-cyano-7-deazaguanine synthase	1.18e-05	3.46e-02	NA	NA
5. P	Q62MS6	7-cyano-7-deazaguanine synthase	1.86e-05	2.98e-05	NA	NA
5. P	Q7W0D1	7-cyano-7-deazaguanine synthase	1.17e-05	2.43e-02	NA	NA
5. P	Q98NP4	tRNA-cytidine(32) 2-sulfurtransferase	8.03e-07	6.94e-05	NA	NA
5. P	A6T2X9	7-cyano-7-deazaguanine synthase	1.11e-05	1.28e-04	NA	NA
5. P	Q5M064	7-cyano-7-deazaguanine synthase	2.38e-06	1.07e-04	NA	NA
5. P	Q2NVN2	Phosphoadenosine 5'-phosphosulfate reductase	9.69e-07	1.88e-04	NA	NA
5. P	Q66A78	tRNA-cytidine(32) 2-sulfurtransferase	1.59e-05	8.83e-05	NA	NA
5. P	Q8PEW6	tRNA-cytidine(32) 2-sulfurtransferase	1.00e-05	2.00e-03	NA	NA
5. P	O33580	Sulfate adenylyltransferase subunit 2	6.26e-06	3.02e-02	NA	NA
5. P	B3QKK5	7-cyano-7-deazaguanine synthase	1.59e-05	1.54e-03	NA	NA
5. P	B2VIU4	7-cyano-7-deazaguanine synthase	8.06e-05	3.55e-02	NA	NA
5. P	Q64WB0	7-cyano-7-deazaguanine synthase	2.15e-06	4.13e-04	NA	NA
5. P	Q65RE8	7-cyano-7-deazaguanine synthase	1.87e-06	1.33e-03	NA	NA
5. P	Q57DS4	tRNA-cytidine(32) 2-sulfurtransferase	6.94e-07	1.20e-05	NA	NA
5. P	B1IL95	7-cyano-7-deazaguanine synthase	2.01e-06	9.75e-04	NA	NA
5. P	A8AK09	7-cyano-7-deazaguanine synthase	6.03e-05	1.64e-02	NA	NA
5. P	B3QPB3	7-cyano-7-deazaguanine synthase	5.24e-06	1.73e-03	NA	NA
5. P	Q136L0	7-cyano-7-deazaguanine synthase	2.54e-05	1.82e-02	NA	NA
5. P	A9NCM4	tRNA-cytidine(32) 2-sulfurtransferase	2.17e-05	2.08e-06	NA	NA
5. P	A5GWT8	7-cyano-7-deazaguanine synthase	3.59e-04	1.01e-04	NA	NA
5. P	Q1C4L5	7-cyano-7-deazaguanine synthase	5.49e-05	2.75e-02	NA	NA
5. P	A7FU68	7-cyano-7-deazaguanine synthase	2.45e-06	5.41e-04	NA	NA
5. P	Q8YGM6	tRNA-cytidine(32) 2-sulfurtransferase	7.94e-07	7.38e-06	NA	NA
5. P	C6DJ78	tRNA-cytidine(32) 2-sulfurtransferase	1.33e-05	1.90e-04	NA	NA
5. P	A4FZY3	7-cyano-7-deazaguanine synthase	4.10e-05	1.72e-02	NA	NA
5. P	O27180	7-cyano-7-deazaguanine synthase	2.98e-06	2.89e-03	NA	NA
5. P	B0BUW5	7-cyano-7-deazaguanine synthase	1.83e-05	1.55e-06	NA	NA
5. P	Q0C438	Sulfate adenylyltransferase subunit 2	1.51e-04	1.27e-03	NA	NA
5. P	P52672	Phosphoadenosine 5'-phosphosulfate reductase	4.11e-07	6.02e-05	NA	NA
5. P	Q1BSK1	7-cyano-7-deazaguanine synthase	1.95e-05	1.14e-05	NA	NA
5. P	A9HRF6	7-cyano-7-deazaguanine synthase	2.61e-05	6.49e-04	NA	NA
5. P	A1JNM3	7-cyano-7-deazaguanine synthase	6.44e-05	4.65e-02	NA	NA
5. P	Q5PEH9	Phosphoadenosine 5'-phosphosulfate reductase	8.70e-07	1.49e-02	NA	NA
5. P	Q146Z6	7-cyano-7-deazaguanine synthase	1.97e-05	7.62e-06	NA	NA
5. P	B0U092	tRNA-cytidine(32) 2-sulfurtransferase 2	6.84e-06	1.12e-04	NA	NA
5. P	Q17XR6	7-cyano-7-deazaguanine synthase	5.42e-05	4.17e-04	NA	NA
5. P	Q2RSY8	7-cyano-7-deazaguanine synthase	9.59e-05	4.49e-02	NA	NA
5. P	Q7A6U7	7-cyano-7-deazaguanine synthase	1.65e-06	8.01e-07	NA	NA
5. P	A9A873	7-cyano-7-deazaguanine synthase	4.04e-05	3.26e-02	NA	NA
5. P	Q9PD82	Phosphoadenosine 5'-phosphosulfate reductase	1.74e-09	1.49e-05	NA	NA
5. P	B1Y8J4	7-cyano-7-deazaguanine synthase	1.20e-05	1.33e-03	NA	NA
5. P	Q0VRI8	7-cyano-7-deazaguanine synthase	1.09e-05	8.39e-03	NA	NA
5. P	Q31H76	7-cyano-7-deazaguanine synthase	1.53e-05	1.81e-03	NA	NA
5. P	A3DK21	7-cyano-7-deazaguanine synthase	9.99e-06	6.65e-03	NA	NA
5. P	B8E544	7-cyano-7-deazaguanine synthase	8.34e-05	6.42e-04	NA	NA
5. P	B0JIA6	7-cyano-7-deazaguanine synthase	3.96e-05	5.17e-03	NA	NA
5. P	Q1QZ76	tRNA-cytidine(32) 2-sulfurtransferase	1.41e-05	1.30e-06	NA	NA
5. P	A1VX95	7-cyano-7-deazaguanine synthase	3.99e-06	3.29e-03	NA	NA
5. P	A4W7B5	7-cyano-7-deazaguanine synthase	5.62e-05	4.85e-02	NA	NA
5. P	A3NQK2	tRNA-cytidine(32) 2-sulfurtransferase	1.70e-05	2.07e-02	NA	NA
5. P	Q39QC5	tRNA-cytidine(32) 2-sulfurtransferase	4.11e-05	2.80e-07	NA	NA
5. P	C6DB62	7-cyano-7-deazaguanine synthase	5.41e-05	5.66e-03	NA	NA
5. P	C1DPQ6	tRNA-cytidine(32) 2-sulfurtransferase	5.83e-06	7.09e-07	NA	NA
5. P	P56891	Adenosine 5'-phosphosulfate reductase	1.26e-05	8.17e-03	NA	NA
5. P	A8GAR6	7-cyano-7-deazaguanine synthase	6.03e-05	4.56e-03	NA	NA
5. P	B0SK77	7-cyano-7-deazaguanine synthase	2.29e-05	2.35e-05	NA	NA
5. P	Q8EE85	7-cyano-7-deazaguanine synthase	6.21e-05	9.48e-04	NA	NA
5. P	B7HHH6	Adenosine 5'-phosphosulfate reductase	3.73e-06	5.97e-03	NA	NA
5. P	B6ELU0	tRNA-cytidine(32) 2-sulfurtransferase	1.69e-05	8.46e-03	NA	NA
5. P	A1SWS4	tRNA-cytidine(32) 2-sulfurtransferase	1.29e-05	8.79e-04	NA	NA
5. P	Q14HG9	tRNA-cytidine(32) 2-sulfurtransferase 1	2.23e-05	1.11e-04	NA	NA
5. P	A9MAK8	tRNA-cytidine(32) 2-sulfurtransferase	7.73e-06	1.20e-05	NA	NA
5. P	C6E751	Sulfate adenylyltransferase subunit 2	5.16e-06	1.33e-02	NA	NA
5. P	C4ZTK1	7-cyano-7-deazaguanine synthase	6.24e-05	3.26e-02	NA	NA
5. P	B5F429	Phosphoadenosine 5'-phosphosulfate reductase	8.37e-07	6.59e-03	NA	NA
5. P	Q5E831	Sulfate adenylyltransferase subunit 2	4.71e-05	2.14e-03	NA	NA
5. P	B8CM62	7-cyano-7-deazaguanine synthase	5.13e-06	2.54e-02	NA	NA
5. P	Q8Z783	tRNA-cytidine(32) 2-sulfurtransferase	1.14e-05	1.25e-04	NA	NA
5. P	Q8UAM7	7-cyano-7-deazaguanine synthase	2.66e-06	1.18e-03	NA	NA
5. P	A7ZCA8	7-cyano-7-deazaguanine synthase	5.14e-06	6.14e-03	NA	NA
5. P	B5QW34	Phosphoadenosine 5'-phosphosulfate reductase	9.31e-07	6.08e-03	NA	NA
5. P	B0TUN8	tRNA-cytidine(32) 2-sulfurtransferase	9.85e-06	1.07e-04	NA	NA
5. P	B4S6H3	7-cyano-7-deazaguanine synthase	4.86e-06	1.38e-03	NA	NA
5. P	Q3ILR0	Sulfate adenylyltransferase subunit 2	1.03e-05	3.67e-03	NA	NA
5. P	B9M0M7	7-cyano-7-deazaguanine synthase	1.01e-04	1.44e-02	NA	NA
5. P	Q9JZJ6	tRNA-cytidine(32) 2-sulfurtransferase	1.35e-05	4.99e-03	NA	NA
5. P	Q8D9J0	tRNA-cytidine(32) 2-sulfurtransferase	1.39e-05	2.18e-03	NA	NA
5. P	Q9I4E6	tRNA-cytidine(32) 2-sulfurtransferase	3.41e-06	1.09e-05	NA	NA
5. P	A2BZ78	7-cyano-7-deazaguanine synthase	1.32e-05	1.95e-03	NA	NA
5. P	B6ELM6	Phosphoadenosine 5'-phosphosulfate reductase	1.06e-05	2.95e-05	NA	NA
5. P	Q9KS29	tRNA-cytidine(32) 2-sulfurtransferase	1.42e-05	1.50e-03	NA	NA
5. P	B0RPG5	Phosphoadenosine 5'-phosphosulfate reductase	2.97e-09	2.48e-05	NA	NA
5. P	Q7MKU7	tRNA-cytidine(32) 2-sulfurtransferase	6.38e-05	1.49e-03	NA	NA
5. P	A5WGB5	7-cyano-7-deazaguanine synthase	1.42e-05	1.88e-04	NA	NA
5. P	B5FKW0	7-cyano-7-deazaguanine synthase	6.59e-05	3.43e-02	NA	NA
5. P	Q0AI06	tRNA-cytidine(32) 2-sulfurtransferase	1.37e-05	6.08e-03	NA	NA
5. P	B8FMW6	7-cyano-7-deazaguanine synthase	1.17e-05	1.62e-04	NA	NA
5. P	Q58873	tRNA-5-methyluridine(54) 2-sulfurtransferase	3.22e-06	3.15e-02	NA	NA
5. P	Q9KAP3	7-cyano-7-deazaguanine synthase	3.11e-06	2.31e-04	NA	NA
5. P	C3P4F6	7-cyano-7-deazaguanine synthase	1.64e-06	6.74e-04	NA	NA
5. P	B7NJ50	7-cyano-7-deazaguanine synthase	5.56e-05	1.33e-02	NA	NA
5. P	C6DDH2	Phosphoadenosine 5'-phosphosulfate reductase	1.05e-06	1.22e-03	NA	NA
5. P	B5R6V6	7-cyano-7-deazaguanine synthase	6.87e-05	3.37e-02	NA	NA
5. P	A9M1Y9	7-cyano-7-deazaguanine synthase	1.35e-06	7.00e-04	NA	NA
5. P	B2IA30	Phosphoadenosine 5'-phosphosulfate reductase	1.40e-09	2.58e-06	NA	NA
5. P	B0S9S9	7-cyano-7-deazaguanine synthase	2.61e-05	2.35e-05	NA	NA
5. P	B2RJS2	7-cyano-7-deazaguanine synthase	9.95e-06	1.75e-04	NA	NA
5. P	B0SX50	7-cyano-7-deazaguanine synthase	1.46e-05	3.37e-04	NA	NA
5. P	Q1MG13	tRNA-cytidine(32) 2-sulfurtransferase	7.67e-06	1.26e-07	NA	NA
5. P	B8D7V6	Phosphoadenosine 5'-phosphosulfate reductase	4.90e-07	2.69e-05	NA	NA
5. P	B0BPR8	tRNA-cytidine(32) 2-sulfurtransferase	1.21e-05	7.27e-04	NA	NA
5. P	A1S6M5	7-cyano-7-deazaguanine synthase	5.22e-05	2.69e-03	NA	NA
5. P	A5G8S2	7-cyano-7-deazaguanine synthase	1.07e-04	1.06e-02	NA	NA
5. P	B0R9W5	7-cyano-7-deazaguanine synthase	8.68e-06	6.27e-05	NA	NA
5. P	Q3AR02	7-cyano-7-deazaguanine synthase	5.85e-06	3.29e-03	NA	NA
5. P	Q5F956	tRNA-cytidine(32) 2-sulfurtransferase	1.16e-05	4.64e-03	NA	NA
5. P	Q728E4	7-cyano-7-deazaguanine synthase	1.17e-05	4.10e-05	NA	NA
5. P	Q9HJL6	7-cyano-7-deazaguanine synthase	9.28e-05	1.66e-02	NA	NA
5. P	A8GTC6	7-cyano-7-deazaguanine synthase	1.99e-05	1.55e-06	NA	NA
5. P	Q3K7W9	7-cyano-7-deazaguanine synthase	8.43e-06	7.08e-05	NA	NA
5. P	A8GPK3	7-cyano-7-deazaguanine synthase	1.80e-05	6.87e-05	NA	NA
5. P	B4EU60	7-cyano-7-deazaguanine synthase	4.90e-05	3.64e-02	NA	NA
5. P	A6WNB3	tRNA-cytidine(32) 2-sulfurtransferase	8.28e-06	7.07e-06	NA	NA
5. P	Q62EN9	tRNA-cytidine(32) 2-sulfurtransferase	1.74e-05	2.07e-02	NA	NA
5. P	A1KU93	tRNA-cytidine(32) 2-sulfurtransferase	1.51e-06	2.70e-02	NA	NA
5. P	Q8FKA4	7-cyano-7-deazaguanine synthase	5.22e-05	1.33e-02	NA	NA
5. P	Q58742	7-cyano-7-deazaguanine synthase	4.63e-06	5.71e-03	NA	NA
5. P	P44124	7-cyano-7-deazaguanine synthase	7.04e-05	8.55e-06	NA	NA
5. P	Q03L16	7-cyano-7-deazaguanine synthase	2.17e-06	3.97e-05	NA	NA
5. P	B5F5C0	tRNA-cytidine(32) 2-sulfurtransferase	1.49e-05	2.54e-04	NA	NA
5. P	A1WY18	7-cyano-7-deazaguanine synthase	1.05e-05	3.86e-04	NA	NA
5. P	P59740	Sulfate adenylyltransferase subunit 2	5.07e-05	4.77e-02	NA	NA
5. P	Q4UNZ5	tRNA-cytidine(32) 2-sulfurtransferase	2.91e-05	9.66e-03	NA	NA
5. P	B1KMH3	Sulfate adenylyltransferase subunit 2	4.53e-06	1.16e-03	NA	NA
5. P	C3LM61	7-cyano-7-deazaguanine synthase	3.85e-05	1.69e-02	NA	NA
5. P	Q6ARX9	7-cyano-7-deazaguanine synthase	2.82e-06	4.32e-03	NA	NA
5. P	Q02ID8	7-cyano-7-deazaguanine synthase	8.66e-06	1.30e-02	NA	NA
5. P	A7MFJ8	7-cyano-7-deazaguanine synthase	4.92e-05	8.02e-03	NA	NA
5. P	C6E087	tRNA-cytidine(32) 2-sulfurtransferase	6.53e-06	1.09e-08	NA	NA
5. P	B7N4F3	tRNA-cytidine(32) 2-sulfurtransferase	5.00e-05	3.86e-04	NA	NA
5. P	A1AEU8	Phosphoadenosine 5'-phosphosulfate reductase	8.68e-07	8.24e-03	NA	NA
5. P	B6J031	tRNA-cytidine(32) 2-sulfurtransferase	2.46e-05	1.22e-06	NA	NA
5. P	Q57184	tRNA-cytidine(32) 2-sulfurtransferase	3.18e-05	6.67e-04	NA	NA
5. P	B2UTI7	7-cyano-7-deazaguanine synthase	5.29e-05	1.11e-04	NA	NA
5. P	B7LRU9	tRNA-cytidine(32) 2-sulfurtransferase	1.28e-05	2.67e-04	NA	NA
5. P	Q6GBB8	7-cyano-7-deazaguanine synthase	1.43e-06	8.01e-07	NA	NA
5. P	O67003	7-cyano-7-deazaguanine synthase	1.22e-05	2.64e-05	NA	NA
5. P	Q2EEX9	tRNA(Ile)-lysidine synthase, plastid	2.24e-05	1.08e-04	NA	NA
5. P	Q2KU24	tRNA-cytidine(32) 2-sulfurtransferase	1.20e-06	4.77e-02	NA	NA
5. P	P17853	Phosphoadenosine 5'-phosphosulfate reductase	8.34e-07	7.08e-03	NA	NA
5. P	Q2G3K1	7-cyano-7-deazaguanine synthase	7.80e-06	5.90e-04	NA	NA
5. P	Q5HR20	7-cyano-7-deazaguanine synthase	1.96e-06	4.54e-05	NA	NA
5. P	Q8XE52	7-cyano-7-deazaguanine synthase	5.90e-05	1.03e-02	NA	NA
5. P	Q8G2W6	Sulfate adenylyltransferase subunit 2	3.70e-06	4.85e-02	NA	NA
5. P	C4ZZR6	Phosphoadenosine 5'-phosphosulfate reductase	8.73e-07	1.46e-02	NA	NA
5. P	A6TZJ0	7-cyano-7-deazaguanine synthase	1.41e-06	8.01e-07	NA	NA
5. P	Q49VQ7	7-cyano-7-deazaguanine synthase	1.59e-06	1.80e-05	NA	NA
5. P	A6TD47	Phosphoadenosine 5'-phosphosulfate reductase	8.57e-07	2.33e-02	NA	NA
5. P	B2K6W4	7-cyano-7-deazaguanine synthase	4.73e-05	2.75e-02	NA	NA
5. P	C3LAL0	7-cyano-7-deazaguanine synthase	1.62e-06	6.74e-04	NA	NA
5. P	A5IGL1	tRNA-cytidine(32) 2-sulfurtransferase	1.49e-06	1.66e-03	NA	NA
5. P	B4TWA6	tRNA-cytidine(32) 2-sulfurtransferase	1.50e-05	1.86e-04	NA	NA
5. P	A1UK27	Sulfate adenylyltransferase subunit 2	7.18e-05	8.77e-03	NA	NA
5. P	Q1RC21	tRNA-cytidine(32) 2-sulfurtransferase	1.42e-05	5.95e-04	NA	NA
5. P	Q2S5G4	Adenosine 5'-phosphosulfate reductase	5.12e-06	1.71e-02	NA	NA
5. P	A9L389	Sulfate adenylyltransferase subunit 2	4.40e-06	3.70e-05	NA	NA
5. P	A4TIV5	tRNA-cytidine(32) 2-sulfurtransferase	1.55e-05	5.07e-05	NA	NA
5. P	B7N8Z8	7-cyano-7-deazaguanine synthase	5.72e-05	1.33e-02	NA	NA
5. P	B4T473	Phosphoadenosine 5'-phosphosulfate reductase	9.08e-07	5.56e-03	NA	NA
5. P	Q1RF91	7-cyano-7-deazaguanine synthase	6.05e-05	1.33e-02	NA	NA
5. P	B2SGI4	tRNA-cytidine(32) 2-sulfurtransferase	2.72e-06	1.11e-04	NA	NA
5. P	Q57KH9	Phosphoadenosine 5'-phosphosulfate reductase	9.49e-07	1.62e-02	NA	NA
5. P	A8FD22	Adenosine 5'-phosphosulfate reductase	9.86e-09	8.38e-04	NA	NA
5. P	C3LMC8	tRNA-cytidine(32) 2-sulfurtransferase	1.71e-05	1.50e-03	NA	NA
5. P	B7GG21	Adenosine 5'-phosphosulfate reductase	2.52e-08	4.48e-03	NA	NA
5. P	A7FHP9	tRNA-cytidine(32) 2-sulfurtransferase	5.10e-05	5.07e-05	NA	NA
5. P	A6LIS9	7-cyano-7-deazaguanine synthase	2.39e-06	2.72e-05	NA	NA
5. P	A9LZH0	tRNA-cytidine(32) 2-sulfurtransferase	1.36e-05	2.97e-02	NA	NA
5. P	Q5N1N0	Phosphoadenosine 5'-phosphosulfate reductase	1.22e-09	4.11e-07	NA	NA
5. P	B9JLH9	7-cyano-7-deazaguanine synthase	5.52e-06	2.23e-02	NA	NA
5. P	A5CWP9	7-cyano-7-deazaguanine synthase	9.57e-06	2.21e-05	NA	NA
5. P	Q7N8L1	Sulfate adenylyltransferase subunit 2	4.85e-05	2.97e-02	NA	NA
5. P	A7ZQJ6	Sulfate adenylyltransferase subunit 2	4.73e-05	3.07e-02	NA	NA
5. P	Q73BG0	7-cyano-7-deazaguanine synthase	1.60e-06	4.87e-04	NA	NA
5. P	A1CBI6	Cytoplasmic tRNA 2-thiolation protein 2	6.60e-05	5.06e-04	NA	NA
5. P	Q0T1I3	Sulfate adenylyltransferase subunit 2	5.15e-05	3.07e-02	NA	NA
5. P	A7H8W2	tRNA-cytidine(32) 2-sulfurtransferase	2.30e-05	3.90e-04	NA	NA
5. P	B2TZH2	Phosphoadenosine 5'-phosphosulfate reductase	8.26e-07	1.85e-02	NA	NA
5. P	B5EDQ7	7-cyano-7-deazaguanine synthase	1.49e-05	4.69e-03	NA	NA
5. P	A5GBX4	tRNA-cytidine(32) 2-sulfurtransferase	6.21e-07	1.46e-08	NA	NA
5. P	A5F3I6	Phosphoadenosine 5'-phosphosulfate reductase	1.09e-05	1.82e-04	NA	NA
5. P	Q0A550	7-cyano-7-deazaguanine synthase	1.39e-05	6.48e-03	NA	NA
5. P	B1ISR7	tRNA-cytidine(32) 2-sulfurtransferase	1.14e-05	3.86e-04	NA	NA
5. P	B2V5L9	7-cyano-7-deazaguanine synthase	1.40e-05	7.08e-05	NA	NA
5. P	Q11K42	Sulfate adenylyltransferase subunit 2	3.83e-06	8.77e-03	NA	NA
5. P	C0QST3	7-cyano-7-deazaguanine synthase	9.52e-06	6.55e-04	NA	NA
5. P	Q14H45	tRNA-cytidine(32) 2-sulfurtransferase 2	1.33e-05	8.03e-06	NA	NA
5. P	Q3SSM7	7-cyano-7-deazaguanine synthase	2.32e-05	1.01e-03	NA	NA
5. P	B7LYL5	tRNA-cytidine(32) 2-sulfurtransferase	1.17e-05	3.86e-04	NA	NA
5. P	Q81T49	Adenosine 5'-phosphosulfate reductase	1.40e-08	1.03e-05	NA	NA
5. P	Q1CIQ7	tRNA-cytidine(32) 2-sulfurtransferase	5.67e-05	5.07e-05	NA	NA
5. P	B2SI03	Sulfate adenylyltransferase subunit 2	1.07e-05	2.72e-04	NA	NA
5. P	Q12FK2	7-cyano-7-deazaguanine synthase	8.95e-06	3.98e-03	NA	NA
5. P	A7WZJ4	7-cyano-7-deazaguanine synthase	1.78e-06	8.01e-07	NA	NA
5. P	Q5YUA1	Sulfate adenylyltransferase subunit 2	1.13e-05	9.57e-04	NA	NA
5. P	B5FUP1	tRNA-cytidine(32) 2-sulfurtransferase	1.23e-05	1.44e-04	NA	NA
5. P	C4L0V4	7-cyano-7-deazaguanine synthase	1.74e-06	1.84e-03	NA	NA
5. P	Q8P610	Sulfate adenylyltransferase subunit 2	4.86e-06	8.96e-04	NA	NA
5. P	Q1I6F8	7-cyano-7-deazaguanine synthase	7.36e-06	1.57e-02	NA	NA
5. P	B5FGJ8	Sulfate adenylyltransferase subunit 2	4.65e-05	2.14e-03	NA	NA
5. P	Q0C4T2	7-cyano-7-deazaguanine synthase	1.69e-05	5.56e-05	NA	NA
5. P	A8A3P3	Phosphoadenosine 5'-phosphosulfate reductase	7.98e-07	1.85e-02	NA	NA
5. P	Q02J28	tRNA-cytidine(32) 2-sulfurtransferase	5.37e-06	1.09e-05	NA	NA
5. P	A4G964	7-cyano-7-deazaguanine synthase	1.44e-05	4.60e-03	NA	NA
5. P	B6ELP2	Sulfate adenylyltransferase subunit 2	4.59e-05	3.32e-03	NA	NA
5. P	A7Z3Y6	7-cyano-7-deazaguanine synthase	2.55e-06	5.84e-05	NA	NA
5. P	Q3JER4	7-cyano-7-deazaguanine synthase	8.57e-06	3.70e-03	NA	NA
5. P	B1XN08	Phosphoadenosine 5'-phosphosulfate reductase	2.00e-06	6.14e-07	NA	NA
5. P	A5F579	Sulfate adenylyltransferase subunit 2	4.06e-05	2.05e-02	NA	NA
5. P	B1YPW9	7-cyano-7-deazaguanine synthase	1.52e-05	5.50e-05	NA	NA
5. P	Q7NQK6	tRNA-cytidine(32) 2-sulfurtransferase	1.44e-05	2.31e-04	NA	NA
5. P	Q11B66	Adenosine 5'-phosphosulfate reductase	4.02e-08	5.90e-04	NA	NA
5. P	A6L2J2	7-cyano-7-deazaguanine synthase	3.90e-06	6.87e-04	NA	NA
5. P	Q15RL9	7-cyano-7-deazaguanine synthase	1.04e-05	2.54e-04	NA	NA
5. P	A7GMN2	7-cyano-7-deazaguanine synthase	1.64e-06	4.01e-04	NA	NA
5. P	A8GF18	tRNA-cytidine(32) 2-sulfurtransferase	1.31e-05	1.30e-04	NA	NA
5. P	Q99VR1	7-cyano-7-deazaguanine synthase	1.59e-06	8.01e-07	NA	NA
5. P	Q1LS06	tRNA-cytidine(32) 2-sulfurtransferase	9.11e-06	1.24e-05	NA	NA
5. P	Q2NV74	7-cyano-7-deazaguanine synthase	6.08e-05	7.47e-03	NA	NA
5. P	A4XRT0	7-cyano-7-deazaguanine synthase	7.31e-06	2.72e-02	NA	NA
5. P	Q3YY96	Phosphoadenosine 5'-phosphosulfate reductase	7.56e-07	1.85e-02	NA	NA
5. P	A7I1D0	7-cyano-7-deazaguanine synthase	8.20e-06	6.71e-03	NA	NA
5. P	A4YUN8	7-cyano-7-deazaguanine synthase	9.93e-06	4.82e-05	NA	NA
5. P	Q8TWG9	7-cyano-7-deazaguanine synthase	9.33e-06	2.04e-06	NA	NA
5. P	A1RGF7	Sulfate adenylyltransferase subunit 2	5.33e-06	9.57e-05	NA	NA
5. P	B7HH96	7-cyano-7-deazaguanine synthase	1.60e-06	5.78e-04	NA	NA
5. P	A7H1A8	7-cyano-7-deazaguanine synthase	4.38e-06	2.28e-03	NA	NA
5. P	Q5E590	tRNA-cytidine(32) 2-sulfurtransferase	1.34e-05	1.20e-02	NA	NA
5. P	Q2YBQ4	tRNA-cytidine(32) 2-sulfurtransferase	9.47e-06	5.90e-04	NA	NA
5. P	Q0HFM4	Sulfate adenylyltransferase subunit 2	5.38e-06	1.56e-04	NA	NA
5. P	Q8UH67	Adenosine 5'-phosphosulfate reductase	2.97e-06	1.42e-03	NA	NA
5. P	A6WGA4	7-cyano-7-deazaguanine synthase	1.43e-05	2.14e-03	NA	NA
5. P	A1IS67	tRNA-cytidine(32) 2-sulfurtransferase	1.54e-05	9.25e-03	NA	NA
5. P	A1U1K6	tRNA-cytidine(32) 2-sulfurtransferase	7.41e-06	6.55e-04	NA	NA
5. P	B3EGF5	7-cyano-7-deazaguanine synthase	5.29e-06	9.84e-04	NA	NA
5. P	Q87PG9	tRNA-cytidine(32) 2-sulfurtransferase	6.97e-07	1.29e-04	NA	NA
5. P	C3JY43	tRNA-cytidine(32) 2-sulfurtransferase	2.39e-05	6.40e-05	NA	NA
5. P	Q5HKZ5	Adenosine 5'-phosphosulfate reductase	6.24e-06	1.71e-02	NA	NA
5. P	Q8U4N3	7-cyano-7-deazaguanine synthase	1.57e-06	1.57e-02	NA	NA
5. P	Q4L9F3	Adenosine 5'-phosphosulfate reductase	6.10e-06	1.54e-02	NA	NA
5. P	B2VKN8	tRNA-cytidine(32) 2-sulfurtransferase	1.25e-05	1.28e-03	NA	NA
5. P	Q8PHD0	Sulfate adenylyltransferase subunit 2	1.07e-05	2.07e-04	NA	NA
5. P	Q3JWX0	tRNA-cytidine(32) 2-sulfurtransferase	1.74e-05	2.07e-02	NA	NA
5. P	Q5PHS1	tRNA-cytidine(32) 2-sulfurtransferase	1.18e-05	1.86e-04	NA	NA
5. P	A4IXY7	tRNA-cytidine(32) 2-sulfurtransferase 1	2.66e-06	1.11e-04	NA	NA
5. P	Q2U667	Cytoplasmic tRNA 2-thiolation protein 2	1.07e-04	4.46e-02	NA	NA
5. P	B1YFM6	7-cyano-7-deazaguanine synthase	1.47e-06	2.65e-04	NA	NA
5. P	Q0AA41	tRNA-cytidine(32) 2-sulfurtransferase	2.85e-05	1.18e-02	NA	NA
5. P	B0VSD7	Sulfate adenylyltransferase subunit 2	3.59e-06	2.26e-03	NA	NA
5. P	B0U8Y5	Sulfate adenylyltransferase subunit 2	6.37e-05	1.99e-04	NA	NA
5. P	A6WVC7	Sulfate adenylyltransferase subunit 2	3.48e-06	1.82e-02	NA	NA
5. P	Q6D5P6	tRNA-cytidine(32) 2-sulfurtransferase	1.38e-05	1.74e-04	NA	NA
5. P	A9KE14	tRNA-cytidine(32) 2-sulfurtransferase	3.02e-05	3.77e-06	NA	NA
5. P	Q5FA99	7-cyano-7-deazaguanine synthase	1.34e-06	4.01e-05	NA	NA
5. P	Q3IKE8	7-cyano-7-deazaguanine synthase	9.12e-06	4.27e-05	NA	NA
5. P	Q476S4	tRNA-cytidine(32) 2-sulfurtransferase	1.38e-06	1.40e-05	NA	NA
5. P	B1K0I8	7-cyano-7-deazaguanine synthase	1.85e-05	1.14e-05	NA	NA
5. P	B4SWU8	7-cyano-7-deazaguanine synthase	6.27e-05	2.91e-02	NA	NA
5. P	B9IV11	Adenosine 5'-phosphosulfate reductase	1.48e-08	3.80e-03	NA	NA
5. P	Q114E1	7-cyano-7-deazaguanine synthase	1.00e-05	1.51e-05	NA	NA
5. P	Q0HII5	7-cyano-7-deazaguanine synthase	5.47e-05	1.09e-05	NA	NA
5. P	Q8P3H2	tRNA-cytidine(32) 2-sulfurtransferase	6.27e-06	1.09e-02	NA	NA
5. P	A4XWK1	tRNA-cytidine(32) 2-sulfurtransferase	3.19e-06	1.73e-05	NA	NA
5. P	Q8DI59	7-cyano-7-deazaguanine synthase	1.19e-05	3.91e-03	NA	NA
5. P	Q83KS7	tRNA-cytidine(32) 2-sulfurtransferase	1.19e-05	3.37e-04	NA	NA
5. P	O06737	Adenosine 5'-phosphosulfate reductase 2	2.58e-08	3.12e-02	NA	NA
5. P	Q9I4Z2	7-cyano-7-deazaguanine synthase	8.71e-06	1.30e-02	NA	NA
5. P	Q3JXD3	7-cyano-7-deazaguanine synthase	1.86e-05	2.98e-05	NA	NA
5. P	Q89LP8	7-cyano-7-deazaguanine synthase	1.96e-05	3.41e-04	NA	NA
5. P	A6V9Z6	7-cyano-7-deazaguanine synthase	8.62e-06	5.82e-03	NA	NA
5. P	A3N0Y3	tRNA-cytidine(32) 2-sulfurtransferase	1.33e-05	1.22e-03	NA	NA
5. P	B1JJU2	tRNA-cytidine(32) 2-sulfurtransferase	1.36e-05	5.07e-05	NA	NA
5. P	B1JHR4	7-cyano-7-deazaguanine synthase	5.89e-05	2.75e-02	NA	NA
5. P	B7VBC3	Adenosine 5'-phosphosulfate reductase	7.89e-06	4.03e-02	NA	NA
5. P	C4ZV92	tRNA-cytidine(32) 2-sulfurtransferase	1.64e-05	4.17e-03	NA	NA
5. P	Q7CYD2	tRNA-cytidine(32) 2-sulfurtransferase	1.71e-05	2.26e-05	NA	NA
5. P	Q0HVA7	tRNA-cytidine(32) 2-sulfurtransferase	9.62e-06	8.32e-05	NA	NA
5. P	B4UF77	tRNA-cytidine(32) 2-sulfurtransferase	6.03e-05	1.11e-04	NA	NA
5. P	A8H0A3	Sulfate adenylyltransferase subunit 2	5.14e-06	8.62e-04	NA	NA
5. P	Q21HP4	7-cyano-7-deazaguanine synthase	8.16e-06	1.57e-02	NA	NA
5. P	B6I6E2	Sulfate adenylyltransferase subunit 2	5.14e-05	3.07e-02	NA	NA
5. P	B1I3W2	7-cyano-7-deazaguanine synthase	4.86e-06	1.40e-04	NA	NA
5. P	Q83CP2	tRNA-cytidine(32) 2-sulfurtransferase	2.61e-05	3.10e-07	NA	NA
5. P	P57499	Sulfate adenylyltransferase subunit 2	7.92e-06	1.74e-02	NA	NA
5. P	B7INB4	Adenosine 5'-phosphosulfate reductase	3.09e-06	2.12e-02	NA	NA
5. P	Q46G70	7-cyano-7-deazaguanine synthase	4.92e-06	4.64e-03	NA	NA
5. P	B8H3X3	7-cyano-7-deazaguanine synthase	1.29e-05	1.40e-04	NA	NA
5. P	A8YZY3	7-cyano-7-deazaguanine synthase	1.43e-06	8.01e-07	NA	NA
5. P	B0KTI3	7-cyano-7-deazaguanine synthase	8.38e-06	3.89e-02	NA	NA
5. P	B0BQ32	7-cyano-7-deazaguanine synthase	3.90e-06	4.96e-04	NA	NA
5. P	A3QEN0	7-cyano-7-deazaguanine synthase	3.59e-06	2.25e-02	NA	NA
5. P	Q7ML86	7-cyano-7-deazaguanine synthase	5.41e-05	4.61e-02	NA	NA
5. P	Q31XB4	Sulfate adenylyltransferase subunit 2	4.04e-06	4.77e-02	NA	NA
5. P	B8D9K2	Sulfate adenylyltransferase subunit 2	6.64e-06	1.74e-02	NA	NA
5. P	Q2IUE0	7-cyano-7-deazaguanine synthase 2	2.53e-05	1.88e-04	NA	NA
5. P	Q2S7U9	7-cyano-7-deazaguanine synthase	3.96e-06	5.31e-04	NA	NA
5. P	A1U490	Sulfate adenylyltransferase subunit 2 2	4.93e-06	5.27e-03	NA	NA
5. P	B5XRN3	tRNA-cytidine(32) 2-sulfurtransferase	1.28e-05	2.72e-04	NA	NA
5. P	A1V788	7-cyano-7-deazaguanine synthase	1.99e-05	2.98e-05	NA	NA
5. P	Q9CN39	tRNA-cytidine(32) 2-sulfurtransferase	1.27e-05	4.09e-04	NA	NA
5. P	Q6MLE7	tRNA-cytidine(32) 2-sulfurtransferase	3.06e-06	1.13e-06	NA	NA
5. P	A8GVR7	7-cyano-7-deazaguanine synthase	1.31e-05	9.10e-05	NA	NA
5. P	P0C634	7-cyano-7-deazaguanine synthase	4.08e-06	3.67e-03	NA	NA
5. P	Q9JRT1	Adenosine 5'-phosphosulfate reductase	1.06e-09	1.54e-03	NA	NA
5. P	A1RJY8	7-cyano-7-deazaguanine synthase	1.14e-04	1.10e-04	NA	NA
5. P	A9MXN4	tRNA-cytidine(32) 2-sulfurtransferase	1.16e-05	5.41e-04	NA	NA
5. P	Q4UY06	Sulfate adenylyltransferase subunit 2	1.03e-05	8.96e-04	NA	NA
5. P	B5Z3B4	Sulfate adenylyltransferase subunit 2	4.71e-05	3.93e-02	NA	NA
5. P	A8PVM6	Cytoplasmic tRNA 2-thiolation protein 1	1.04e-04	3.07e-02	NA	NA
5. P	A1B9Q5	7-cyano-7-deazaguanine synthase	4.85e-06	6.65e-03	NA	NA
5. P	A7GMW0	Adenosine 5'-phosphosulfate reductase	1.46e-08	9.92e-03	NA	NA
5. P	C3L9N6	Adenosine 5'-phosphosulfate reductase	2.22e-06	1.03e-05	NA	NA
5. P	A9MWC2	7-cyano-7-deazaguanine synthase	5.11e-05	3.40e-02	NA	NA
5. P	B7I610	tRNA-cytidine(32) 2-sulfurtransferase	2.20e-05	8.23e-05	NA	NA
5. P	Q5WKF5	Adenosine 5'-phosphosulfate reductase	4.86e-05	1.79e-04	NA	NA
5. P	A5UBX9	tRNA-cytidine(32) 2-sulfurtransferase	1.08e-05	7.13e-04	NA	NA
5. P	B3PTD3	Sulfate adenylyltransferase subunit 2	4.48e-06	1.36e-02	NA	NA
5. P	B2IUR7	7-cyano-7-deazaguanine synthase	1.35e-05	6.36e-04	NA	NA
5. P	A1UT10	tRNA-cytidine(32) 2-sulfurtransferase	4.31e-06	2.26e-04	NA	NA
5. P	B1IUR7	Phosphoadenosine 5'-phosphosulfate reductase	8.88e-07	1.46e-02	NA	NA
5. P	Q31NK6	7-cyano-7-deazaguanine synthase	3.55e-05	2.81e-03	NA	NA
5. P	Q6FDA0	Sulfate adenylyltransferase subunit 2	5.49e-06	6.96e-03	NA	NA
5. P	Q8G189	tRNA-cytidine(32) 2-sulfurtransferase	3.45e-05	1.20e-05	NA	NA
5. P	A6VIL3	7-cyano-7-deazaguanine synthase	4.13e-05	1.49e-02	NA	NA
5. P	Q2T2A4	7-cyano-7-deazaguanine synthase	2.16e-05	1.55e-05	NA	NA
5. P	Q87WW0	Sulfate adenylyltransferase subunit 2	6.34e-05	2.50e-02	NA	NA
5. P	A7NBC6	tRNA-cytidine(32) 2-sulfurtransferase 1	8.02e-05	9.21e-06	NA	NA
5. P	Q8FEI9	Phosphoadenosine 5'-phosphosulfate reductase	7.81e-07	2.48e-02	NA	NA
5. P	B4E7W5	7-cyano-7-deazaguanine synthase	1.81e-05	1.08e-05	NA	NA
5. P	Q0A6T1	Phosphoadenosine 5'-phosphosulfate reductase	5.26e-07	2.33e-05	NA	NA
5. P	A2S7T4	tRNA-cytidine(32) 2-sulfurtransferase	1.26e-05	2.07e-02	NA	NA
5. P	Q87DH1	Phosphoadenosine 5'-phosphosulfate reductase	1.31e-09	2.58e-06	NA	NA
5. P	Q55468	7-cyano-7-deazaguanine synthase	4.74e-05	5.67e-04	NA	NA
5. P	A1K2P7	tRNA-cytidine(32) 2-sulfurtransferase	1.12e-06	7.15e-05	NA	NA
5. P	B3GXW8	tRNA-cytidine(32) 2-sulfurtransferase	1.40e-05	5.90e-04	NA	NA
5. P	A4Y9X3	Sulfate adenylyltransferase subunit 2	5.08e-06	9.57e-05	NA	NA
5. P	Q57SA8	7-cyano-7-deazaguanine synthase	4.94e-05	2.72e-02	NA	NA
5. P	Q2LVL3	7-cyano-7-deazaguanine synthase	8.04e-06	7.74e-03	NA	NA
5. P	A7N0R3	tRNA-cytidine(32) 2-sulfurtransferase	7.73e-06	9.28e-05	NA	NA
5. P	Q8EEM4	tRNA-cytidine(32) 2-sulfurtransferase	9.55e-06	1.62e-05	NA	NA
5. P	A1AWK9	7-cyano-7-deazaguanine synthase	1.12e-05	2.43e-05	NA	NA
5. P	Q1QM87	7-cyano-7-deazaguanine synthase	2.19e-05	1.12e-02	NA	NA
5. P	Q8FEJ0	Sulfate adenylyltransferase subunit 2	3.69e-05	1.68e-02	NA	NA
5. P	Q7MV08	7-cyano-7-deazaguanine synthase	1.06e-05	1.84e-04	NA	NA
5. P	B2U0Z1	tRNA-cytidine(32) 2-sulfurtransferase	1.14e-05	4.91e-04	NA	NA
5. P	A7ZIK2	7-cyano-7-deazaguanine synthase	5.97e-05	2.65e-02	NA	NA
5. P	Q1IHK6	7-cyano-7-deazaguanine synthase	4.64e-06	5.49e-07	NA	NA
5. P	A0Q736	tRNA-cytidine(32) 2-sulfurtransferase 2	2.49e-05	4.38e-06	NA	NA
5. P	B9IUT0	7-cyano-7-deazaguanine synthase	2.33e-06	7.27e-04	NA	NA
5. P	Q46I95	7-cyano-7-deazaguanine synthase	1.04e-04	2.83e-04	NA	NA
5. P	A4IYL5	tRNA-cytidine(32) 2-sulfurtransferase 2	1.90e-05	1.53e-06	NA	NA
5. P	Q8CMX3	Adenosine 5'-phosphosulfate reductase	6.31e-06	6.71e-03	NA	NA
5. P	B9JS46	7-cyano-7-deazaguanine synthase	4.94e-06	8.84e-03	NA	NA
5. P	A0L4R8	7-cyano-7-deazaguanine synthase	3.52e-05	1.44e-04	NA	NA
5. P	B2UD46	tRNA-cytidine(32) 2-sulfurtransferase	1.12e-05	6.50e-06	NA	NA
5. P	A4SMC4	tRNA-cytidine(32) 2-sulfurtransferase	1.05e-05	3.58e-04	NA	NA
5. P	Q9PFT8	tRNA-cytidine(32) 2-sulfurtransferase	1.73e-05	2.97e-04	NA	NA
5. P	A8ANW8	Phosphoadenosine 5'-phosphosulfate reductase	8.12e-07	8.09e-03	NA	NA
5. P	B0C253	7-cyano-7-deazaguanine synthase	1.11e-05	1.33e-03	NA	NA
5. P	Q5WG41	7-cyano-7-deazaguanine synthase	1.72e-06	1.71e-05	NA	NA
5. P	Q2SBG0	Sulfate adenylyltransferase subunit 2	4.74e-05	1.20e-02	NA	NA
5. P	Q30U93	Sulfate adenylyltransferase subunit 2	6.24e-05	4.65e-02	NA	NA
5. P	B2SIG7	tRNA-cytidine(32) 2-sulfurtransferase	4.35e-05	4.73e-04	NA	NA
5. P	B5XV26	Phosphoadenosine 5'-phosphosulfate reductase	7.85e-07	2.46e-02	NA	NA
5. P	Q1IDN2	tRNA-cytidine(32) 2-sulfurtransferase	5.74e-06	1.46e-05	NA	NA
5. P	A8LMA2	tRNA-cytidine(32) 2-sulfurtransferase	5.14e-07	4.77e-04	NA	NA
5. P	Q88NI3	7-cyano-7-deazaguanine synthase	7.31e-06	1.12e-02	NA	NA
5. P	Q2YNH1	tRNA-cytidine(32) 2-sulfurtransferase	8.73e-06	1.20e-05	NA	NA
5. P	A9NBS5	7-cyano-7-deazaguanine synthase	1.03e-05	4.03e-02	NA	NA
5. P	Q39BV2	7-cyano-7-deazaguanine synthase	1.77e-05	1.32e-05	NA	NA
5. P	Q0I3K3	tRNA-cytidine(32) 2-sulfurtransferase	1.36e-05	1.12e-03	NA	NA
5. P	Q1GTF3	7-cyano-7-deazaguanine synthase 1	8.63e-05	1.65e-04	NA	NA
5. P	B4SRP3	tRNA-cytidine(32) 2-sulfurtransferase	3.17e-05	1.22e-04	NA	NA
5. P	A9MM16	7-cyano-7-deazaguanine synthase	4.22e-05	1.74e-02	NA	NA
5. P	Q0HVF0	7-cyano-7-deazaguanine synthase	5.27e-05	1.32e-05	NA	NA
5. P	Q87L92	Phosphoadenosine 5'-phosphosulfate reductase	1.72e-05	5.34e-05	NA	NA
5. P	B8GJL3	7-cyano-7-deazaguanine synthase	6.65e-06	1.79e-03	NA	NA
5. P	A3N4E3	7-cyano-7-deazaguanine synthase	1.92e-05	2.98e-05	NA	NA
5. P	Q6M0P3	7-cyano-7-deazaguanine synthase	5.02e-06	2.94e-02	NA	NA
5. P	A1AUS1	tRNA-cytidine(32) 2-sulfurtransferase	6.00e-05	3.47e-09	NA	NA
5. P	Q9WWW8	7-cyano-7-deazaguanine synthase	7.24e-06	1.12e-02	NA	NA
5. P	C5CNK9	tRNA-cytidine(32) 2-sulfurtransferase	1.20e-05	2.69e-03	NA	NA
5. P	B7MM21	tRNA-cytidine(32) 2-sulfurtransferase	1.22e-05	5.95e-04	NA	NA
5. P	Q8EB09	Sulfate adenylyltransferase subunit 2	5.35e-06	1.77e-04	NA	NA
5. P	Q8F964	7-cyano-7-deazaguanine synthase	1.30e-05	8.87e-04	NA	NA
5. P	Q2IPE3	tRNA-cytidine(32) 2-sulfurtransferase	1.76e-05	1.51e-04	NA	NA
5. P	Q0TEA4	Phosphoadenosine 5'-phosphosulfate reductase	8.46e-07	2.48e-02	NA	NA
5. P	Q6LM68	Sulfate adenylyltransferase subunit 2	4.52e-06	2.87e-02	NA	NA
5. P	A7MWG4	Sulfate adenylyltransferase subunit 2	4.39e-06	4.13e-02	NA	NA
5. P	A3PNA9	tRNA-cytidine(32) 2-sulfurtransferase	5.60e-07	1.60e-06	NA	NA
5. P	O25356	7-cyano-7-deazaguanine synthase	3.87e-05	1.25e-05	NA	NA
5. P	P57501	Phosphoadenosine 5'-phosphosulfate reductase	4.77e-07	1.10e-05	NA	NA
5. P	Q0A653	Sulfate adenylyltransferase subunit 2 2	1.34e-05	6.19e-03	NA	NA
5. P	C1FN27	7-cyano-7-deazaguanine synthase	2.22e-06	2.48e-03	NA	NA
5. P	A1TWU4	7-cyano-7-deazaguanine synthase	3.38e-06	4.13e-04	NA	NA
5. P	A5F8G4	7-cyano-7-deazaguanine synthase	3.94e-05	1.69e-02	NA	NA
5. P	B7IN35	7-cyano-7-deazaguanine synthase	1.63e-06	4.87e-04	NA	NA
5. P	A6Q9Q9	7-cyano-7-deazaguanine synthase	5.79e-06	2.92e-03	NA	NA
5. P	A4TPD5	7-cyano-7-deazaguanine synthase	5.53e-05	2.75e-02	NA	NA
5. P	B1LSA1	Sulfate adenylyltransferase subunit 2	8.13e-06	6.36e-04	NA	NA
5. P	Q7N0M0	7-cyano-7-deazaguanine synthase	4.72e-05	1.71e-02	NA	NA
5. P	Q3K8D5	tRNA-cytidine(32) 2-sulfurtransferase	6.19e-06	3.51e-05	NA	NA
5. P	B2K567	Phosphoadenosine 5'-phosphosulfate reductase	1.09e-06	5.51e-04	NA	NA
5. P	Q3BPY3	Phosphoadenosine 5'-phosphosulfate reductase	2.74e-09	8.32e-05	NA	NA
5. P	A7GXH1	7-cyano-7-deazaguanine synthase	3.30e-06	1.38e-03	NA	NA
5. P	B7HK63	7-cyano-7-deazaguanine synthase	1.67e-06	7.27e-04	NA	NA
5. P	P72794	Phosphoadenosine 5'-phosphosulfate reductase	1.45e-06	3.35e-06	NA	NA
5. P	B5ZUF6	Sulfate adenylyltransferase subunit 2	4.84e-06	4.57e-02	NA	NA
5. P	B4T9F0	7-cyano-7-deazaguanine synthase	4.87e-05	3.37e-02	NA	NA
5. P	A1B0E2	tRNA-cytidine(32) 2-sulfurtransferase	6.10e-06	1.86e-04	NA	NA
5. P	Q0ALV0	Sulfate adenylyltransferase subunit 2	2.66e-06	3.79e-02	NA	NA
5. P	Q1LTP5	Sulfate adenylyltransferase subunit 2	5.00e-06	1.41e-02	NA	NA
5. P	A4ILN7	7-cyano-7-deazaguanine synthase	2.27e-06	8.83e-06	NA	NA
5. P	B6HZQ1	7-cyano-7-deazaguanine synthase	5.93e-05	2.65e-02	NA	NA
5. P	Q1CTN3	7-cyano-7-deazaguanine synthase	2.08e-06	4.98e-06	NA	NA
5. P	Q02KP7	Adenosine 5'-phosphosulfate reductase	7.94e-06	4.03e-02	NA	NA
5. P	B6EH68	7-cyano-7-deazaguanine synthase	4.95e-06	3.63e-03	NA	NA
5. P	Q55309	Phosphoadenosine 5'-phosphosulfate reductase	1.09e-09	4.11e-07	NA	NA
5. P	A5E8X6	Sulfate adenylyltransferase subunit 2	7.61e-06	2.10e-02	NA	NA
5. P	A9W4X2	Sulfate adenylyltransferase subunit 2	6.64e-06	3.50e-03	NA	NA
5. P	B7URE9	tRNA-cytidine(32) 2-sulfurtransferase	1.28e-05	2.97e-04	NA	NA
5. P	A9L185	7-cyano-7-deazaguanine synthase	9.31e-05	2.00e-03	NA	NA
5. P	B5FE41	tRNA-cytidine(32) 2-sulfurtransferase	1.38e-05	1.20e-02	NA	NA
5. P	A9QZP5	7-cyano-7-deazaguanine synthase	6.25e-05	2.75e-02	NA	NA
5. P	Q6G5E1	tRNA-cytidine(32) 2-sulfurtransferase	2.82e-07	4.44e-05	NA	NA
5. P	Q32JK2	7-cyano-7-deazaguanine synthase	6.02e-05	1.08e-02	NA	NA
5. P	Q9RX35	tRNA-cytidine(32) 2-sulfurtransferase	2.43e-05	5.20e-06	NA	NA
5. P	A1AEU6	Sulfate adenylyltransferase subunit 2	4.67e-05	1.68e-02	NA	NA
5. P	A7FLB7	7-cyano-7-deazaguanine synthase	5.01e-05	2.75e-02	NA	NA
5. P	B1LJK1	7-cyano-7-deazaguanine synthase	5.78e-05	1.72e-02	NA	NA
5. P	B7HKE5	Adenosine 5'-phosphosulfate reductase	1.76e-08	1.06e-02	NA	NA
5. P	C3LRB8	Phosphoadenosine 5'-phosphosulfate reductase	1.09e-05	1.82e-04	NA	NA
5. P	B5ED57	tRNA-cytidine(32) 2-sulfurtransferase	6.97e-06	1.09e-08	NA	NA
5. P	A8FUY4	7-cyano-7-deazaguanine synthase	6.37e-05	1.34e-04	NA	NA
5. P	Q5ZXN3	tRNA-cytidine(32) 2-sulfurtransferase	1.73e-05	2.28e-03	NA	NA
5. P	Q9CP69	7-cyano-7-deazaguanine synthase	3.05e-06	1.07e-05	NA	NA
5. P	Q8TIF3	7-cyano-7-deazaguanine synthase	2.97e-06	4.99e-03	NA	NA
5. P	Q4ZWK2	7-cyano-7-deazaguanine synthase	8.74e-06	3.83e-04	NA	NA
5. P	Q58102	Uncharacterized protein MJ0690	9.78e-05	7.10e-08	NA	NA
5. P	Q1RJ87	7-cyano-7-deazaguanine synthase	1.31e-05	9.10e-05	NA	NA
5. P	C0Q3V6	tRNA-cytidine(32) 2-sulfurtransferase	1.44e-05	4.82e-04	NA	NA
5. P	Q8K986	7-cyano-7-deazaguanine synthase	5.33e-05	1.53e-03	NA	NA
5. P	Q9HIH8	GMP synthase [glutamine-hydrolyzing] subunit B	2.41e-08	1.10e-02	NA	NA
5. P	B2U7H6	7-cyano-7-deazaguanine synthase	6.60e-06	5.01e-04	NA	NA
5. P	Q7MB85	Phosphoadenosine 5'-phosphosulfate reductase	9.35e-07	2.78e-05	NA	NA
5. P	Q317V0	7-cyano-7-deazaguanine synthase	8.44e-05	2.00e-03	NA	NA
5. P	A7NC76	tRNA-cytidine(32) 2-sulfurtransferase 2	2.99e-06	2.95e-05	NA	NA
5. P	A5EXQ4	tRNA-cytidine(32) 2-sulfurtransferase	7.46e-06	1.06e-06	NA	NA
5. P	P77756	7-cyano-7-deazaguanine synthase	5.83e-05	3.26e-02	NA	NA
5. P	Q3Z4V4	7-cyano-7-deazaguanine synthase	6.13e-05	2.65e-02	NA	NA
5. P	B7L681	7-cyano-7-deazaguanine synthase	4.84e-05	2.41e-02	NA	NA
5. P	Q7WQB2	7-cyano-7-deazaguanine synthase	1.08e-05	2.43e-02	NA	NA
5. P	Q1B510	Sulfate adenylyltransferase subunit 2	7.59e-05	8.77e-03	NA	NA
5. P	Q1GJX4	tRNA-cytidine(32) 2-sulfurtransferase	6.57e-07	9.01e-05	NA	NA
5. P	Q5NFP3	tRNA-cytidine(32) 2-sulfurtransferase 2	1.81e-06	8.03e-06	NA	NA
5. P	Q2KB48	Sulfate adenylyltransferase subunit 2	4.97e-06	1.80e-02	NA	NA
5. P	B7GY44	tRNA-cytidine(32) 2-sulfurtransferase	6.96e-07	8.23e-05	NA	NA
5. P	Q1CZQ8	tRNA-cytidine(32) 2-sulfurtransferase	3.83e-05	3.77e-06	NA	NA
5. P	C3P516	Adenosine 5'-phosphosulfate reductase	1.49e-08	1.03e-05	NA	NA
5. P	Q15VB5	Sulfate adenylyltransferase subunit 2	4.39e-06	1.76e-03	NA	NA
5. P	Q5E839	Phosphoadenosine 5'-phosphosulfate reductase	7.44e-06	2.07e-04	NA	NA
5. P	Q5QUZ6	7-cyano-7-deazaguanine synthase	4.23e-06	4.63e-05	NA	NA
5. P	Q8D985	7-cyano-7-deazaguanine synthase	4.82e-05	1.95e-02	NA	NA
5. P	Q2NXR3	tRNA-cytidine(32) 2-sulfurtransferase	9.01e-06	5.51e-04	NA	NA
5. P	B3H1X8	7-cyano-7-deazaguanine synthase	2.20e-06	9.21e-04	NA	NA
5. P	B3QS09	7-cyano-7-deazaguanine synthase	3.98e-06	1.06e-03	NA	NA
5. P	O57836	7-cyano-7-deazaguanine synthase	1.46e-06	1.98e-03	NA	NA
5. P	A8IMX7	7-cyano-7-deazaguanine synthase	1.55e-05	1.66e-05	NA	NA
5. P	C1F844	7-cyano-7-deazaguanine synthase	4.64e-06	1.87e-05	NA	NA
5. P	Q1R7T6	Phosphoadenosine 5'-phosphosulfate reductase	8.42e-07	8.24e-03	NA	NA
5. P	B2HXA8	tRNA-cytidine(32) 2-sulfurtransferase	1.41e-05	8.23e-05	NA	NA
5. P	A4T0E0	tRNA-cytidine(32) 2-sulfurtransferase	1.19e-05	3.85e-05	NA	NA
5. P	B3ENV8	7-cyano-7-deazaguanine synthase	3.88e-06	2.97e-03	NA	NA
5. P	Q5P3T7	tRNA-cytidine(32) 2-sulfurtransferase	1.00e-05	5.82e-03	NA	NA
5. P	A0KTI2	Sulfate adenylyltransferase subunit 2	5.44e-06	1.56e-04	NA	NA
5. P	Q2P0H4	Sulfate adenylyltransferase subunit 2	1.05e-05	2.72e-04	NA	NA
5. P	Q73B76	Adenosine 5'-phosphosulfate reductase	1.30e-08	2.45e-03	NA	NA
5. P	A9N2E4	Phosphoadenosine 5'-phosphosulfate reductase	8.59e-07	6.08e-03	NA	NA
5. P	B0RYY8	tRNA-cytidine(32) 2-sulfurtransferase	1.73e-05	1.09e-02	NA	NA
5. P	B4F233	Phosphoadenosine 5'-phosphosulfate reductase	6.11e-07	5.36e-04	NA	NA
5. P	B5FF08	7-cyano-7-deazaguanine synthase	5.35e-06	5.97e-03	NA	NA
5. P	Q3BPY6	Sulfate adenylyltransferase subunit 2	5.47e-06	3.21e-04	NA	NA
5. P	B0TTD5	Sulfate adenylyltransferase subunit 2	5.25e-06	7.41e-04	NA	NA
5. P	Q0K7W8	7-cyano-7-deazaguanine synthase	8.46e-06	2.20e-04	NA	NA
5. P	Q5NG17	tRNA-cytidine(32) 2-sulfurtransferase 1	4.66e-06	1.11e-04	NA	NA
5. P	Q4UY09	Phosphoadenosine 5'-phosphosulfate reductase	2.89e-09	2.48e-05	NA	NA
5. P	Q12MM8	7-cyano-7-deazaguanine synthase	5.19e-05	4.24e-03	NA	NA
5. P	A4XFR8	7-cyano-7-deazaguanine synthase	3.37e-06	4.53e-02	NA	NA
5. P	A2S8H7	7-cyano-7-deazaguanine synthase	1.89e-05	2.98e-05	NA	NA
5. P	B7UJR7	7-cyano-7-deazaguanine synthase	5.45e-05	1.65e-02	NA	NA
5. P	Q63YL0	7-cyano-7-deazaguanine synthase	1.91e-05	2.98e-05	NA	NA
5. P	Q0A977	Sulfate adenylyltransferase subunit 2 1	1.56e-05	4.40e-03	NA	NA
5. P	A1BHS4	7-cyano-7-deazaguanine synthase	5.75e-06	2.02e-03	NA	NA
5. P	Q32GI6	tRNA-cytidine(32) 2-sulfurtransferase	1.24e-05	7.34e-04	NA	NA
5. P	Q65KI6	7-cyano-7-deazaguanine synthase	1.96e-06	1.26e-04	NA	NA
5. P	Q8Y306	tRNA-cytidine(32) 2-sulfurtransferase	5.14e-05	1.83e-06	NA	NA
5. P	A3QCU1	Sulfate adenylyltransferase subunit 2	5.93e-06	3.70e-03	NA	NA
5. P	Q82XN5	7-cyano-7-deazaguanine synthase	8.27e-06	1.28e-03	NA	NA
5. P	Q87DG8	Sulfate adenylyltransferase subunit 2	7.87e-06	1.11e-03	NA	NA
5. P	Q2A447	tRNA-cytidine(32) 2-sulfurtransferase 1	1.70e-06	9.21e-06	NA	NA
5. P	Q9JVT8	7-cyano-7-deazaguanine synthase	1.40e-06	1.37e-03	NA	NA
5. P	Q1LJY1	7-cyano-7-deazaguanine synthase	7.50e-06	4.31e-05	NA	NA
5. P	A6VP68	tRNA-cytidine(32) 2-sulfurtransferase	1.06e-05	1.44e-04	NA	NA
5. P	B5EF56	Sulfate adenylyltransferase subunit 2	4.87e-06	4.93e-02	NA	NA
5. P	Q5LW09	tRNA-cytidine(32) 2-sulfurtransferase	7.54e-07	3.01e-05	NA	NA
5. P	A0KBJ0	7-cyano-7-deazaguanine synthase	1.81e-05	1.14e-05	NA	NA
5. P	A6WN68	7-cyano-7-deazaguanine synthase	7.55e-05	5.26e-04	NA	NA
5. P	B0V9N5	Sulfate adenylyltransferase subunit 2	4.36e-06	2.26e-03	NA	NA
5. P	Q6D820	7-cyano-7-deazaguanine synthase	4.98e-05	5.36e-03	NA	NA
5. P	Q2J7K8	7-cyano-7-deazaguanine synthase	7.76e-05	2.40e-05	NA	NA
5. P	Q04PP1	7-cyano-7-deazaguanine synthase	5.39e-05	1.33e-03	NA	NA
5. P	A1TDE9	Sulfate adenylyltransferase subunit 2	6.26e-05	1.85e-02	NA	NA
5. P	B2TZH9	Sulfate adenylyltransferase subunit 2	4.99e-05	3.55e-02	NA	NA
5. P	A4J5C7	7-cyano-7-deazaguanine synthase	3.39e-06	6.65e-03	NA	NA
5. P	Q0T7D9	7-cyano-7-deazaguanine synthase	5.20e-05	3.26e-02	NA	NA
5. P	Q4K6M3	7-cyano-7-deazaguanine synthase 2	6.92e-05	9.84e-03	NA	NA
5. P	Q0HIM8	tRNA-cytidine(32) 2-sulfurtransferase	9.79e-06	8.32e-05	NA	NA
5. P	B5QU45	7-cyano-7-deazaguanine synthase	5.24e-05	3.43e-02	NA	NA
5. P	Q81FZ1	Adenosine 5'-phosphosulfate reductase	3.43e-06	5.76e-03	NA	NA
5. P	A1DDV3	Cytoplasmic tRNA 2-thiolation protein 2	5.17e-05	4.01e-04	NA	NA
5. P	Q6LR31	tRNA-cytidine(32) 2-sulfurtransferase	7.71e-07	3.03e-04	NA	NA
5. P	Q63DV9	Adenosine 5'-phosphosulfate reductase	1.73e-08	2.69e-03	NA	NA
5. P	A9M7D7	Sulfate adenylyltransferase subunit 2	4.13e-06	4.85e-02	NA	NA
5. P	Q7VKY7	tRNA-cytidine(32) 2-sulfurtransferase	1.33e-05	7.55e-04	NA	NA
5. P	Q7UFU6	7-cyano-7-deazaguanine synthase	1.84e-05	5.50e-05	NA	NA
5. P	B0KT32	tRNA-cytidine(32) 2-sulfurtransferase	5.29e-06	9.41e-06	NA	NA
5. P	A1W9G0	7-cyano-7-deazaguanine synthase	1.04e-05	1.74e-03	NA	NA
5. P	Q7N3Y7	tRNA-cytidine(32) 2-sulfurtransferase	1.24e-05	1.71e-03	NA	NA
5. P	A1VB03	7-cyano-7-deazaguanine synthase	7.42e-06	4.10e-05	NA	NA
5. P	A6U9M6	tRNA-cytidine(32) 2-sulfurtransferase	8.63e-06	1.36e-06	NA	NA
5. P	A0Q1F7	7-cyano-7-deazaguanine synthase	2.67e-06	2.57e-04	NA	NA
5. P	B7KR63	7-cyano-7-deazaguanine synthase	2.57e-05	2.40e-05	NA	NA
5. P	Q9KCT3	Adenosine 5'-phosphosulfate reductase	3.27e-06	8.23e-04	NA	NA
5. P	B7LXH5	Phosphoadenosine 5'-phosphosulfate reductase	7.84e-07	9.25e-03	NA	NA
5. P	Q220R7	7-cyano-7-deazaguanine synthase	2.44e-05	2.57e-03	NA	NA
5. P	Q603C7	tRNA-cytidine(32) 2-sulfurtransferase	1.95e-05	1.47e-03	NA	NA
5. P	Q3A6S7	tRNA-cytidine(32) 2-sulfurtransferase	5.21e-07	7.52e-08	NA	NA
5. P	Q5V0E6	7-cyano-7-deazaguanine synthase	6.32e-06	1.22e-02	NA	NA
5. P	B2AGH6	tRNA-cytidine(32) 2-sulfurtransferase	8.36e-06	3.17e-06	NA	NA
5. P	Q3ADI5	7-cyano-7-deazaguanine synthase	3.36e-08	2.69e-05	NA	NA
5. P	B4RMM2	tRNA-cytidine(32) 2-sulfurtransferase	1.21e-05	1.24e-02	NA	NA
5. P	Q9K0Q9	7-cyano-7-deazaguanine synthase	1.33e-06	4.46e-04	NA	NA
5. P	Q4QK81	tRNA-cytidine(32) 2-sulfurtransferase	4.32e-05	2.04e-03	NA	NA
5. P	Q8CWK6	Phosphoadenosine 5'-phosphosulfate reductase	6.57e-05	8.46e-04	NA	NA
5. P	Q0KF09	tRNA-cytidine(32) 2-sulfurtransferase	8.94e-06	8.71e-04	NA	NA
5. P	A1ST25	Sulfate adenylyltransferase subunit 2	4.96e-06	1.19e-03	NA	NA
5. P	Q2P553	7-cyano-7-deazaguanine synthase	6.72e-06	4.09e-03	NA	NA
5. P	Q320D9	tRNA-cytidine(32) 2-sulfurtransferase	1.23e-05	1.82e-04	NA	NA
5. P	A5GPN0	7-cyano-7-deazaguanine synthase	9.67e-05	3.46e-02	NA	NA
5. P	Q1CL58	7-cyano-7-deazaguanine synthase	5.69e-05	2.75e-02	NA	NA
5. P	Q5P4Z2	7-cyano-7-deazaguanine synthase	8.51e-06	4.42e-04	NA	NA
5. P	A4WWJ3	tRNA-cytidine(32) 2-sulfurtransferase	9.24e-06	6.71e-06	NA	NA
5. P	Q98GP9	Adenosine 5'-phosphosulfate reductase	5.49e-05	1.98e-03	NA	NA
5. P	B7MYR0	Phosphoadenosine 5'-phosphosulfate reductase	8.46e-07	8.24e-03	NA	NA
5. P	Q5L1C0	7-cyano-7-deazaguanine synthase	2.29e-06	8.64e-06	NA	NA
5. P	Q2T1V1	tRNA-cytidine(32) 2-sulfurtransferase	1.28e-05	1.88e-02	NA	NA
5. P	A1U3Y0	Sulfate adenylyltransferase subunit 2 1	1.41e-05	1.09e-02	NA	NA
5. P	Q0UDH1	Cytoplasmic tRNA 2-thiolation protein 2	3.23e-05	6.55e-04	NA	NA
5. P	B2URN8	Sulfate adenylyltransferase subunit 2	6.00e-06	2.24e-03	NA	NA
5. P	B7M3T7	7-cyano-7-deazaguanine synthase	5.39e-05	2.10e-02	NA	NA
5. P	Q2W000	7-cyano-7-deazaguanine synthase	1.09e-05	7.00e-04	NA	NA
5. P	Q5E4H1	7-cyano-7-deazaguanine synthase	5.01e-06	4.90e-03	NA	NA
5. P	B7MQG0	7-cyano-7-deazaguanine synthase	6.08e-05	1.33e-02	NA	NA
5. P	A6VX48	7-cyano-7-deazaguanine synthase	7.03e-06	1.14e-03	NA	NA
5. P	Q72DA1	Cytidylate kinase	5.58e-02	2.54e-02	NA	NA
5. P	Q4QLA8	7-cyano-7-deazaguanine synthase	1.49e-06	1.74e-04	NA	NA
5. P	C1DRE9	7-cyano-7-deazaguanine synthase	7.76e-06	1.22e-02	NA	NA
5. P	C5BRQ7	tRNA-cytidine(32) 2-sulfurtransferase	9.96e-06	2.12e-03	NA	NA
5. P	Q0T3Z1	tRNA-cytidine(32) 2-sulfurtransferase	1.46e-05	3.37e-04	NA	NA
5. P	Q12QM9	Sulfate adenylyltransferase subunit 2	1.25e-05	3.01e-06	NA	NA
5. P	B6JLM6	7-cyano-7-deazaguanine synthase	2.92e-06	4.58e-05	NA	NA
5. P	Q609K0	7-cyano-7-deazaguanine synthase	9.42e-06	5.45e-05	NA	NA
5. P	A4Y6T9	tRNA-cytidine(32) 2-sulfurtransferase	6.98e-06	2.33e-05	NA	NA
5. P	B8HQ99	7-cyano-7-deazaguanine synthase	1.36e-05	4.34e-04	NA	NA
5. P	A1WHW6	tRNA-cytidine(32) 2-sulfurtransferase	1.26e-05	2.65e-02	NA	NA
5. P	B0UU61	tRNA-cytidine(32) 2-sulfurtransferase	1.06e-05	1.60e-03	NA	NA
5. P	Q8EQP2	Adenosine 5'-phosphosulfate reductase	2.72e-08	1.56e-03	NA	NA
5. P	O58038	tRNA-5-methyluridine(54) 2-sulfurtransferase	1.44e-07	5.92e-03	NA	NA
5. P	A5VZV6	7-cyano-7-deazaguanine synthase	7.26e-06	8.84e-03	NA	NA
5. P	A0KX75	7-cyano-7-deazaguanine synthase	4.77e-05	1.89e-05	NA	NA
5. P	A8FXJ5	Sulfate adenylyltransferase subunit 2 1	4.12e-06	4.48e-03	NA	NA
5. P	B2FRM5	7-cyano-7-deazaguanine synthase	5.73e-06	1.46e-03	NA	NA
5. P	Q9ZLJ7	7-cyano-7-deazaguanine synthase	3.28e-05	4.31e-05	NA	NA
5. P	C1DQ71	Sulfate adenylyltransferase subunit 2	8.78e-05	2.37e-02	NA	NA
5. P	Q8DUK7	7-cyano-7-deazaguanine synthase	2.15e-06	1.54e-04	NA	NA
5. P	A1VJX7	7-cyano-7-deazaguanine synthase	8.44e-06	6.03e-03	NA	NA
5. P	P13441	Sulfate adenylyltransferase subunit 2	1.56e-06	7.14e-03	NA	NA
5. P	B2JJV1	7-cyano-7-deazaguanine synthase	2.01e-05	9.91e-06	NA	NA
5. P	A1JJS4	Phosphoadenosine 5'-phosphosulfate reductase	1.12e-06	1.39e-03	NA	NA
5. P	Q2SK22	tRNA-cytidine(32) 2-sulfurtransferase	5.20e-06	3.08e-05	NA	NA
5. P	B2I4Y4	7-cyano-7-deazaguanine synthase	7.98e-06	1.58e-02	NA	NA
5. P	A7ZQK5	Phosphoadenosine 5'-phosphosulfate reductase	8.47e-07	9.25e-03	NA	NA
5. P	Q11B05	7-cyano-7-deazaguanine synthase	4.35e-06	4.77e-04	NA	NA
5. P	B7N6Y2	Sulfate adenylyltransferase subunit 2	5.09e-05	3.07e-02	NA	NA
5. P	B4RTX3	7-cyano-7-deazaguanine synthase	3.51e-06	3.75e-04	NA	NA
5. P	Q8Z460	Phosphoadenosine 5'-phosphosulfate reductase	8.24e-07	1.06e-02	NA	NA
5. P	Q81TC7	7-cyano-7-deazaguanine synthase	1.90e-06	6.74e-04	NA	NA
5. P	Q82UJ4	tRNA-cytidine(32) 2-sulfurtransferase	1.16e-05	7.60e-03	NA	NA
5. P	B9KNZ4	tRNA-cytidine(32) 2-sulfurtransferase	7.25e-06	1.60e-06	NA	NA
5. P	Q66DS7	7-cyano-7-deazaguanine synthase	5.12e-05	2.75e-02	NA	NA
5. P	Q213Y7	7-cyano-7-deazaguanine synthase	1.74e-05	1.28e-02	NA	NA
5. P	B3PC22	7-cyano-7-deazaguanine synthase	1.03e-05	2.04e-03	NA	NA
5. P	O31675	7-cyano-7-deazaguanine synthase	2.58e-06	7.01e-05	NA	NA
5. P	A3CXN3	7-cyano-7-deazaguanine synthase	6.08e-06	5.04e-03	NA	NA
5. P	Q12WI3	7-cyano-7-deazaguanine synthase	4.17e-06	6.74e-04	NA	NA
5. P	Q87CW1	7-cyano-7-deazaguanine synthase	9.00e-06	1.58e-02	NA	NA
5. P	Q7NK24	Phosphoadenosine 5'-phosphosulfate reductase	5.36e-05	1.30e-03	NA	NA
5. P	Q8Y1F2	7-cyano-7-deazaguanine synthase	5.69e-06	2.92e-04	NA	NA
5. P	A6Q342	7-cyano-7-deazaguanine synthase	2.60e-06	2.00e-02	NA	NA
5. P	Q9PD79	Sulfate adenylyltransferase subunit 2	1.50e-05	1.10e-02	NA	NA
5. P	B8EE60	Sulfate adenylyltransferase subunit 2	4.85e-06	9.96e-05	NA	NA
5. P	A6V906	tRNA-cytidine(32) 2-sulfurtransferase	6.72e-06	1.21e-05	NA	NA
5. P	A8F2I5	7-cyano-7-deazaguanine synthase	1.84e-05	1.91e-06	NA	NA
5. P	Q12N51	tRNA-cytidine(32) 2-sulfurtransferase	1.12e-05	1.32e-04	NA	NA
5. P	Q1QVW9	7-cyano-7-deazaguanine synthase	5.18e-06	2.50e-06	NA	NA
5. P	A6WXM7	7-cyano-7-deazaguanine synthase	6.17e-06	6.89e-03	NA	NA
5. P	Q5WYK1	tRNA-cytidine(32) 2-sulfurtransferase	1.52e-06	5.08e-03	NA	NA
5. P	A3PFI0	7-cyano-7-deazaguanine synthase	8.44e-05	1.07e-03	NA	NA
5. P	B7MUI7	tRNA-cytidine(32) 2-sulfurtransferase	1.18e-05	7.27e-04	NA	NA
5. P	B0CEK4	tRNA-cytidine(32) 2-sulfurtransferase	8.99e-06	8.15e-05	NA	NA
5. P	Q8X7U3	Phosphoadenosine 5'-phosphosulfate reductase	8.44e-07	3.15e-02	NA	NA
5. P	Q8ETE9	7-cyano-7-deazaguanine synthase	7.40e-06	1.26e-03	NA	NA
5. P	Q48FD4	7-cyano-7-deazaguanine synthase	9.04e-06	3.09e-04	NA	NA
5. P	C3KVW4	7-cyano-7-deazaguanine synthase	1.90e-06	3.94e-04	NA	NA
5. P	A6X1K4	tRNA-cytidine(32) 2-sulfurtransferase	6.10e-07	2.89e-05	NA	NA
5. P	Q7NCE2	7-cyano-7-deazaguanine synthase	4.51e-05	6.59e-03	NA	NA
5. P	Q88MD2	tRNA-cytidine(32) 2-sulfurtransferase	5.16e-06	7.94e-06	NA	NA
5. P	Q0BMI3	tRNA-cytidine(32) 2-sulfurtransferase 1	1.61e-05	9.21e-06	NA	NA
5. P	Q63Y74	tRNA-cytidine(32) 2-sulfurtransferase	1.27e-05	2.07e-02	NA	NA
5. P	Q1R7T9	Sulfate adenylyltransferase subunit 2	5.32e-06	1.68e-02	NA	NA
5. P	B2I7H1	tRNA-cytidine(32) 2-sulfurtransferase	1.37e-05	3.37e-04	NA	NA
5. P	Q7M8H4	7-cyano-7-deazaguanine synthase	4.64e-06	1.86e-05	NA	NA
5. P	C3MIE1	Adenosine 5'-phosphosulfate reductase	3.73e-05	2.49e-04	NA	NA
5. P	Q3IYY8	tRNA-cytidine(32) 2-sulfurtransferase	5.38e-07	1.14e-06	NA	NA
5. P	A9AKB0	tRNA-cytidine(32) 2-sulfurtransferase	1.67e-05	4.34e-02	NA	NA
5. P	Q1GEY7	7-cyano-7-deazaguanine synthase	5.91e-06	2.43e-03	NA	NA
5. P	A2C5G1	7-cyano-7-deazaguanine synthase	1.10e-04	4.25e-04	NA	NA
5. P	B7MKM6	Sulfate adenylyltransferase subunit 2	5.07e-05	1.68e-02	NA	NA
5. P	B9MMB0	7-cyano-7-deazaguanine synthase	3.29e-06	5.92e-03	NA	NA
5. P	Q57909	Probable sulfurtransferase	4.95e-05	6.50e-06	NA	NA
5. P	A6WJU3	Sulfate adenylyltransferase subunit 2	4.61e-06	7.99e-05	NA	NA
5. P	Q9PCC3	7-cyano-7-deazaguanine synthase	9.09e-06	2.63e-02	NA	NA
5. P	Q2FIS8	7-cyano-7-deazaguanine synthase	1.38e-06	8.01e-07	NA	NA
5. P	C4K2L7	7-cyano-7-deazaguanine synthase	1.98e-05	1.12e-06	NA	NA
5. P	B8D9K4	Phosphoadenosine 5'-phosphosulfate reductase	4.57e-07	8.64e-06	NA	NA
5. P	Q474K5	7-cyano-7-deazaguanine synthase	6.14e-06	4.87e-04	NA	NA
5. P	Q8KF00	7-cyano-7-deazaguanine synthase	5.00e-06	1.01e-03	NA	NA
5. P	Q8PHC7	Phosphoadenosine 5'-phosphosulfate reductase	2.89e-09	3.66e-05	NA	NA
5. P	Q57P06	tRNA-cytidine(32) 2-sulfurtransferase	1.48e-05	4.82e-04	NA	NA
5. P	C3MD80	tRNA-cytidine(32) 2-sulfurtransferase	8.65e-06	1.06e-05	NA	NA
5. P	B7LWP0	Phosphoadenosine 5'-phosphosulfate reductase	8.69e-07	1.46e-02	NA	NA
5. P	Q082E9	tRNA-cytidine(32) 2-sulfurtransferase	1.34e-05	2.42e-04	NA	NA
5. P	B7LEI1	Phosphoadenosine 5'-phosphosulfate reductase	8.09e-07	9.25e-03	NA	NA
5. P	Q0TI22	tRNA-cytidine(32) 2-sulfurtransferase	5.62e-05	7.27e-04	NA	NA
5. P	Q5NRM3	Phosphoadenosine 5'-phosphosulfate reductase	1.22e-06	4.95e-03	NA	NA
5. P	A0KX28	tRNA-cytidine(32) 2-sulfurtransferase	9.75e-06	8.32e-05	NA	NA
5. P	A1KSD4	7-cyano-7-deazaguanine synthase	1.18e-06	2.65e-04	NA	NA
5. P	B0VDQ2	tRNA-cytidine(32) 2-sulfurtransferase	5.23e-07	8.23e-05	NA	NA
5. P	B4TIS7	tRNA-cytidine(32) 2-sulfurtransferase	1.57e-05	1.20e-04	NA	NA
5. P	A0RBG1	7-cyano-7-deazaguanine synthase	1.99e-06	4.87e-04	NA	NA
5. P	C5D7Y2	7-cyano-7-deazaguanine synthase	2.01e-06	4.13e-04	NA	NA
5. P	A5DPQ4	Cytoplasmic tRNA 2-thiolation protein 1	2.27e-05	4.73e-02	NA	NA
5. P	Q9ZCM9	7-cyano-7-deazaguanine synthase	2.78e-05	2.64e-03	NA	NA
5. P	Q7UBT0	Phosphoadenosine 5'-phosphosulfate reductase	8.18e-07	9.25e-03	NA	NA
5. P	Q6LM60	Phosphoadenosine 5'-phosphosulfate reductase	8.29e-06	1.07e-06	NA	NA
5. P	Q604B7	Sulfate adenylyltransferase subunit 2	1.17e-05	1.38e-03	NA	NA
5. P	Q0BLX1	tRNA-cytidine(32) 2-sulfurtransferase 2	2.60e-06	2.95e-05	NA	NA
5. P	A6QB13	Sulfate adenylyltransferase subunit 2	4.30e-06	3.47e-03	NA	NA
5. P	F9UST4	Pyridinium-3,5-bisthiocarboxylic acid mononucleotide synthase	4.89e-06	2.42e-07	NA	NA
5. P	Q0TKJ7	7-cyano-7-deazaguanine synthase	6.03e-05	1.33e-02	NA	NA
5. P	A0Q6E3	tRNA-cytidine(32) 2-sulfurtransferase 1	2.38e-05	9.38e-05	NA	NA
5. P	C3KDP1	Sulfate adenylyltransferase subunit 2	8.38e-05	4.49e-02	NA	NA
5. P	B2T1L3	7-cyano-7-deazaguanine synthase	1.83e-05	3.07e-06	NA	NA
5. P	Q8P607	Phosphoadenosine 5'-phosphosulfate reductase	2.71e-09	2.48e-05	NA	NA
5. P	Q0I671	7-cyano-7-deazaguanine synthase	8.10e-05	1.78e-02	NA	NA
5. P	A5W7U0	tRNA-cytidine(32) 2-sulfurtransferase	5.09e-06	7.94e-06	NA	NA
5. P	Q7D0L8	Sulfate adenylyltransferase subunit 2	5.45e-06	6.71e-03	NA	NA
5. P	A0LJR5	7-cyano-7-deazaguanine synthase	1.24e-05	2.52e-04	NA	NA
5. P	B8F6L5	7-cyano-7-deazaguanine synthase	4.62e-06	4.82e-06	NA	NA
5. P	Q0HYA6	Sulfate adenylyltransferase subunit 2	5.42e-06	1.56e-04	NA	NA
5. P	A8H4Q7	tRNA-cytidine(32) 2-sulfurtransferase	8.58e-06	3.18e-04	NA	NA
5. P	Q2P0H1	Phosphoadenosine 5'-phosphosulfate reductase	2.30e-09	5.50e-05	NA	NA
5. P	B0RPG8	Sulfate adenylyltransferase subunit 2	4.90e-06	8.96e-04	NA	NA
5. P	Q07UU1	Sulfate adenylyltransferase subunit 2	5.57e-06	1.85e-02	NA	NA
5. P	B1XCH3	tRNA-cytidine(32) 2-sulfurtransferase	1.41e-05	4.17e-03	NA	NA
5. P	A1JND8	tRNA-cytidine(32) 2-sulfurtransferase	1.44e-05	6.15e-05	NA	NA
5. P	C3JYR8	7-cyano-7-deazaguanine synthase	6.87e-06	1.73e-03	NA	NA
5. P	A7MW43	7-cyano-7-deazaguanine synthase	5.29e-05	3.61e-02	NA	NA
5. P	Q055M9	7-cyano-7-deazaguanine synthase	8.31e-05	1.33e-03	NA	NA
5. P	A9IUA2	tRNA-cytidine(32) 2-sulfurtransferase	4.68e-07	3.21e-05	NA	NA
5. P	C4XPJ3	7-cyano-7-deazaguanine synthase	1.90e-05	3.60e-03	NA	NA
5. P	B0RPZ6	7-cyano-7-deazaguanine synthase	6.55e-06	5.08e-03	NA	NA
5. P	Q0VQ34	tRNA-cytidine(32) 2-sulfurtransferase	5.56e-06	3.58e-04	NA	NA
5. P	A6LWG7	7-cyano-7-deazaguanine synthase	1.92e-06	1.50e-04	NA	NA
5. P	C3PLH1	7-cyano-7-deazaguanine synthase	1.80e-05	1.85e-06	NA	NA
5. P	Q7NSB9	7-cyano-7-deazaguanine synthase	3.46e-04	1.84e-04	NA	NA
5. P	B9MBJ3	7-cyano-7-deazaguanine synthase	9.94e-06	1.74e-03	NA	NA
5. P	A5UCR9	7-cyano-7-deazaguanine synthase	1.68e-06	2.09e-04	NA	NA
5. P	Q5LFI6	7-cyano-7-deazaguanine synthase	2.61e-06	4.13e-04	NA	NA
5. P	Q8ZC72	7-cyano-7-deazaguanine synthase	6.37e-05	2.75e-02	NA	NA
5. P	B3PID5	tRNA-cytidine(32) 2-sulfurtransferase	4.53e-05	9.39e-04	NA	NA
5. P	Q3A090	7-cyano-7-deazaguanine synthase	1.21e-04	4.77e-02	NA	NA
5. P	B7UHH1	Sulfate adenylyltransferase subunit 2	5.21e-05	3.07e-02	NA	NA
5. P	A1VEW5	Cytidylate kinase	5.63e-02	2.77e-02	NA	NA
5. P	Q979P0	7-cyano-7-deazaguanine synthase	3.46e-04	2.50e-02	NA	NA
5. P	A1RJP0	tRNA-cytidine(32) 2-sulfurtransferase	8.97e-06	2.33e-05	NA	NA
5. P	B4TMD3	7-cyano-7-deazaguanine synthase	5.19e-05	2.84e-02	NA	NA
5. P	Q2IG55	7-cyano-7-deazaguanine synthase	1.13e-05	2.19e-05	NA	NA
5. P	B0VT10	tRNA-cytidine(32) 2-sulfurtransferase	1.77e-05	6.60e-05	NA	NA
5. P	B1KFY6	tRNA-cytidine(32) 2-sulfurtransferase	9.91e-06	2.09e-04	NA	NA
5. P	Q5H288	7-cyano-7-deazaguanine synthase	6.45e-06	4.09e-03	NA	NA
5. P	B7UXV6	7-cyano-7-deazaguanine synthase	8.65e-06	1.30e-02	NA	NA
5. P	Q478G3	7-cyano-7-deazaguanine synthase	1.02e-05	3.50e-03	NA	NA
5. P	Q2Y5H4	7-cyano-7-deazaguanine synthase	9.40e-06	1.66e-02	NA	NA
5. P	A9VKR8	7-cyano-7-deazaguanine synthase	1.37e-06	6.55e-04	NA	NA
5. P	Q6GIT0	7-cyano-7-deazaguanine synthase	1.77e-06	8.01e-07	NA	NA
5. P	Q8XEU3	7-cyano-7-deazaguanine synthase	4.80e-05	3.43e-02	NA	NA
5. P	B7JG06	Adenosine 5'-phosphosulfate reductase	1.44e-08	4.64e-03	NA	NA
5. P	B7GLA4	7-cyano-7-deazaguanine synthase	2.37e-06	2.70e-04	NA	NA
5. P	A1STX3	7-cyano-7-deazaguanine synthase	3.64e-06	5.96e-05	NA	NA
5. P	Q5NNR3	7-cyano-7-deazaguanine synthase	9.68e-06	3.31e-05	NA	NA
5. P	B7MKM9	Phosphoadenosine 5'-phosphosulfate reductase	8.65e-07	8.24e-03	NA	NA
5. P	Q1QCP3	7-cyano-7-deazaguanine synthase	3.35e-05	4.15e-07	NA	NA
5. P	A1S6K0	tRNA-cytidine(32) 2-sulfurtransferase	9.84e-06	2.62e-03	NA	NA
5. P	A5D2E1	7-cyano-7-deazaguanine synthase	2.59e-06	8.69e-03	NA	NA
5. P	C1EM49	7-cyano-7-deazaguanine synthase	1.56e-06	4.87e-04	NA	NA
5. P	B7L5B2	tRNA-cytidine(32) 2-sulfurtransferase	1.16e-05	3.79e-04	NA	NA
5. P	A7Z4H7	Adenosine 5'-phosphosulfate reductase	2.43e-08	1.57e-03	NA	NA
5. P	B0CJ51	Sulfate adenylyltransferase subunit 2	3.53e-06	4.85e-02	NA	NA
5. P	Q31XM6	Phosphoadenosine 5'-phosphosulfate reductase	8.52e-07	1.85e-02	NA	NA
5. P	Q8X7X4	Sulfate adenylyltransferase subunit 2	3.56e-06	3.93e-02	NA	NA
5. P	C1D6L0	7-cyano-7-deazaguanine synthase	6.97e-06	3.28e-06	NA	NA
5. P	Q2YSL9	7-cyano-7-deazaguanine synthase	1.68e-06	1.07e-06	NA	NA
5. P	Q1CYI2	7-cyano-7-deazaguanine synthase	1.15e-05	1.50e-03	NA	NA
5. P	Q8X8Q5	tRNA-cytidine(32) 2-sulfurtransferase	1.08e-05	7.07e-04	NA	NA
5. P	Q8EB01	Phosphoadenosine 5'-phosphosulfate reductase	8.85e-07	2.84e-03	NA	NA
5. P	Q0BQ87	7-cyano-7-deazaguanine synthase	8.88e-06	7.15e-06	NA	NA
5. P	Q5HXE2	7-cyano-7-deazaguanine synthase	3.80e-06	3.67e-03	NA	NA
5. P	Q1LTK2	7-cyano-7-deazaguanine synthase	5.93e-05	9.75e-03	NA	NA
5. P	A8H532	7-cyano-7-deazaguanine synthase	5.25e-06	8.46e-04	NA	NA
5. P	D3RNJ4	Adenosine 5'-phosphosulfate reductase	7.75e-10	4.16e-08	NA	NA
5. P	Q59ZY9	Cytoplasmic tRNA 2-thiolation protein 2	3.90e-04	2.89e-02	NA	NA
5. P	Q87B85	tRNA-cytidine(32) 2-sulfurtransferase	1.32e-05	3.37e-04	NA	NA
5. P	Q11U13	tRNA-cytidine(32) 2-sulfurtransferase	1.10e-05	3.35e-06	NA	NA
5. P	C5D5A7	Adenosine 5'-phosphosulfate reductase	1.58e-08	1.09e-02	NA	NA
5. P	B0TY35	tRNA-cytidine(32) 2-sulfurtransferase 1	8.35e-05	5.12e-05	NA	NA
5. P	Q9V2I3	7-cyano-7-deazaguanine synthase	1.50e-06	4.48e-03	NA	NA
5. P	A7GDP2	7-cyano-7-deazaguanine synthase	1.56e-06	9.21e-04	NA	NA
5. P	Q3B5F4	7-cyano-7-deazaguanine synthase	3.91e-06	3.37e-04	NA	NA
5. P	Q30RN3	7-cyano-7-deazaguanine synthase	7.50e-06	7.88e-03	NA	NA
5. P	Q2K7U6	tRNA-cytidine(32) 2-sulfurtransferase	9.43e-07	6.01e-07	NA	NA
5. P	B4F231	Sulfate adenylyltransferase subunit 2	1.21e-05	1.04e-03	NA	NA
5. P	Q3BMF4	tRNA-cytidine(32) 2-sulfurtransferase	3.59e-05	2.62e-04	NA	NA
5. P	C0Q7Y0	7-cyano-7-deazaguanine synthase	5.12e-05	2.72e-02	NA	NA
5. P	A4JIU1	7-cyano-7-deazaguanine synthase	1.55e-05	7.08e-05	NA	NA
5. P	Q6N608	7-cyano-7-deazaguanine synthase	1.76e-05	2.92e-03	NA	NA
5. P	A2R475	Cytoplasmic tRNA 2-thiolation protein 2	6.34e-05	1.39e-02	NA	NA
5. P	Q7UZH5	7-cyano-7-deazaguanine synthase	8.42e-05	9.94e-04	NA	NA
5. P	Q0ARS7	7-cyano-7-deazaguanine synthase	1.12e-05	1.14e-03	NA	NA
5. P	Q97D53	7-cyano-7-deazaguanine synthase	2.64e-06	2.01e-04	NA	NA
5. P	Q83M51	7-cyano-7-deazaguanine synthase	5.99e-05	2.65e-02	NA	NA
5. P	Q082U2	7-cyano-7-deazaguanine synthase	9.88e-06	4.38e-04	NA	NA
5. P	Q7MHA7	Phosphoadenosine 5'-phosphosulfate reductase	9.80e-06	9.66e-04	NA	NA
5. P	A4SDQ0	7-cyano-7-deazaguanine synthase	5.08e-06	1.63e-03	NA	NA
5. P	Q8FHP6	tRNA-cytidine(32) 2-sulfurtransferase	1.19e-05	7.27e-04	NA	NA
5. P	B2S568	tRNA-cytidine(32) 2-sulfurtransferase	7.49e-06	1.20e-05	NA	NA
5. P	Q0AJ94	7-cyano-7-deazaguanine synthase	7.51e-06	1.82e-02	NA	NA
5. P	A3MNQ3	7-cyano-7-deazaguanine synthase	2.22e-05	2.98e-05	NA	NA
5. P	A8FXM2	Sulfate adenylyltransferase subunit 2 2	4.27e-06	2.10e-02	NA	NA
5. P	B8JEH9	tRNA-cytidine(32) 2-sulfurtransferase	5.04e-05	7.45e-05	NA	NA
5. P	A4YYA7	Sulfate adenylyltransferase subunit 2	3.74e-06	5.08e-03	NA	NA
5. P	B5Z3C5	Phosphoadenosine 5'-phosphosulfate reductase	8.51e-07	3.15e-02	NA	NA
5. P	B8IRX8	Sulfate adenylyltransferase subunit 2	7.79e-06	1.36e-02	NA	NA
5. P	A0B6A6	7-cyano-7-deazaguanine synthase	5.94e-06	4.42e-04	NA	NA
5. P	Q9A3P2	7-cyano-7-deazaguanine synthase	1.22e-05	1.40e-04	NA	NA
5. P	Q1IX43	tRNA-cytidine(32) 2-sulfurtransferase	1.64e-05	3.55e-05	NA	NA
5. P	A6URL5	7-cyano-7-deazaguanine synthase	5.51e-06	1.95e-03	NA	NA
5. P	Q4K7E8	7-cyano-7-deazaguanine synthase 1	9.19e-06	1.08e-04	NA	NA
5. P	A9BXV6	tRNA-cytidine(32) 2-sulfurtransferase	9.39e-07	2.89e-02	NA	NA
5. P	Q65TL6	tRNA-cytidine(32) 2-sulfurtransferase	1.16e-05	1.77e-04	NA	NA
5. P	P17854	Phosphoadenosine 5'-phosphosulfate reductase	8.66e-07	1.46e-02	NA	NA
5. P	A9G6U6	tRNA-cytidine(32) 2-sulfurtransferase	1.28e-05	2.64e-05	NA	NA
5. P	A9MF18	Phosphoadenosine 5'-phosphosulfate reductase	7.97e-07	1.39e-02	NA	NA
5. P	Q39RP7	Sulfate adenylyltransferase subunit 2	4.48e-06	4.65e-02	NA	NA
5. P	Q87Y44	7-cyano-7-deazaguanine synthase	8.10e-06	2.00e-03	NA	NA
5. P	B7K7J4	7-cyano-7-deazaguanine synthase	2.74e-06	1.13e-02	NA	NA
5. P	Q7VNH6	7-cyano-7-deazaguanine synthase	2.23e-06	7.60e-05	NA	NA
5. P	A8AGE0	tRNA-cytidine(32) 2-sulfurtransferase	4.73e-05	1.82e-04	NA	NA
5. P	Q9X5U0	Sulfate adenylyltransferase subunit 2	1.07e-04	2.80e-05	NA	NA
5. P	Q3Z194	tRNA-cytidine(32) 2-sulfurtransferase	1.37e-05	7.07e-04	NA	NA
5. P	A8FCH9	7-cyano-7-deazaguanine synthase	3.11e-06	1.24e-04	NA	NA
5. P	Q98AM3	7-cyano-7-deazaguanine synthase 2	6.79e-06	9.57e-05	NA	NA
5. P	B4T6P5	tRNA-cytidine(32) 2-sulfurtransferase	1.49e-05	1.44e-04	NA	NA
5. P	P72338	Sulfate adenylyltransferase subunit 2	3.93e-06	7.14e-03	NA	NA
5. P	Q1LTP3	Phosphoadenosine 5'-phosphosulfate reductase	8.94e-07	1.20e-03	NA	NA
5. P	Q72VK9	7-cyano-7-deazaguanine synthase	1.27e-05	8.87e-04	NA	NA
5. P	Q16A99	tRNA-cytidine(32) 2-sulfurtransferase	5.79e-06	1.59e-05	NA	NA
5. P	Q6F8Q3	tRNA-cytidine(32) 2-sulfurtransferase	4.95e-07	3.44e-05	NA	NA
5. P	Q5JHU5	7-cyano-7-deazaguanine synthase	1.92e-06	2.32e-03	NA	NA
5. P	A1AAV5	tRNA-cytidine(32) 2-sulfurtransferase	1.37e-05	5.46e-04	NA	NA
5. P	Q66ED2	Phosphoadenosine 5'-phosphosulfate reductase	1.03e-06	5.51e-04	NA	NA
5. P	B6I6F6	Phosphoadenosine 5'-phosphosulfate reductase	7.57e-07	9.25e-03	NA	NA
5. P	B7NT99	Phosphoadenosine 5'-phosphosulfate reductase	8.33e-07	9.25e-03	NA	NA
5. P	A2SCE3	7-cyano-7-deazaguanine synthase	1.02e-05	1.93e-04	NA	NA
5. P	Q9HHN8	7-cyano-7-deazaguanine synthase	8.96e-06	6.27e-05	NA	NA
5. P	B7JFS4	7-cyano-7-deazaguanine synthase	1.61e-06	6.74e-04	NA	NA
5. P	I3X057	Adenosine 5'-phosphosulfate reductase	2.07e-05	6.07e-04	NA	NA
5. P	Q483A0	Sulfate adenylyltransferase subunit 2	4.52e-06	3.29e-03	NA	NA
5. P	Q8PYU8	7-cyano-7-deazaguanine synthase	2.91e-06	4.46e-04	NA	NA
5. P	Q0BAU3	7-cyano-7-deazaguanine synthase	1.96e-05	5.50e-05	NA	NA
5. P	Q885Z7	tRNA-cytidine(32) 2-sulfurtransferase	2.46e-05	3.14e-06	NA	NA
6. F	Q92L73	Argininosuccinate synthase	1.20e-03	NA	NA	0.5966
6. F	Q1C5J6	GMP synthase [glutamine-hydrolyzing]	5.71e-07	NA	NA	0.6059
6. F	Q4ZPK0	Argininosuccinate synthase	6.06e-04	NA	NA	0.6534
6. F	B5R569	GMP synthase [glutamine-hydrolyzing]	4.64e-07	NA	NA	0.5877
6. F	Q7M8K2	GMP synthase [glutamine-hydrolyzing]	3.18e-07	NA	NA	0.603
6. F	A3MZV8	GMP synthase [glutamine-hydrolyzing]	4.76e-07	NA	NA	0.5887
6. F	Q046I2	GMP synthase [glutamine-hydrolyzing]	5.73e-07	NA	NA	0.6769
6. F	A2SG95	GMP synthase [glutamine-hydrolyzing]	7.73e-07	NA	NA	0.5818
6. F	A1VEV0	GMP synthase [glutamine-hydrolyzing]	5.28e-07	NA	NA	0.672
6. F	Q92CU0	GMP synthase [glutamine-hydrolyzing]	5.57e-07	NA	NA	0.5903
6. F	B8CKS4	GMP synthase [glutamine-hydrolyzing]	6.62e-07	NA	NA	0.5866
6. F	Q38ZE1	GMP synthase [glutamine-hydrolyzing]	7.34e-07	NA	NA	0.6733
6. F	Q6AD51	GMP synthase [glutamine-hydrolyzing]	3.97e-07	NA	NA	0.5509
6. F	A7HSW4	Argininosuccinate synthase	1.15e-03	NA	NA	0.6356
6. F	A1U1E2	GMP synthase [glutamine-hydrolyzing]	4.84e-07	NA	NA	0.5988
6. F	C1DQV2	Argininosuccinate synthase	9.51e-04	NA	NA	0.6424
6. F	Q3IHJ1	GMP synthase [glutamine-hydrolyzing]	5.40e-07	NA	NA	0.6129
6. F	A9N8L6	GMP synthase [glutamine-hydrolyzing]	4.55e-07	NA	NA	0.5863
6. F	B3ELI1	GMP synthase [glutamine-hydrolyzing]	1.01e-06	NA	NA	0.604
6. F	A1BD85	GMP synthase [glutamine-hydrolyzing]	8.24e-07	NA	NA	0.6851
6. F	Q8ZN60	GMP synthase [glutamine-hydrolyzing]	4.69e-07	NA	NA	0.5825
6. F	B1JSB0	GMP synthase [glutamine-hydrolyzing]	4.21e-07	NA	NA	0.6066
6. F	B7K8T7	GMP synthase [glutamine-hydrolyzing]	1.32e-06	NA	NA	0.6573
6. F	Q7UFS3	GMP synthase [glutamine-hydrolyzing]	1.75e-06	NA	NA	0.6077
6. F	B9M374	Argininosuccinate synthase	9.40e-04	NA	NA	0.6372
6. F	A7GGQ9	Argininosuccinate synthase	3.42e-03	NA	NA	0.6093
6. F	B2I6W2	GMP synthase [glutamine-hydrolyzing]	3.85e-07	NA	NA	0.5945
6. F	Q2IV75	GMP synthase [glutamine-hydrolyzing]	1.09e-06	NA	NA	0.6215
6. F	B5ED13	Argininosuccinate synthase	9.06e-04	NA	NA	0.6395
6. F	O66601	GMP synthase [glutamine-hydrolyzing]	7.88e-07	NA	NA	0.5904
6. F	Q92SQ3	GMP synthase [glutamine-hydrolyzing]	4.45e-07	NA	NA	0.5713
6. F	Q97FM9	GMP synthase [glutamine-hydrolyzing]	5.80e-07	NA	NA	0.5722
6. F	Q5NN19	GMP synthase [glutamine-hydrolyzing]	4.66e-07	NA	NA	0.6835
6. F	A0KUK2	GMP synthase [glutamine-hydrolyzing]	5.11e-07	NA	NA	0.5992
6. F	P61522	Argininosuccinate synthase	1.90e-03	NA	NA	0.6351
6. F	Q30TH8	GMP synthase [glutamine-hydrolyzing]	6.64e-07	NA	NA	0.6
6. F	Q89ZV6	GMP synthase [glutamine-hydrolyzing] 1	6.09e-07	NA	NA	0.6757
6. F	P60502	GMP synthase [glutamine-hydrolyzing]	2.22e-07	NA	NA	0.5904
6. F	O85192	GMP synthase [glutamine-hydrolyzing]	4.90e-07	NA	NA	0.5669
6. F	A6H0T6	GMP synthase [glutamine-hydrolyzing]	6.50e-07	NA	NA	0.659
6. F	A2C5P2	GMP synthase [glutamine-hydrolyzing]	8.71e-07	NA	NA	0.5811
6. F	Q87S07	GMP synthase [glutamine-hydrolyzing]	6.79e-07	NA	NA	0.6375
6. F	A6TL10	Argininosuccinate synthase	1.10e-03	NA	NA	0.6137
6. F	Q5HRX1	GMP synthase [glutamine-hydrolyzing]	5.20e-07	NA	NA	0.682
6. F	Q987R3	GMP synthase [glutamine-hydrolyzing]	4.59e-07	NA	NA	0.5751
6. F	B1LAK3	GMP synthase [glutamine-hydrolyzing]	5.19e-07	NA	NA	0.6319
6. F	Q96Y23	GMP synthase [glutamine-hydrolyzing] subunit B	4.33e-07	NA	NA	0.6363
6. F	B9JZA3	GMP synthase [glutamine-hydrolyzing]	5.04e-07	NA	NA	0.5983
6. F	C3KUC5	GMP synthase [glutamine-hydrolyzing]	5.85e-07	NA	NA	0.6726
6. F	A9R7Z2	GMP synthase [glutamine-hydrolyzing]	7.29e-07	NA	NA	0.5993
6. F	Q5FF75	GMP synthase [glutamine-hydrolyzing]	7.66e-07	NA	NA	0.586
6. F	A8G223	GMP synthase [glutamine-hydrolyzing]	9.28e-07	NA	NA	0.6069
6. F	A8H254	GMP synthase [glutamine-hydrolyzing]	5.02e-07	NA	NA	0.588
6. F	B7M7L1	GMP synthase [glutamine-hydrolyzing]	5.47e-07	NA	NA	0.5925
6. F	C0R1H5	Argininosuccinate synthase	4.26e-03	NA	NA	0.6043
6. F	Q2RMV0	Argininosuccinate synthase	7.20e-04	NA	NA	0.6454
6. F	B2SBN5	GMP synthase [glutamine-hydrolyzing]	5.51e-07	NA	NA	0.5793
6. F	Q6ASN4	GMP synthase [glutamine-hydrolyzing]	6.45e-07	NA	NA	0.5925
6. F	A1ATU4	Argininosuccinate synthase	9.37e-04	NA	NA	0.6427
6. F	B2T5G8	GMP synthase [glutamine-hydrolyzing]	7.31e-07	NA	NA	0.5876
6. F	A4Y8T3	GMP synthase [glutamine-hydrolyzing]	6.23e-07	NA	NA	0.6097
6. F	Q4K6W4	GMP synthase [glutamine-hydrolyzing]	5.45e-07	NA	NA	0.6049
6. F	Q6D288	GMP synthase [glutamine-hydrolyzing]	3.85e-07	NA	NA	0.5841
6. F	Q8RDR4	GMP synthase [glutamine-hydrolyzing]	5.95e-07	NA	NA	0.5802
6. F	A8AA65	Argininosuccinate synthase	5.38e-05	NA	NA	0.6255
6. F	B1JUC0	GMP synthase [glutamine-hydrolyzing]	7.68e-07	NA	NA	0.5958
6. F	A7FYP0	GMP synthase [glutamine-hydrolyzing]	7.24e-07	NA	NA	0.6984
6. F	C3MCS5	GMP synthase [glutamine-hydrolyzing]	4.46e-07	NA	NA	0.5575
6. F	Q3JR65	GMP synthase [glutamine-hydrolyzing]	1.06e-06	NA	NA	0.6033
6. F	Q7VEH5	GMP synthase [glutamine-hydrolyzing]	9.03e-07	NA	NA	0.6513
6. F	B2FNS1	GMP synthase [glutamine-hydrolyzing]	5.43e-07	NA	NA	0.5929
6. F	A1SYT6	GMP synthase [glutamine-hydrolyzing]	5.49e-07	NA	NA	0.6036
6. F	A1KRY5	GMP synthase [glutamine-hydrolyzing]	5.84e-07	NA	NA	0.574
6. F	Q2GC97	tRNA(Ile)-lysidine synthase	7.01e-06	NA	NA	0.52
6. F	Q4HXF0	GMP synthase [glutamine-hydrolyzing]	8.59e-07	NA	NA	0.6225
6. F	B0U3R8	GMP synthase [glutamine-hydrolyzing]	5.78e-07	NA	NA	0.5903
6. F	Q1CK82	GMP synthase [glutamine-hydrolyzing]	4.25e-07	NA	NA	0.6078
6. F	Q5FMD6	GMP synthase [glutamine-hydrolyzing]	5.08e-07	NA	NA	0.6497
6. F	C6E6Y6	Argininosuccinate synthase	1.06e-03	NA	NA	0.6225
6. F	A0Q2S8	GMP synthase [glutamine-hydrolyzing]	6.44e-07	NA	NA	0.6614
6. F	A9N218	GMP synthase [glutamine-hydrolyzing]	6.41e-07	NA	NA	0.5816
6. F	Q28WC8	Argininosuccinate synthase	1.17e-03	NA	NA	0.6277
6. F	Q8FRZ3	GMP synthase [glutamine-hydrolyzing]	6.66e-07	NA	NA	0.5697
6. F	Q14HJ0	GMP synthase [glutamine-hydrolyzing]	5.75e-07	NA	NA	0.5754
6. F	Q8RC63	GMP synthase [glutamine-hydrolyzing]	2.16e-07	NA	NA	0.6511
6. F	Q49UU9	GMP synthase [glutamine-hydrolyzing]	5.16e-07	NA	NA	0.7042
6. F	Q0ADW4	GMP synthase [glutamine-hydrolyzing]	7.82e-07	NA	NA	0.6239
6. F	Q3SQP4	GMP synthase [glutamine-hydrolyzing]	9.80e-07	NA	NA	0.6237
6. F	C3K1K0	GMP synthase [glutamine-hydrolyzing]	4.70e-07	NA	NA	0.5966
6. F	B7MHY8	GMP synthase [glutamine-hydrolyzing]	4.91e-07	NA	NA	0.5928
6. F	B2SGK4	GMP synthase [glutamine-hydrolyzing]	4.49e-07	NA	NA	0.5832
6. F	Q98E81	Argininosuccinate synthase	2.78e-03	NA	NA	0.648
6. F	B9M9G4	GMP synthase [glutamine-hydrolyzing]	5.85e-07	NA	NA	0.5984
6. F	Q87XM3	Argininosuccinate synthase	6.14e-04	NA	NA	0.6529
6. F	A1KP87	GMP synthase [glutamine-hydrolyzing]	7.40e-07	NA	NA	0.6519
6. F	O52831	GMP synthase [glutamine-hydrolyzing]	7.85e-07	NA	NA	0.6025
6. F	A3DCD4	GMP synthase [glutamine-hydrolyzing]	7.25e-07	NA	NA	0.5715
6. F	Q11D10	Argininosuccinate synthase	7.07e-04	NA	NA	0.6217
6. F	Q83GZ6	GMP synthase [glutamine-hydrolyzing]	3.86e-06	NA	NA	0.5869
6. F	Q1H0L1	Argininosuccinate synthase	9.92e-04	NA	NA	0.6271
6. F	Q3A590	GMP synthase [glutamine-hydrolyzing]	6.21e-07	NA	NA	0.583
6. F	Q8CXK8	GMP synthase [glutamine-hydrolyzing]	4.35e-07	NA	NA	0.5909
6. F	C0MFC7	GMP synthase [glutamine-hydrolyzing]	4.88e-07	NA	NA	0.6817
6. F	Q1Q9L2	Argininosuccinate synthase	6.84e-04	NA	NA	0.6419
6. F	A1AE43	GMP synthase [glutamine-hydrolyzing]	6.04e-07	NA	NA	0.5929
6. F	Q57LJ8	GMP synthase [glutamine-hydrolyzing]	5.80e-07	NA	NA	0.5941
6. F	B7N691	GMP synthase [glutamine-hydrolyzing]	6.01e-07	NA	NA	0.5943
6. F	Q5N2F8	GMP synthase [glutamine-hydrolyzing]	1.18e-06	NA	NA	0.569
6. F	B1KXY1	Argininosuccinate synthase	3.23e-03	NA	NA	0.6019
6. F	A4G4U7	GMP synthase [glutamine-hydrolyzing]	6.66e-07	NA	NA	0.6024
6. F	Q9JW60	GMP synthase [glutamine-hydrolyzing]	6.52e-07	NA	NA	0.5715
6. F	Q9HXM6	GMP synthase [glutamine-hydrolyzing]	5.93e-07	NA	NA	0.5984
6. F	Q8A525	Putative GMP synthase [glutamine-hydrolyzing] 2	1.27e-07	NA	NA	0.6882
6. F	Q4FNX4	Argininosuccinate synthase	6.26e-04	NA	NA	0.625
6. F	Q02Y87	GMP synthase [glutamine-hydrolyzing]	5.94e-07	NA	NA	0.7058
6. F	C1CF29	GMP synthase [glutamine-hydrolyzing]	4.89e-07	NA	NA	0.6043
6. F	C6DBG3	GMP synthase [glutamine-hydrolyzing]	5.98e-07	NA	NA	0.5925
6. F	B5ZYE9	GMP synthase [glutamine-hydrolyzing]	4.49e-07	NA	NA	0.577
6. F	B3R290	GMP synthase [glutamine-hydrolyzing]	9.80e-07	NA	NA	0.6292
6. F	Q63GV4	GMP synthase [glutamine-hydrolyzing]	6.85e-07	NA	NA	0.5943
6. F	Q0UHC4	GMP synthase [glutamine-hydrolyzing]	6.31e-06	NA	NA	0.5855
6. F	A7I131	GMP synthase [glutamine-hydrolyzing]	3.28e-07	NA	NA	0.6008
6. F	A0Q6C0	GMP synthase [glutamine-hydrolyzing]	4.47e-07	NA	NA	0.5924
6. F	Q886X5	GMP synthase [glutamine-hydrolyzing]	6.13e-07	NA	NA	0.588
6. F	A3DBU1	Argininosuccinate synthase	1.26e-03	NA	NA	0.6358
6. F	Q1CSM2	GMP synthase [glutamine-hydrolyzing]	6.21e-07	NA	NA	0.6635
6. F	P99105	GMP synthase [glutamine-hydrolyzing]	5.66e-07	NA	NA	0.6478
6. F	P64297	GMP synthase [glutamine-hydrolyzing]	5.41e-07	NA	NA	0.6015
6. F	Q5QWW5	GMP synthase [glutamine-hydrolyzing]	3.96e-07	NA	NA	0.5939
6. F	B3PYH7	GMP synthase [glutamine-hydrolyzing]	3.78e-07	NA	NA	0.5882
6. F	A4SYS2	GMP synthase [glutamine-hydrolyzing]	1.02e-06	NA	NA	0.6597
6. F	Q32D55	GMP synthase [glutamine-hydrolyzing]	5.07e-07	NA	NA	0.5896
6. F	Q31F66	GMP synthase [glutamine-hydrolyzing]	6.19e-07	NA	NA	0.611
6. F	Q1MAN9	Argininosuccinate synthase 2	5.88e-04	NA	NA	0.6237
6. F	Q2YA75	Argininosuccinate synthase	6.52e-04	NA	NA	0.6373
6. F	Q6FUF3	GMP synthase [glutamine-hydrolyzing]	8.19e-07	NA	NA	0.6904
6. F	B2UUF1	GMP synthase [glutamine-hydrolyzing]	3.95e-07	NA	NA	0.5998
6. F	Q39F73	GMP synthase [glutamine-hydrolyzing]	8.56e-07	NA	NA	0.5966
6. F	Q8NSR1	GMP synthase [glutamine-hydrolyzing]	7.61e-07	NA	NA	0.5959
6. F	Q5PI52	GMP synthase [glutamine-hydrolyzing]	4.68e-07	NA	NA	0.5948
6. F	A6WQP0	GMP synthase [glutamine-hydrolyzing]	4.83e-07	NA	NA	0.5814
6. F	A1RHR0	GMP synthase [glutamine-hydrolyzing]	5.32e-07	NA	NA	0.5852
6. F	Q04JQ8	GMP synthase [glutamine-hydrolyzing]	5.64e-07	NA	NA	0.6159
6. F	C1CLE8	GMP synthase [glutamine-hydrolyzing]	5.50e-07	NA	NA	0.6199
6. F	Q1QKC3	GMP synthase [glutamine-hydrolyzing]	1.28e-06	NA	NA	0.5714
6. F	B1YIZ1	GMP synthase [glutamine-hydrolyzing]	5.99e-07	NA	NA	0.5771
6. F	Q9CNX8	GMP synthase [glutamine-hydrolyzing]	5.89e-07	NA	NA	0.5794
6. F	P0DB55	GMP synthase [glutamine-hydrolyzing]	4.98e-07	NA	NA	0.7056
6. F	Q1MEZ8	Argininosuccinate synthase 1	9.59e-04	NA	NA	0.5965
6. F	Q9A7U9	GMP synthase [glutamine-hydrolyzing]	9.21e-07	NA	NA	0.6106
6. F	Q165N4	GMP synthase [glutamine-hydrolyzing]	7.97e-07	NA	NA	0.5853
6. F	Q2YK38	GMP synthase [glutamine-hydrolyzing]	5.69e-07	NA	NA	0.6762
6. F	Q6G5J3	GMP synthase [glutamine-hydrolyzing]	5.01e-07	NA	NA	0.5722
6. F	C4Z3X1	GMP synthase [glutamine-hydrolyzing]	2.04e-06	NA	NA	0.6039
6. F	B8DNB9	GMP synthase [glutamine-hydrolyzing]	6.59e-07	NA	NA	0.6888
6. F	B0TI09	GMP synthase [glutamine-hydrolyzing]	7.96e-07	NA	NA	0.5935
6. F	C4ZX82	GMP synthase [glutamine-hydrolyzing]	6.35e-07	NA	NA	0.5799
6. F	A1K5U3	GMP synthase [glutamine-hydrolyzing]	5.65e-07	NA	NA	0.5718
6. F	Q6HPC6	GMP synthase [glutamine-hydrolyzing]	4.64e-07	NA	NA	0.5818
6. F	A4YI75	Argininosuccinate synthase	8.33e-04	NA	NA	0.6261
6. F	Q4P763	GMP synthase [glutamine-hydrolyzing]	1.31e-06	NA	NA	0.5359
6. F	Q89N53	GMP synthase [glutamine-hydrolyzing]	1.24e-06	NA	NA	0.5714
6. F	Q3YZ45	GMP synthase [glutamine-hydrolyzing]	4.84e-07	NA	NA	0.5875
6. F	Q6A6X1	GMP synthase [glutamine-hydrolyzing]	6.08e-07	NA	NA	0.6859
6. F	Q2RGP2	GMP synthase [glutamine-hydrolyzing]	6.49e-07	NA	NA	0.599
6. F	Q1WRY8	GMP synthase [glutamine-hydrolyzing]	6.03e-07	NA	NA	0.5921
6. F	Q0I2D2	GMP synthase [glutamine-hydrolyzing]	3.43e-07	NA	NA	0.6126
6. F	Q2A3D4	GMP synthase [glutamine-hydrolyzing]	6.52e-07	NA	NA	0.5538
6. F	B1XLR5	GMP synthase [glutamine-hydrolyzing]	1.20e-06	NA	NA	0.5708
6. F	B9J7L1	GMP synthase [glutamine-hydrolyzing]	5.40e-07	NA	NA	0.5848
6. F	A1AVI7	Argininosuccinate synthase	6.96e-04	NA	NA	0.6217
6. F	Q2GHY2	GMP synthase [glutamine-hydrolyzing]	1.03e-06	NA	NA	0.5749
6. F	C3PBL1	GMP synthase [glutamine-hydrolyzing]	6.43e-07	NA	NA	0.5904
6. F	B4RV80	GMP synthase [glutamine-hydrolyzing]	4.85e-07	NA	NA	0.585
6. F	B1XTW6	GMP synthase [glutamine-hydrolyzing]	9.92e-07	NA	NA	0.6577
6. F	B8DN64	Argininosuccinate synthase	1.60e-03	NA	NA	0.6486
6. F	B8I4P0	GMP synthase [glutamine-hydrolyzing]	6.53e-07	NA	NA	0.5948
6. F	Q3B1J3	GMP synthase [glutamine-hydrolyzing]	8.72e-07	NA	NA	0.596
6. F	A5ILP6	GMP synthase [glutamine-hydrolyzing]	4.12e-07	NA	NA	0.5601
6. F	Q5X4I9	GMP synthase [glutamine-hydrolyzing]	4.99e-07	NA	NA	0.6118
6. F	A9MHM5	GMP synthase [glutamine-hydrolyzing]	5.31e-07	NA	NA	0.5616
6. F	A7ZPV1	GMP synthase [glutamine-hydrolyzing]	5.00e-07	NA	NA	0.5955
6. F	B7H4Q8	GMP synthase [glutamine-hydrolyzing]	4.68e-07	NA	NA	0.5934
6. F	C0RKS9	GMP synthase [glutamine-hydrolyzing]	2.88e-07	NA	NA	0.627
6. F	E4QHI6	GMP synthase [glutamine-hydrolyzing]	4.22e-07	NA	NA	0.6197
6. F	Q2K3B7	Argininosuccinate synthase	2.53e-03	NA	NA	0.6511
6. F	C1CQS0	GMP synthase [glutamine-hydrolyzing]	4.94e-07	NA	NA	0.6066
6. F	C5BER5	GMP synthase [glutamine-hydrolyzing]	7.83e-07	NA	NA	0.5778
6. F	Q2KDG7	GMP synthase [glutamine-hydrolyzing]	4.30e-07	NA	NA	0.5715
6. F	A5GDA4	Argininosuccinate synthase	9.50e-04	NA	NA	0.6469
6. F	A0Q1Z2	Argininosuccinate synthase	1.11e-03	NA	NA	0.6303
6. F	Q9HY84	Argininosuccinate synthase	5.82e-04	NA	NA	0.6474
6. F	A1URR0	GMP synthase [glutamine-hydrolyzing]	6.51e-07	NA	NA	0.7041
6. F	Q8YT80	GMP synthase [glutamine-hydrolyzing]	1.17e-06	NA	NA	0.643
6. F	Q48TF6	GMP synthase [glutamine-hydrolyzing]	5.06e-07	NA	NA	0.7133
6. F	A6L686	GMP synthase [glutamine-hydrolyzing]	9.10e-07	NA	NA	0.6646
6. F	A6VVI2	Argininosuccinate synthase	9.98e-04	NA	NA	0.6312
6. F	Q5M029	GMP synthase [glutamine-hydrolyzing]	5.59e-07	NA	NA	0.7128
6. F	Q8UIL2	GMP synthase [glutamine-hydrolyzing]	8.78e-07	NA	NA	0.6066
6. F	Q0A9W8	GMP synthase [glutamine-hydrolyzing]	5.65e-07	NA	NA	0.6308
6. F	A9MEB0	GMP synthase [glutamine-hydrolyzing]	5.55e-07	NA	NA	0.6136
6. F	Q7NHC2	GMP synthase [glutamine-hydrolyzing]	1.32e-06	NA	NA	0.5712
6. F	B2TXT2	GMP synthase [glutamine-hydrolyzing]	5.74e-07	NA	NA	0.5953
6. F	Q8G376	Argininosuccinate synthase	3.65e-03	NA	NA	0.6113
6. F	Q9UX31	Argininosuccinate synthase	8.94e-04	NA	NA	0.6216
6. F	A1UUF5	Argininosuccinate synthase	6.26e-04	NA	NA	0.6398
6. F	A1VRB1	tRNA(Ile)-lysidine synthase	1.52e-05	NA	NA	0.5368
6. F	Q21W48	GMP synthase [glutamine-hydrolyzing]	8.36e-07	NA	NA	0.6127
6. F	Q3J210	GMP synthase [glutamine-hydrolyzing]	7.83e-07	NA	NA	0.6807
6. F	Q6FFN2	GMP synthase [glutamine-hydrolyzing]	1.22e-06	NA	NA	0.5994
6. F	Q9KTW2	GMP synthase [glutamine-hydrolyzing]	4.24e-07	NA	NA	0.6041
6. F	B9DLM7	GMP synthase [glutamine-hydrolyzing]	4.99e-07	NA	NA	0.582
6. F	Q756B7	GMP synthase [glutamine-hydrolyzing]	9.00e-07	NA	NA	0.6973
6. F	Q0IE37	GMP synthase [glutamine-hydrolyzing]	1.12e-06	NA	NA	0.5921
6. F	A2BNG3	GMP synthase [glutamine-hydrolyzing]	1.05e-06	NA	NA	0.6704
6. F	B5XNM4	GMP synthase [glutamine-hydrolyzing]	4.78e-07	NA	NA	0.5957
6. F	B1IWF4	GMP synthase [glutamine-hydrolyzing]	4.93e-07	NA	NA	0.5866
6. F	A4YSU1	GMP synthase [glutamine-hydrolyzing]	1.07e-06	NA	NA	0.6016
6. F	B1YS44	GMP synthase [glutamine-hydrolyzing]	8.86e-07	NA	NA	0.6172
6. F	Q5Z1E9	GMP synthase [glutamine-hydrolyzing]	7.12e-07	NA	NA	0.6549
6. F	B5YAL9	Argininosuccinate synthase	1.10e-03	NA	NA	0.5819
6. F	Q8UC31	Argininosuccinate synthase	2.68e-03	NA	NA	0.6469
6. F	C1AHL0	GMP synthase [glutamine-hydrolyzing]	8.60e-07	NA	NA	0.6738
6. F	A9KWW6	GMP synthase [glutamine-hydrolyzing]	4.97e-07	NA	NA	0.6148
6. F	C1FLV2	GMP synthase [glutamine-hydrolyzing]	6.89e-07	NA	NA	0.6935
6. F	B2KCS8	GMP synthase [glutamine-hydrolyzing]	3.38e-07	NA	NA	0.6842
6. F	A9M138	GMP synthase [glutamine-hydrolyzing]	6.71e-07	NA	NA	0.5648
6. F	Q8XZG4	GMP synthase [glutamine-hydrolyzing]	1.07e-06	NA	NA	0.6055
6. F	A7Z235	GMP synthase [glutamine-hydrolyzing]	5.34e-07	NA	NA	0.7115
6. F	Q4J8F1	Argininosuccinate synthase	9.15e-04	NA	NA	0.6542
6. F	A9KGD5	GMP synthase [glutamine-hydrolyzing]	4.06e-07	NA	NA	0.6007
6. F	A7MU26	GMP synthase [glutamine-hydrolyzing]	5.93e-07	NA	NA	0.5968
6. F	B2J9G3	GMP synthase [glutamine-hydrolyzing]	1.28e-06	NA	NA	0.5903
6. F	Q5ZUS0	GMP synthase [glutamine-hydrolyzing]	6.58e-07	NA	NA	0.5962
6. F	Q668A8	GMP synthase [glutamine-hydrolyzing]	4.04e-07	NA	NA	0.6022
6. F	Q2UFN0	GMP synthase [glutamine-hydrolyzing]	9.64e-07	NA	NA	0.586
6. F	Q8E5M8	GMP synthase [glutamine-hydrolyzing]	5.12e-07	NA	NA	0.7068
6. F	C0PYP4	GMP synthase [glutamine-hydrolyzing]	4.93e-07	NA	NA	0.5826
6. F	C4ZCQ4	GMP synthase [glutamine-hydrolyzing]	1.62e-06	NA	NA	0.5833
6. F	Q17YH9	GMP synthase [glutamine-hydrolyzing]	2.89e-07	NA	NA	0.596
6. F	A7GKG1	GMP synthase [glutamine-hydrolyzing]	4.75e-07	NA	NA	0.5776
6. F	Q8FWT4	GMP synthase [glutamine-hydrolyzing]	6.24e-07	NA	NA	0.6815
6. F	Q7VLE9	GMP synthase [glutamine-hydrolyzing]	5.83e-07	NA	NA	0.5921
6. F	B2UZ05	GMP synthase [glutamine-hydrolyzing]	1.78e-06	NA	NA	0.6127
6. F	B5RCX9	GMP synthase [glutamine-hydrolyzing]	4.68e-07	NA	NA	0.5955
6. F	Q81VE0	GMP synthase [glutamine-hydrolyzing]	4.99e-07	NA	NA	0.5825
6. F	Q8PK88	GMP synthase [glutamine-hydrolyzing]	6.46e-07	NA	NA	0.6724
6. F	P49057	GMP synthase [glutamine-hydrolyzing]	1.46e-06	NA	NA	0.6558
6. F	Q6CEF3	GMP synthase [glutamine-hydrolyzing]	1.03e-06	NA	NA	0.6852
6. F	B6I579	GMP synthase [glutamine-hydrolyzing]	5.04e-07	NA	NA	0.5952
6. F	A6W2W4	GMP synthase [glutamine-hydrolyzing]	7.31e-07	NA	NA	0.634
6. F	B1ICM9	GMP synthase [glutamine-hydrolyzing]	5.63e-07	NA	NA	0.6178
6. F	B9KT27	GMP synthase [glutamine-hydrolyzing]	8.06e-07	NA	NA	0.5858
6. F	Q65UI1	GMP synthase [glutamine-hydrolyzing]	5.69e-07	NA	NA	0.6075
6. F	Q1J0T4	GMP synthase [glutamine-hydrolyzing]	6.40e-07	NA	NA	0.6706
6. F	Q73IH1	GMP synthase [glutamine-hydrolyzing]	2.79e-06	NA	NA	0.5835
6. F	A9HIQ4	Argininosuccinate synthase	1.04e-03	NA	NA	0.6348
6. F	A5CXM9	Argininosuccinate synthase	6.84e-04	NA	NA	0.6324
6. F	Q8CMQ8	GMP synthase [glutamine-hydrolyzing]	5.22e-07	NA	NA	0.678
6. F	Q7MNE1	GMP synthase [glutamine-hydrolyzing]	5.77e-07	NA	NA	0.6033
6. F	B3W952	GMP synthase [glutamine-hydrolyzing]	4.99e-07	NA	NA	0.5759
6. F	B2S7X3	Argininosuccinate synthase	6.98e-04	NA	NA	0.6156
6. F	A8FMV3	GMP synthase [glutamine-hydrolyzing]	6.19e-07	NA	NA	0.5914
6. F	Q0AKJ6	Argininosuccinate synthase	1.14e-03	NA	NA	0.6277
6. F	Q2NS52	GMP synthase [glutamine-hydrolyzing]	4.02e-07	NA	NA	0.6093
6. F	B8D0Z5	GMP synthase [glutamine-hydrolyzing]	5.88e-07	NA	NA	0.6996
6. F	Q1IE03	Argininosuccinate synthase	6.48e-04	NA	NA	0.6507
6. F	Q7NSG1	GMP synthase [glutamine-hydrolyzing]	6.57e-07	NA	NA	0.6352
6. F	Q3ASI2	Argininosuccinate synthase	7.23e-04	NA	NA	0.588
6. F	A3NWJ3	GMP synthase [glutamine-hydrolyzing]	1.07e-06	NA	NA	0.6131
6. F	Q3A9W5	Argininosuccinate synthase	1.01e-03	NA	NA	0.642
6. F	Q65MU0	GMP synthase [glutamine-hydrolyzing]	5.67e-07	NA	NA	0.6992
6. F	Q6LU31	GMP synthase [glutamine-hydrolyzing]	5.18e-07	NA	NA	0.5871
6. F	Q60C21	GMP synthase [glutamine-hydrolyzing]	3.95e-07	NA	NA	0.5783
6. F	A4IXW6	GMP synthase [glutamine-hydrolyzing]	5.85e-07	NA	NA	0.5423
6. F	Q036Y5	GMP synthase [glutamine-hydrolyzing]	5.19e-07	NA	NA	0.5712
6. F	Q93JQ8	Argininosuccinate synthase	3.21e-03	NA	NA	0.637
6. F	A8LAX2	GMP synthase [glutamine-hydrolyzing]	8.54e-07	NA	NA	0.5927
6. F	B3PIG3	GMP synthase [glutamine-hydrolyzing]	6.14e-07	NA	NA	0.5509
6. F	A9M6S7	Argininosuccinate synthase	2.71e-03	NA	NA	0.627
6. F	B0KRE6	GMP synthase [glutamine-hydrolyzing]	5.74e-07	NA	NA	0.5605
6. F	P64296	GMP synthase [glutamine-hydrolyzing]	5.53e-07	NA	NA	0.7037
6. F	A6TCC2	GMP synthase [glutamine-hydrolyzing]	4.64e-07	NA	NA	0.6092
6. F	Q5HCA2	GMP synthase [glutamine-hydrolyzing]	9.43e-07	NA	NA	0.6015
6. F	B0U0B2	GMP synthase [glutamine-hydrolyzing]	6.04e-07	NA	NA	0.5725
6. F	Q8KFZ5	GMP synthase [glutamine-hydrolyzing]	1.26e-06	NA	NA	0.6856
6. F	A6VMR9	GMP synthase [glutamine-hydrolyzing]	4.71e-07	NA	NA	0.6088
6. F	Q11WK3	GMP synthase [glutamine-hydrolyzing]	5.44e-07	NA	NA	0.674
6. F	A1VEQ0	Argininosuccinate synthase	1.91e-03	NA	NA	0.6388
6. F	Q0VNF0	GMP synthase [glutamine-hydrolyzing]	4.78e-07	NA	NA	0.6153
6. F	B6JHM4	GMP synthase [glutamine-hydrolyzing]	9.38e-07	NA	NA	0.6702
6. F	A1V534	GMP synthase [glutamine-hydrolyzing]	7.97e-07	NA	NA	0.5972
6. F	A2RED2	GMP synthase [glutamine-hydrolyzing]	5.11e-07	NA	NA	0.7005
6. F	B5Z842	GMP synthase [glutamine-hydrolyzing]	4.47e-07	NA	NA	0.5948
6. F	B2IQR1	GMP synthase [glutamine-hydrolyzing]	4.81e-07	NA	NA	0.5864
6. F	A6UFA3	GMP synthase [glutamine-hydrolyzing]	7.47e-07	NA	NA	0.5726
6. F	P60499	GMP synthase [glutamine-hydrolyzing]	7.24e-07	NA	NA	0.5946
6. F	C1C842	GMP synthase [glutamine-hydrolyzing]	5.56e-07	NA	NA	0.6067
6. F	A4WD82	GMP synthase [glutamine-hydrolyzing]	4.51e-07	NA	NA	0.5898
6. F	B2TIX3	GMP synthase [glutamine-hydrolyzing]	1.81e-06	NA	NA	0.6113
6. F	C3LT21	GMP synthase [glutamine-hydrolyzing]	5.75e-07	NA	NA	0.604
6. F	B3QYF4	GMP synthase [glutamine-hydrolyzing]	1.73e-06	NA	NA	0.5876
6. F	Q82XZ6	GMP synthase [glutamine-hydrolyzing]	6.56e-07	NA	NA	0.6049
6. F	B1J4I4	Argininosuccinate synthase	1.02e-03	NA	NA	0.6287
6. F	Q1IIZ2	Argininosuccinate synthase	1.38e-04	NA	NA	0.5986
6. F	A7GIN0	GMP synthase [glutamine-hydrolyzing]	6.44e-07	NA	NA	0.6875
6. F	Q8ZU97	Argininosuccinate synthase	5.08e-04	NA	NA	0.6407
6. F	Q1LND0	GMP synthase [glutamine-hydrolyzing]	1.19e-06	NA	NA	0.5947
6. F	B9DUB2	GMP synthase [glutamine-hydrolyzing]	7.42e-07	NA	NA	0.6971
6. F	Q83ID3	GMP synthase [glutamine-hydrolyzing]	3.58e-06	NA	NA	0.5715
6. F	B2HDP0	GMP synthase [glutamine-hydrolyzing]	6.69e-07	NA	NA	0.6087
6. F	B7IUT1	GMP synthase [glutamine-hydrolyzing]	4.16e-07	NA	NA	0.5933
6. F	Q7UA53	GMP synthase [glutamine-hydrolyzing]	8.74e-07	NA	NA	0.5727
6. F	Q3AT13	GMP synthase [glutamine-hydrolyzing]	1.04e-06	NA	NA	0.6815
6. F	B0BUF0	GMP synthase [glutamine-hydrolyzing]	3.43e-07	NA	NA	0.5974
6. F	Q12PS0	GMP synthase [glutamine-hydrolyzing]	5.67e-07	NA	NA	0.5952
6. F	Q48LY0	GMP synthase [glutamine-hydrolyzing]	5.00e-07	NA	NA	0.6003
6. F	A6UE09	Argininosuccinate synthase	3.94e-03	NA	NA	0.6361
6. F	B5F185	GMP synthase [glutamine-hydrolyzing]	4.79e-07	NA	NA	0.5944
6. F	Q5B1L4	GMP synthase [glutamine-hydrolyzing]	8.43e-07	NA	NA	0.6649
6. F	Q8DF07	GMP synthase [glutamine-hydrolyzing]	4.81e-07	NA	NA	0.5858
6. F	Q9L0H2	GMP synthase [glutamine-hydrolyzing]	6.38e-07	NA	NA	0.6128
6. F	B7UVV5	Argininosuccinate synthase	6.89e-04	NA	NA	0.6315
6. F	P61523	Argininosuccinate synthase	8.86e-04	NA	NA	0.6276
6. F	A5UG27	GMP synthase [glutamine-hydrolyzing]	5.87e-07	NA	NA	0.6235
6. F	Q8YEK8	Argininosuccinate synthase	2.64e-03	NA	NA	0.6261
6. F	A9IL50	Argininosuccinate synthase	2.77e-03	NA	NA	0.6468
6. F	Q0BVJ1	Argininosuccinate synthase	1.18e-03	NA	NA	0.6283
6. F	B2G994	GMP synthase [glutamine-hydrolyzing]	6.49e-07	NA	NA	0.5642
6. F	A0KJS0	GMP synthase [glutamine-hydrolyzing]	5.38e-07	NA	NA	0.6118
6. F	Q6F1C4	GMP synthase [glutamine-hydrolyzing]	6.56e-07	NA	NA	0.6069
6. F	B4TD82	GMP synthase [glutamine-hydrolyzing]	4.88e-07	NA	NA	0.5952
6. F	B7MYD5	GMP synthase [glutamine-hydrolyzing]	6.45e-07	NA	NA	0.593
6. F	Q88P21	GMP synthase [glutamine-hydrolyzing]	4.52e-07	NA	NA	0.5792
6. F	A5U871	GMP synthase [glutamine-hydrolyzing]	1.09e-06	NA	NA	0.6058
6. F	Q87BK6	GMP synthase [glutamine-hydrolyzing]	4.24e-07	NA	NA	0.5722
6. F	A1S856	GMP synthase [glutamine-hydrolyzing]	6.83e-07	NA	NA	0.6012
6. F	Q6GJQ6	GMP synthase [glutamine-hydrolyzing]	6.02e-07	NA	NA	0.694
6. F	Q720X7	GMP synthase [glutamine-hydrolyzing]	5.14e-07	NA	NA	0.5735
6. F	A9IKK0	GMP synthase [glutamine-hydrolyzing]	8.44e-07	NA	NA	0.6
6. F	A5I5A4	Argininosuccinate synthase	3.73e-03	NA	NA	0.5986
6. F	A1JKT2	GMP synthase [glutamine-hydrolyzing]	4.32e-07	NA	NA	0.5931
6. F	P64295	GMP synthase [glutamine-hydrolyzing]	4.89e-07	NA	NA	0.5933
6. F	Q2RXI5	GMP synthase [glutamine-hydrolyzing]	3.95e-07	NA	NA	0.6064
6. F	Q5WJI0	GMP synthase [glutamine-hydrolyzing]	5.08e-07	NA	NA	0.5812
6. F	Q83BZ6	GMP synthase [glutamine-hydrolyzing]	4.06e-07	NA	NA	0.5868
6. F	Q3B0W1	GMP synthase [glutamine-hydrolyzing]	1.11e-06	NA	NA	0.5887
6. F	B3H120	GMP synthase [glutamine-hydrolyzing]	4.65e-07	NA	NA	0.5955
6. F	Q1JLL1	GMP synthase [glutamine-hydrolyzing]	4.79e-07	NA	NA	0.7178
6. F	Q67S57	GMP synthase [glutamine-hydrolyzing]	6.43e-07	NA	NA	0.6833
6. F	B8E0N9	Argininosuccinate synthase	1.01e-03	NA	NA	0.6
6. F	B1XAY2	GMP synthase [glutamine-hydrolyzing]	5.16e-07	NA	NA	0.6039
6. F	C1A3W7	GMP synthase [glutamine-hydrolyzing]	5.50e-07	NA	NA	0.719
6. F	Q3Z727	Argininosuccinate synthase	6.01e-04	NA	NA	0.6165
6. F	Q7V3N7	GMP synthase [glutamine-hydrolyzing]	1.07e-06	NA	NA	0.6374
6. F	A7MGU1	GMP synthase [glutamine-hydrolyzing]	5.19e-07	NA	NA	0.5981
6. F	Q0TEY1	GMP synthase [glutamine-hydrolyzing]	4.75e-07	NA	NA	0.5876
6. F	A5FWI5	Argininosuccinate synthase	1.25e-03	NA	NA	0.6269
6. F	B7JM61	GMP synthase [glutamine-hydrolyzing]	5.07e-07	NA	NA	0.5796
6. F	A5I720	GMP synthase [glutamine-hydrolyzing]	6.33e-07	NA	NA	0.5931
6. F	Q15R63	GMP synthase [glutamine-hydrolyzing]	4.97e-07	NA	NA	0.5795
6. F	C5CBZ4	GMP synthase [glutamine-hydrolyzing]	1.44e-06	NA	NA	0.5702
6. F	B4SSX7	GMP synthase [glutamine-hydrolyzing]	6.68e-07	NA	NA	0.5984
6. F	Q2FJM5	GMP synthase [glutamine-hydrolyzing]	7.59e-07	NA	NA	0.598
6. F	B4EC68	GMP synthase [glutamine-hydrolyzing]	1.02e-06	NA	NA	0.6027
6. F	Q73U79	GMP synthase [glutamine-hydrolyzing]	8.81e-07	NA	NA	0.6674
6. F	P59604	Argininosuccinate synthase	6.46e-04	NA	NA	0.6378
6. F	Q04P84	Argininosuccinate synthase	3.08e-03	NA	NA	0.6103
6. F	Q9X2E0	GMP synthase [glutamine-hydrolyzing]	4.50e-07	NA	NA	0.5572
6. F	Q3Z886	GMP synthase [glutamine-hydrolyzing]	7.63e-07	NA	NA	0.6286
6. F	Q63T42	GMP synthase [glutamine-hydrolyzing]	1.21e-06	NA	NA	0.6268
6. F	Q8DU81	GMP synthase [glutamine-hydrolyzing]	6.07e-07	NA	NA	0.7095
6. F	P64299	GMP synthase [glutamine-hydrolyzing]	5.64e-07	NA	NA	0.7145
6. F	Q47LQ0	GMP synthase [glutamine-hydrolyzing]	5.37e-07	NA	NA	0.6029
6. F	A0M3J8	GMP synthase [glutamine-hydrolyzing]	6.90e-07	NA	NA	0.6767
6. F	B1ZNB4	GMP synthase [glutamine-hydrolyzing]	6.50e-07	NA	NA	0.6596
6. F	B9KH18	GMP synthase [glutamine-hydrolyzing]	4.59e-07	NA	NA	0.5941
6. F	Q1JGP6	GMP synthase [glutamine-hydrolyzing]	4.58e-07	NA	NA	0.707
6. F	B4T0N7	GMP synthase [glutamine-hydrolyzing]	4.73e-07	NA	NA	0.5881
6. F	A8FAH5	GMP synthase [glutamine-hydrolyzing]	6.03e-07	NA	NA	0.6859
6. F	Q5FPL0	GMP synthase [glutamine-hydrolyzing]	7.81e-07	NA	NA	0.585
6. F	C1FU68	Argininosuccinate synthase	3.95e-03	NA	NA	0.6595
6. F	B5E5U0	GMP synthase [glutamine-hydrolyzing]	5.18e-07	NA	NA	0.6182
6. F	C4L8C4	GMP synthase [glutamine-hydrolyzing]	7.94e-07	NA	NA	0.6025
6. F	B5BAZ5	GMP synthase [glutamine-hydrolyzing]	5.82e-07	NA	NA	0.5824
6. F	B0TLJ4	GMP synthase [glutamine-hydrolyzing]	6.11e-07	NA	NA	0.5765
6. F	B4SFX7	GMP synthase [glutamine-hydrolyzing]	1.19e-06	NA	NA	0.6483
6. F	Q8NY69	GMP synthase [glutamine-hydrolyzing]	5.18e-07	NA	NA	0.7034
6. F	Q31H63	Argininosuccinate synthase	6.58e-04	NA	NA	0.6151
6. F	Q4K749	Argininosuccinate synthase	9.68e-04	NA	NA	0.6307
6. F	A0K8B3	GMP synthase [glutamine-hydrolyzing]	8.55e-07	NA	NA	0.6144
6. F	A8AD80	GMP synthase [glutamine-hydrolyzing]	4.52e-07	NA	NA	0.5969
6. F	B5FAY1	GMP synthase [glutamine-hydrolyzing]	2.95e-07	NA	NA	0.6074
6. F	B9E8Y0	GMP synthase [glutamine-hydrolyzing]	3.90e-07	NA	NA	0.5861
6. F	Q0HX50	GMP synthase [glutamine-hydrolyzing]	4.80e-07	NA	NA	0.5948
6. F	C6BSD8	GMP synthase [glutamine-hydrolyzing]	6.22e-07	NA	NA	0.5887
6. F	Q5E763	GMP synthase [glutamine-hydrolyzing]	2.59e-07	NA	NA	0.6104
6. F	A9BER7	GMP synthase [glutamine-hydrolyzing]	5.74e-07	NA	NA	0.5973
6. F	Q212S9	GMP synthase [glutamine-hydrolyzing]	8.18e-07	NA	NA	0.679
6. F	Q8Z4Q3	GMP synthase [glutamine-hydrolyzing]	4.71e-07	NA	NA	0.5942
6. F	B1LNF9	GMP synthase [glutamine-hydrolyzing]	5.11e-07	NA	NA	0.5867
6. F	Q18CT8	GMP synthase [glutamine-hydrolyzing]	6.87e-07	NA	NA	0.6102
6. F	A5N6U2	Argininosuccinate synthase	3.98e-03	NA	NA	0.6109
6. F	A1AQJ8	GMP synthase [glutamine-hydrolyzing]	5.73e-07	NA	NA	0.5889
6. F	B2JIA0	GMP synthase [glutamine-hydrolyzing]	7.27e-07	NA	NA	0.6159
6. F	A5VU71	GMP synthase [glutamine-hydrolyzing]	4.92e-07	NA	NA	0.6659
6. F	C0MAM2	GMP synthase [glutamine-hydrolyzing]	5.28e-07	NA	NA	0.6652
6. F	C3L1U3	Argininosuccinate synthase	3.38e-03	NA	NA	0.6013
6. F	Q04CA4	GMP synthase [glutamine-hydrolyzing]	6.81e-07	NA	NA	0.5926
6. F	B5Z0X6	GMP synthase [glutamine-hydrolyzing]	5.07e-07	NA	NA	0.5943
6. F	Q73ER7	GMP synthase [glutamine-hydrolyzing]	5.23e-07	NA	NA	0.5903
6. F	A8FY04	GMP synthase [glutamine-hydrolyzing]	5.59e-07	NA	NA	0.589
6. F	A6QE71	GMP synthase [glutamine-hydrolyzing]	5.55e-07	NA	NA	0.704
6. F	Q6GC81	GMP synthase [glutamine-hydrolyzing]	5.22e-07	NA	NA	0.6707
6. F	Q609X7	Argininosuccinate synthase	1.05e-03	NA	NA	0.6205
6. F	A4XY17	GMP synthase [glutamine-hydrolyzing]	5.68e-07	NA	NA	0.5745
6. F	Q7WAV6	GMP synthase [glutamine-hydrolyzing]	1.00e-06	NA	NA	0.5784
6. F	C0R5H8	GMP synthase [glutamine-hydrolyzing]	3.81e-06	NA	NA	0.5653
6. F	Q16D10	Argininosuccinate synthase	1.11e-03	NA	NA	0.6217
6. F	Q5WVX4	GMP synthase [glutamine-hydrolyzing]	5.13e-07	NA	NA	0.6044
6. F	A6V1S1	Argininosuccinate synthase	6.44e-04	NA	NA	0.6322
6. F	A4SM23	GMP synthase [glutamine-hydrolyzing]	6.59e-07	NA	NA	0.6035
6. F	Q4FVS5	GMP synthase [glutamine-hydrolyzing]	4.65e-07	NA	NA	0.598
6. F	Q46I26	GMP synthase [glutamine-hydrolyzing]	8.13e-07	NA	NA	0.5953
6. F	Q0VRM5	Argininosuccinate synthase	1.09e-03	NA	NA	0.6284
6. F	Q4ZX09	GMP synthase [glutamine-hydrolyzing]	5.33e-07	NA	NA	0.592
6. F	Q31XY3	GMP synthase [glutamine-hydrolyzing]	4.90e-07	NA	NA	0.5941
6. F	B9MS76	GMP synthase [glutamine-hydrolyzing]	7.21e-07	NA	NA	0.6113
6. F	A9WY54	GMP synthase [glutamine-hydrolyzing]	5.37e-07	NA	NA	0.5964
6. F	Q02QZ6	Argininosuccinate synthase	6.79e-04	NA	NA	0.6381
6. F	P60501	GMP synthase [glutamine-hydrolyzing]	1.09e-06	NA	NA	0.5727
6. F	Q1BHF2	GMP synthase [glutamine-hydrolyzing]	9.60e-07	NA	NA	0.6259
6. F	Q3ANK7	GMP synthase [glutamine-hydrolyzing]	9.12e-07	NA	NA	0.5917
6. F	Q6APU2	GMP synthase [glutamine-hydrolyzing]	6.96e-07	NA	NA	0.6791
6. F	P29727	GMP synthase [glutamine-hydrolyzing]	5.71e-07	NA	NA	0.6135
6. F	Q839J8	GMP synthase [glutamine-hydrolyzing]	4.08e-07	NA	NA	0.5963
6. F	P44335	GMP synthase [glutamine-hydrolyzing]	6.34e-07	NA	NA	0.6342
6. F	A5VZC3	GMP synthase [glutamine-hydrolyzing]	5.66e-07	NA	NA	0.5974
6. F	C4XSN8	GMP synthase [glutamine-hydrolyzing]	5.20e-07	NA	NA	0.6889
6. F	B1JDH6	GMP synthase [glutamine-hydrolyzing]	4.69e-07	NA	NA	0.5785
6. F	Q4QNW4	GMP synthase [glutamine-hydrolyzing]	3.12e-07	NA	NA	0.6156
6. F	B2A5V5	GMP synthase [glutamine-hydrolyzing]	6.98e-07	NA	NA	0.5988
6. F	Q1MQL7	Argininosuccinate synthase	8.61e-04	NA	NA	0.6235
6. F	Q6BLS3	GMP synthase [glutamine-hydrolyzing]	8.38e-07	NA	NA	0.6619
6. F	Q9RWJ4	Argininosuccinate synthase	1.23e-03	NA	NA	0.5883
6. F	P0A5A2	GMP synthase [glutamine-hydrolyzing]	8.11e-07	NA	NA	0.6028
6. F	P9WMS6	GMP synthase [glutamine-hydrolyzing]	9.55e-07	NA	NA	0.6498
6. F	B3ECP2	Argininosuccinate synthase	4.87e-03	NA	NA	0.5981
6. F	Q3YT30	GMP synthase [glutamine-hydrolyzing]	6.99e-07	NA	NA	0.6055
6. F	Q0T212	GMP synthase [glutamine-hydrolyzing]	4.91e-07	NA	NA	0.5946
6. F	Q8DGA5	GMP synthase [glutamine-hydrolyzing]	1.21e-06	NA	NA	0.5827
6. F	A8Z0R1	GMP synthase [glutamine-hydrolyzing]	5.39e-07	NA	NA	0.6934
6. F	A6Q4N8	GMP synthase [glutamine-hydrolyzing]	6.88e-07	NA	NA	0.6955
6. F	P64300	GMP synthase [glutamine-hydrolyzing]	4.36e-07	NA	NA	0.7172
6. F	B1IFD1	GMP synthase [glutamine-hydrolyzing]	7.24e-07	NA	NA	0.6535
6. F	Q5XC20	GMP synthase [glutamine-hydrolyzing]	7.03e-07	NA	NA	0.7112
6. F	Q02RS2	GMP synthase [glutamine-hydrolyzing]	6.51e-07	NA	NA	0.5817
6. F	A3MKQ7	GMP synthase [glutamine-hydrolyzing]	8.82e-07	NA	NA	0.6118
6. F	A4QBV0	GMP synthase [glutamine-hydrolyzing]	6.63e-07	NA	NA	0.5849
6. F	A5WG08	Argininosuccinate synthase	6.57e-04	NA	NA	0.6277
6. F	B7VJU8	GMP synthase [glutamine-hydrolyzing]	3.58e-07	NA	NA	0.6082
6. F	B6IZE2	GMP synthase [glutamine-hydrolyzing]	3.65e-07	NA	NA	0.6005
6. F	Q3B425	Argininosuccinate synthase	7.26e-04	NA	NA	0.5801
6. F	B4EY59	GMP synthase [glutamine-hydrolyzing]	4.22e-07	NA	NA	0.5724
6. F	Q3SI29	GMP synthase [glutamine-hydrolyzing]	5.10e-07	NA	NA	0.61
6. F	Q48F14	Argininosuccinate synthase	6.11e-04	NA	NA	0.6396
6. F	A8LKW5	GMP synthase [glutamine-hydrolyzing]	6.16e-07	NA	NA	0.585
6. F	Q4JTG0	GMP synthase [glutamine-hydrolyzing]	7.79e-07	NA	NA	0.6497
6. F	C1EUB4	GMP synthase [glutamine-hydrolyzing]	4.85e-07	NA	NA	0.6179
6. F	Q8U484	Argininosuccinate synthase	5.23e-05	NA	NA	0.6437
6. F	A5IPX0	GMP synthase [glutamine-hydrolyzing]	5.70e-07	NA	NA	0.6923
6. F	Q5NYE5	GMP synthase [glutamine-hydrolyzing]	5.61e-07	NA	NA	0.5669
6. F	Q7V9A9	GMP synthase [glutamine-hydrolyzing]	1.05e-06	NA	NA	0.5803
6. F	A4TMS8	GMP synthase [glutamine-hydrolyzing]	5.26e-07	NA	NA	0.5947
6. F	Q5NG38	GMP synthase [glutamine-hydrolyzing]	6.03e-07	NA	NA	0.5897
6. F	B4R9R7	GMP synthase [glutamine-hydrolyzing]	7.51e-07	NA	NA	0.6476
6. F	B9KFL4	GMP synthase [glutamine-hydrolyzing]	6.05e-07	NA	NA	0.6957
6. F	Q82HM9	GMP synthase [glutamine-hydrolyzing]	5.92e-07	NA	NA	0.609
6. F	B2K9P0	GMP synthase [glutamine-hydrolyzing]	4.01e-07	NA	NA	0.5871
6. F	Q9ZKG4	GMP synthase [glutamine-hydrolyzing]	4.68e-07	NA	NA	0.5757
6. F	P64294	GMP synthase [glutamine-hydrolyzing]	4.82e-07	NA	NA	0.5868
6. F	Q2LT97	Argininosuccinate synthase	1.07e-03	NA	NA	0.6287
6. F	A5UAR3	GMP synthase [glutamine-hydrolyzing]	3.65e-07	NA	NA	0.5902
6. F	B1WY30	GMP synthase [glutamine-hydrolyzing]	1.32e-06	NA	NA	0.6514
6. F	B1IK08	Argininosuccinate synthase	3.38e-03	NA	NA	0.6252
6. F	O25165	GMP synthase [glutamine-hydrolyzing]	3.13e-07	NA	NA	0.6124
6. F	A8GHV1	GMP synthase [glutamine-hydrolyzing]	5.48e-07	NA	NA	0.6085
6. F	Q8G5P4	GMP synthase [glutamine-hydrolyzing]	7.56e-07	NA	NA	0.6042
6. F	B7LKD4	GMP synthase [glutamine-hydrolyzing]	5.99e-07	NA	NA	0.5947
6. F	Q39Z72	Argininosuccinate synthase	8.82e-04	NA	NA	0.626
6. F	Q1R8M9	GMP synthase [glutamine-hydrolyzing]	5.12e-07	NA	NA	0.5929
6. F	Q6AR59	Argininosuccinate synthase	7.78e-04	NA	NA	0.5909
6. F	A5FHB4	GMP synthase [glutamine-hydrolyzing]	7.64e-07	NA	NA	0.6761
6. F	A4JF45	GMP synthase [glutamine-hydrolyzing]	1.02e-06	NA	NA	0.6096
6. F	Q88Y74	GMP synthase [glutamine-hydrolyzing]	4.89e-07	NA	NA	0.5855
6. F	Q2S0V0	GMP synthase [glutamine-hydrolyzing]	8.88e-07	NA	NA	0.6624
6. F	Q8EC52	GMP synthase [glutamine-hydrolyzing]	5.05e-07	NA	NA	0.5889
6. F	Q4L386	GMP synthase [glutamine-hydrolyzing]	5.26e-07	NA	NA	0.7152
6. F	A4XKX8	GMP synthase [glutamine-hydrolyzing]	3.93e-07	NA	NA	0.6221
6. F	Q085S4	GMP synthase [glutamine-hydrolyzing]	5.53e-07	NA	NA	0.5985
6. F	Q47WD1	GMP synthase [glutamine-hydrolyzing]	3.30e-07	NA	NA	0.6005
6. F	B1L1J7	GMP synthase [glutamine-hydrolyzing]	6.98e-07	NA	NA	0.696
6. F	P0CL64	GMP synthase [glutamine-hydrolyzing]	4.48e-07	NA	NA	0.6067
6. F	Q72D86	GMP synthase [glutamine-hydrolyzing]	4.76e-07	NA	NA	0.6629
6. F	Q1J6G5	GMP synthase [glutamine-hydrolyzing]	5.05e-07	NA	NA	0.7111
6. F	Q5P9L5	GMP synthase [glutamine-hydrolyzing]	4.99e-07	NA	NA	0.6161
6. F	C0Z6S0	Argininosuccinate synthase	8.38e-04	NA	NA	0.5866
6. F	Q4WFT3	GMP synthase [glutamine-hydrolyzing]	1.07e-06	NA	NA	0.6303
6. F	B7LCP7	GMP synthase [glutamine-hydrolyzing]	4.96e-07	NA	NA	0.5932
6. F	B9L0W3	GMP synthase [glutamine-hydrolyzing]	1.13e-06	NA	NA	0.6671
6. F	B6J7Z4	GMP synthase [glutamine-hydrolyzing]	1.77e-07	NA	NA	0.6123
6. F	Q8Y822	GMP synthase [glutamine-hydrolyzing]	5.24e-07	NA	NA	0.5689
6. F	A6LQ90	GMP synthase [glutamine-hydrolyzing]	6.15e-07	NA	NA	0.5873
6. F	B2UBD1	GMP synthase [glutamine-hydrolyzing]	1.09e-06	NA	NA	0.589
6. F	Q5FUA8	Argininosuccinate synthase	1.08e-03	NA	NA	0.6481
6. F	Q0KA43	GMP synthase [glutamine-hydrolyzing]	7.99e-07	NA	NA	0.6023
6. F	A7WY93	GMP synthase [glutamine-hydrolyzing]	5.39e-07	NA	NA	0.6701
6. F	B9DYY7	GMP synthase [glutamine-hydrolyzing]	4.70e-07	NA	NA	0.6896
6. F	Q0HKV2	GMP synthase [glutamine-hydrolyzing]	4.99e-07	NA	NA	0.5939
6. F	Q7WK13	GMP synthase [glutamine-hydrolyzing]	9.94e-07	NA	NA	0.594
6. F	A5VLY3	GMP synthase [glutamine-hydrolyzing]	5.12e-07	NA	NA	0.6714
6. F	Q4FR79	Argininosuccinate synthase	7.19e-04	NA	NA	0.6391
6. F	Q13XE2	GMP synthase [glutamine-hydrolyzing]	7.29e-07	NA	NA	0.6168
6. F	B8FH30	Argininosuccinate synthase	8.27e-04	NA	NA	0.6383
6. F	B1H0L3	Argininosuccinate synthase	4.04e-03	NA	NA	0.5813
6. F	A5VN19	Argininosuccinate synthase	3.33e-03	NA	NA	0.6231
6. F	A3QCH0	GMP synthase [glutamine-hydrolyzing]	5.85e-07	NA	NA	0.6167
6. F	P64298	GMP synthase [glutamine-hydrolyzing]	4.92e-07	NA	NA	0.6229
6. F	A1AXH0	GMP synthase [glutamine-hydrolyzing]	3.21e-07	NA	NA	0.6193
6. F	Q2SCE5	Argininosuccinate synthase	1.10e-03	NA	NA	0.6318
6. F	Q3K1C0	GMP synthase [glutamine-hydrolyzing]	5.33e-07	NA	NA	0.6996
6. F	B1KLC1	GMP synthase [glutamine-hydrolyzing]	5.31e-07	NA	NA	0.588
6. F	A6LD04	GMP synthase [glutamine-hydrolyzing]	7.31e-07	NA	NA	0.6473
6. F	Q5HTL3	GMP synthase [glutamine-hydrolyzing]	7.11e-07	NA	NA	0.6954
6. F	B4RJH7	GMP synthase [glutamine-hydrolyzing]	8.35e-07	NA	NA	0.641
6. F	Q470G4	GMP synthase [glutamine-hydrolyzing]	7.81e-07	NA	NA	0.6154
6. F	A1W0N3	GMP synthase [glutamine-hydrolyzing]	6.07e-07	NA	NA	0.5917
6. F	Q9KF78	Putative GMP synthase [glutamine-hydrolyzing]	6.58e-07	NA	NA	0.6683
6. F	A6TLR3	GMP synthase [glutamine-hydrolyzing]	6.85e-07	NA	NA	0.5708
6. F	Q2SCJ3	GMP synthase [glutamine-hydrolyzing]	5.50e-07	NA	NA	0.5763
6. F	P46810	GMP synthase [glutamine-hydrolyzing]	7.87e-07	NA	NA	0.6047
6. F	A8LPE0	Argininosuccinate synthase	1.13e-03	NA	NA	0.6092
6. F	Q2L1U0	GMP synthase [glutamine-hydrolyzing]	8.25e-07	NA	NA	0.587
6. F	Q9Z6H4	GMP synthase [glutamine-hydrolyzing]	4.43e-07	NA	NA	0.704
6. F	Q8DZX7	GMP synthase [glutamine-hydrolyzing]	4.54e-07	NA	NA	0.717
6. F	Q2YVL5	GMP synthase [glutamine-hydrolyzing]	5.66e-07	NA	NA	0.7036
6. F	Q577H0	GMP synthase [glutamine-hydrolyzing]	5.76e-07	NA	NA	0.6268
6. F	B7UXJ9	GMP synthase [glutamine-hydrolyzing]	5.05e-07	NA	NA	0.5851
6. F	Q891G7	GMP synthase [glutamine-hydrolyzing]	5.58e-07	NA	NA	0.6038
6. F	Q0AEE4	Argininosuccinate synthase	6.38e-04	NA	NA	0.6522
6. F	A2BZD9	GMP synthase [glutamine-hydrolyzing]	7.48e-07	NA	NA	0.5914
6. F	Q0AB32	Argininosuccinate synthase	9.90e-04	NA	NA	0.6208
6. F	A4VIU7	Argininosuccinate synthase	6.50e-04	NA	NA	0.6461
6. F	P60500	GMP synthase [glutamine-hydrolyzing]	6.06e-07	NA	NA	0.5636
6. F	B4TR83	GMP synthase [glutamine-hydrolyzing]	5.35e-07	NA	NA	0.5937
6. F	B8ZUE2	GMP synthase [glutamine-hydrolyzing]	7.86e-07	NA	NA	0.5976
6. F	P61526	Argininosuccinate synthase	1.45e-03	NA	NA	0.6231
6. F	A8A313	GMP synthase [glutamine-hydrolyzing]	6.75e-07	NA	NA	0.5891
6. F	Q7N3K4	GMP synthase [glutamine-hydrolyzing]	5.73e-07	NA	NA	0.6067
6. F	A0AHK7	GMP synthase [glutamine-hydrolyzing]	4.70e-07	NA	NA	0.5882
6. F	Q5F4X9	GMP synthase [glutamine-hydrolyzing]	6.83e-07	NA	NA	0.5725
6. F	Q5HIQ6	GMP synthase [glutamine-hydrolyzing]	5.39e-07	NA	NA	0.603
6. F	A7H2D2	GMP synthase [glutamine-hydrolyzing]	6.49e-07	NA	NA	0.6904
6. F	Q7VVM4	GMP synthase [glutamine-hydrolyzing]	1.11e-06	NA	NA	0.5925
6. F	A5FQ73	Argininosuccinate synthase	6.42e-04	NA	NA	0.649
6. F	A9VQG9	GMP synthase [glutamine-hydrolyzing]	5.67e-07	NA	NA	0.5848
6. F	C4Z9C9	Argininosuccinate synthase	4.18e-03	NA	NA	0.6239
6. F	Q6AIZ6	tRNA-specific 2-thiouridylase MnmA	6.44e-07	NA	NA	0.6266
6. F	B6JMN5	GMP synthase [glutamine-hydrolyzing]	4.45e-07	NA	NA	0.5859
6. F	B2RIF9	GMP synthase [glutamine-hydrolyzing]	5.25e-07	NA	NA	0.6585
6. F	B8ZKZ5	GMP synthase [glutamine-hydrolyzing]	4.87e-07	NA	NA	0.6297
6. F	Q8ZCU4	GMP synthase [glutamine-hydrolyzing]	5.63e-07	NA	NA	0.5896
6. F	Q03H14	GMP synthase [glutamine-hydrolyzing]	6.81e-07	NA	NA	0.6574
6. F	B5XLN9	GMP synthase [glutamine-hydrolyzing]	5.51e-07	NA	NA	0.7178
6. F	B8GVI7	GMP synthase [glutamine-hydrolyzing]	8.95e-07	NA	NA	0.5676
6. F	C4K7H1	GMP synthase [glutamine-hydrolyzing]	6.89e-07	NA	NA	0.5691
6. F	Q1MMJ7	GMP synthase [glutamine-hydrolyzing]	7.76e-07	NA	NA	0.5714
6. F	Q9PN49	GMP synthase [glutamine-hydrolyzing]	7.04e-07	NA	NA	0.6982
6. F	Q8YBL2	GMP synthase [glutamine-hydrolyzing]	3.86e-07	NA	NA	0.5902
6. F	P59846	Argininosuccinate synthase	3.39e-03	NA	NA	0.6373
6. F	B8E9T4	GMP synthase [glutamine-hydrolyzing]	5.58e-07	NA	NA	0.6109
6. F	B8F3T2	GMP synthase [glutamine-hydrolyzing]	8.04e-07	NA	NA	0.5865
6. F	C5BLU3	GMP synthase [glutamine-hydrolyzing]	5.42e-07	NA	NA	0.591
6. F	Q9CFJ0	GMP synthase [glutamine-hydrolyzing]	6.03e-07	NA	NA	0.6978
6. F	Q6G197	GMP synthase [glutamine-hydrolyzing]	4.54e-07	NA	NA	0.6022
6. F	B7JXM2	GMP synthase [glutamine-hydrolyzing]	1.36e-06	NA	NA	0.6602
6. F	Q1LSJ1	GMP synthase [glutamine-hydrolyzing]	5.25e-07	NA	NA	0.561
6. F	C3L508	GMP synthase [glutamine-hydrolyzing]	4.89e-07	NA	NA	0.5936
6. F	Q83QL1	GMP synthase [glutamine-hydrolyzing]	5.05e-07	NA	NA	0.5942
6. F	A7FWU6	Argininosuccinate synthase	3.39e-03	NA	NA	0.6311
6. F	A5D510	Argininosuccinate synthase	8.46e-04	NA	NA	0.6342
6. F	A7NCA3	GMP synthase [glutamine-hydrolyzing]	6.54e-07	NA	NA	0.5974
6. F	A3PA84	GMP synthase [glutamine-hydrolyzing]	9.64e-07	NA	NA	0.6366
6. F	Q7VG78	Probable GMP synthase [glutamine-hydrolyzing]	7.69e-03	NA	NA	0.5187
6. F	Q970V0	Argininosuccinate synthase	7.47e-04	NA	NA	0.6317
6. F	Q0AW22	GMP synthase [glutamine-hydrolyzing]	7.02e-07	NA	NA	0.5963
6. F	Q62JF6	GMP synthase [glutamine-hydrolyzing]	1.07e-06	NA	NA	0.616
6. F	A5CVV4	GMP synthase [glutamine-hydrolyzing]	5.88e-07	NA	NA	0.6007
6. F	Q47DK8	GMP synthase [glutamine-hydrolyzing]	1.10e-06	NA	NA	0.6873
6. F	B7UGU5	GMP synthase [glutamine-hydrolyzing]	5.34e-07	NA	NA	0.5679
6. F	A1U3U4	Argininosuccinate synthase	6.33e-04	NA	NA	0.6276
6. F	Q39TA7	GMP synthase [glutamine-hydrolyzing]	5.94e-07	NA	NA	0.5907
6. F	Q3JDG3	GMP synthase [glutamine-hydrolyzing]	3.82e-07	NA	NA	0.608
6. F	Q2Y9R9	GMP synthase [glutamine-hydrolyzing]	5.10e-07	NA	NA	0.6745
6. F	Q30YB8	Argininosuccinate synthase	1.67e-03	NA	NA	0.6098
6. F	Q9PAR6	GMP synthase [glutamine-hydrolyzing]	4.13e-07	NA	NA	0.5745
6. F	A3PK79	GMP synthase [glutamine-hydrolyzing]	7.80e-07	NA	NA	0.5628
6. F	A6TYP2	GMP synthase [glutamine-hydrolyzing]	5.02e-07	NA	NA	0.7058
6. F	A5ICM2	GMP synthase [glutamine-hydrolyzing]	6.65e-07	NA	NA	0.5872
6. F	Q3AD70	GMP synthase [glutamine-hydrolyzing]	7.77e-07	NA	NA	0.6012
6. F	Q3MEA8	GMP synthase [glutamine-hydrolyzing]	1.22e-06	NA	NA	0.6467
6. F	Q8EWS9	GMP synthase [glutamine-hydrolyzing]	9.73e-07	NA	NA	0.5626
6. F	A6LKY1	GMP synthase [glutamine-hydrolyzing]	6.70e-07	NA	NA	0.5892
6. F	A0R8W7	GMP synthase [glutamine-hydrolyzing]	5.44e-07	NA	NA	0.593
6. F	C0QYF1	GMP synthase [glutamine-hydrolyzing]	9.59e-07	NA	NA	0.656
6. F	Q1I5K9	GMP synthase [glutamine-hydrolyzing]	5.64e-07	NA	NA	0.5991
6. F	A3D6V2	GMP synthase [glutamine-hydrolyzing]	4.84e-07	NA	NA	0.6067
6. F	A4XS43	Argininosuccinate synthase	6.28e-04	NA	NA	0.641
6. F	B0USI5	GMP synthase [glutamine-hydrolyzing]	5.55e-07	NA	NA	0.5753
6. F	Q6L1Q1	GMP synthase [glutamine-hydrolyzing] subunit B	7.69e-08	NA	NA	0.5991
6. F	Q056F0	Argininosuccinate synthase	3.06e-03	NA	NA	0.6383
6. F	Q1GGV8	GMP synthase [glutamine-hydrolyzing]	7.09e-07	NA	NA	0.5818
6. F	A5F3F1	GMP synthase [glutamine-hydrolyzing]	4.19e-07	NA	NA	0.6144
6. F	Q0BLV0	GMP synthase [glutamine-hydrolyzing]	6.12e-07	NA	NA	0.6322
6. F	B0KUE7	Argininosuccinate synthase	6.58e-04	NA	NA	0.6518
6. F	Q81IS3	GMP synthase [glutamine-hydrolyzing]	6.73e-07	NA	NA	0.5935
6. F	Q492E5	GMP synthase [glutamine-hydrolyzing]	8.82e-07	NA	NA	0.5941
6. F	Q7MWL9	GMP synthase [glutamine-hydrolyzing]	5.11e-07	NA	NA	0.6522
6. F	A9AIP4	GMP synthase [glutamine-hydrolyzing]	1.05e-06	NA	NA	0.5909
6. F	A0LEB2	Argininosuccinate synthase	1.09e-03	NA	NA	0.633
6. F	A2SBA7	GMP synthase [glutamine-hydrolyzing]	1.07e-06	NA	NA	0.5885
6. F	Q3ZYG0	Argininosuccinate synthase	6.54e-04	NA	NA	0.6306
6. F	P0DB54	GMP synthase [glutamine-hydrolyzing]	4.51e-07	NA	NA	0.7064
6. F	C3KBZ2	Argininosuccinate synthase	6.59e-04	NA	NA	0.6387
6. F	Q0BE45	GMP synthase [glutamine-hydrolyzing]	8.50e-07	NA	NA	0.5946
6. F	A7FFZ9	GMP synthase [glutamine-hydrolyzing]	4.23e-07	NA	NA	0.5883
6. F	Q3ZXH7	GMP synthase [glutamine-hydrolyzing]	6.00e-07	NA	NA	0.7016
6. F	Q9JXR2	GMP synthase [glutamine-hydrolyzing]	6.63e-07	NA	NA	0.5646
6. F	A6SZM5	GMP synthase [glutamine-hydrolyzing]	7.77e-07	NA	NA	0.6049
6. F	A5VZI0	Argininosuccinate synthase	5.76e-04	NA	NA	0.6328
6. F	A2BTY4	GMP synthase [glutamine-hydrolyzing]	8.23e-07	NA	NA	0.648
6. F	Q3K7D0	GMP synthase [glutamine-hydrolyzing]	5.51e-07	NA	NA	0.5964
6. F	Q74LF7	GMP synthase [glutamine-hydrolyzing]	4.95e-07	NA	NA	0.6448
6. F	B5FR52	GMP synthase [glutamine-hydrolyzing]	4.50e-07	NA	NA	0.5998
6. F	Q1GBU7	GMP synthase [glutamine-hydrolyzing]	7.00e-07	NA	NA	0.6033
6. F	A4SGJ0	GMP synthase [glutamine-hydrolyzing]	8.27e-07	NA	NA	0.6933
6. F	Q5L3E1	GMP synthase [glutamine-hydrolyzing]	5.53e-07	NA	NA	0.589
6. F	A4WTP4	GMP synthase [glutamine-hydrolyzing]	9.15e-07	NA	NA	0.5756
6. F	Q5M4P4	GMP synthase [glutamine-hydrolyzing]	5.27e-07	NA	NA	0.6923
6. F	A5N5D9	GMP synthase [glutamine-hydrolyzing]	6.69e-07	NA	NA	0.5772
6. F	A3NAR3	GMP synthase [glutamine-hydrolyzing]	1.12e-06	NA	NA	0.5957
6. F	Q8XI46	GMP synthase [glutamine-hydrolyzing]	9.31e-07	NA	NA	0.599
6. F	B7NQV3	GMP synthase [glutamine-hydrolyzing]	5.52e-07	NA	NA	0.5804
6. F	A9KHL4	Argininosuccinate synthase	4.52e-03	NA	NA	0.6082
6. F	Q31DE7	GMP synthase [glutamine-hydrolyzing]	8.93e-07	NA	NA	0.6324
6. F	Q1JBM8	GMP synthase [glutamine-hydrolyzing]	5.06e-07	NA	NA	0.71
7. B	Q54ML1	Glutamine-dependent NAD(+) synthetase	5.42e-12	NA	2.38e-06	NA
7. B	A2YII8	Glutamine-dependent NAD(+) synthetase	6.29e-12	NA	1.82e-04	NA
7. B	Q711T7	Glutamine-dependent NAD(+) synthetase	7.81e-12	NA	8.40e-07	NA
7. B	Q6YR90	tRNA-specific 2-thiouridylase MnmA	1.24e-04	NA	0.024	NA
7. B	B1VAX7	tRNA-specific 2-thiouridylase MnmA	1.09e-04	NA	0.013	NA
7. B	Q4R5Y2	Glutamine-dependent NAD(+) synthetase	5.93e-12	NA	1.48e-08	NA
7. B	Q9VYA0	Glutamine-dependent NAD(+) synthetase	2.54e-11	NA	3.95e-08	NA
7. B	O74940	Putative glutamine-dependent NAD(+) synthetase	3.37e-12	NA	7.60e-07	NA
7. B	P38795	Glutamine-dependent NAD(+) synthetase	4.32e-12	NA	1.48e-07	NA
7. B	Q6IA69	Glutamine-dependent NAD(+) synthetase	6.19e-12	NA	5.67e-08	NA
7. B	Q812E8	Glutamine-dependent NAD(+) synthetase	8.54e-12	NA	6.38e-08	NA
7. B	Q0D8D4	Glutamine-dependent NAD(+) synthetase	6.69e-12	NA	1.82e-04	NA
7. B	Q9C723	Glutamine-dependent NAD(+) synthetase	6.62e-12	NA	9.61e-06	NA
7. B	Q5ZMA6	Glutamine-dependent NAD(+) synthetase	4.23e-12	NA	2.30e-07	NA
7. B	Q2NIM9	tRNA-specific 2-thiouridylase MnmA	1.34e-04	NA	0.028	NA
7. B	Q3ZBF0	Glutamine-dependent NAD(+) synthetase	4.34e-12	NA	6.82e-07	NA