Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54752.1
JCVISYN3A_0380
Nicotinate (nicotinamide) nucleotide adenylyltransferase.
M. mycoides homolog: Q6MTG6.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 15
Unique PROST Go: 3
Unique BLAST Go: 3
Unique Foldseek Go: 1
Total Homologs: 511
Unique PROST Homologs: 3
Unique BLAST Homologs: 12
Unique Foldseek Homologs: 103
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q9PQ21
(Probable nicotinate-nucleotide adenylyltransferase) with a FATCAT P-Value: 0 and RMSD of 3.11 angstrom. The sequence alignment identity is 31.0%.
Structural alignment shown in left. Query protein AVX54752.1 colored as red in alignment, homolog Q9PQ21 colored as blue.
Query protein AVX54752.1 is also shown in right top, homolog Q9PQ21 showed in right bottom. They are colored based on secondary structures.
AVX54752.1 MSKKIALFGGSFDPIHTDHVNIIKTCYEKL-KFDEVWLIPAYLNPFKT-KQNSSI------V----DRLNMLEI-IKNKFSYIKIYDYEIKN-NKSTPTY 86 Q9PQ21 M--KIILFCGAFDMVHNAHIAMAKQAM-KLVNADKLIFLPSNFKFFKAINKNDNLEYEKTKLTPGHHRIAMLKIATKNLVN-IEVSDYELKQINKSY-TI 95 AVX54752.1 QTVKHILKTNQNDH-FSFIMGSDQLDRFEEWNNFEELIKMIDFKV--FKRNED--YNKQVLNK------YNLELFEFE----N--NY-LSSTDIR---NL 165 Q9PQ21 NTIEHFKQIYGSEHEYYFIMGSDNLERFKQWKDWERILK--EVKIICFKRG-DVCVKKSCPQKSCECESFN--FFEHEILLVNDFNYNISSTEIKKRHNL 190 AVX54752.1 KH-LDKQIKEINDYVN-YNL--MYLYER-L---E--TQMDQK--RYIHCLNVGKMAHDLAIKWNV-DPKKALI-----AGTLHDITKRWSKEQSLNYL-- 245 Q9PQ21 TSGIDPAV--L-DYINEHGLYALWLLEKHLISYDNFNNLEKKVARINHCRRVAQMCVDLM---NVYD-KK-LIDQAYCAGIYHDILKCLDEQESVAYFNE 282 AVX54752.1 -KTYLPQLINEPYPVW---HSYTAYLHLL---YDWLIDDKEILSAVFNHT-----VG--SENMSLLDIIVFCADKISIER----DYLGVDKLRELCFSDL 327 Q9PQ21 HKSELN--IGDDFISWRILHSYLG-AHLLQTQYGF--KNQLILNAIRRHTRPFDFIKDYSE-LTTLDKILYCADKLEPNRREEIDQINIDYYRKLVFEDL 376 AVX54752.1 MLGFKTLLK-NQYDLAIKKHGKDNIGSMLIKTINYYLKD 365 Q9PQ21 ---DKAFIEVYQYQQRQRK-------------------- 392
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0009435 | NAD biosynthetic process |
| 1. PBF | GO:0000309 | nicotinamide-nucleotide adenylyltransferase activity |
| 1. PBF | GO:0004515 | nicotinate-nucleotide adenylyltransferase activity |
| 3. BF | GO:0004595 | pantetheine-phosphate adenylyltransferase activity |
| 3. BF | GO:0005886 | plasma membrane |
| 3. BF | GO:0015937 | coenzyme A biosynthetic process |
| 3. BF | GO:0005524 | ATP binding |
| 3. BF | GO:0005737 | cytoplasm |
| 5. P | GO:0016787 | hydrolase activity |
| 5. P | GO:0002128 | tRNA nucleoside ribose methylation |
| 5. P | GO:0008175 | tRNA methyltransferase activity |
| 6. F | GO:0050262 | ribosylnicotinamide kinase activity |
| 7. B | GO:0034355 | NAD salvage |
| 7. B | GO:0034628 | 'de novo' NAD biosynthetic process from aspartate |
| 7. B | GO:0016021 | integral component of membrane |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0000166 | nucleotide binding |
| GO:0016779 | nucleotidyltransferase activity |
| GO:0009435 | NAD biosynthetic process |
| GO:0009058 | biosynthetic process |
| GO:0005524 | ATP binding |
| GO:0070566 | adenylyltransferase activity |
| GO:0019363 | pyridine nucleotide biosynthetic process |
| GO:0003824 | catalytic activity |
| GO:0008803 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) activity |
| GO:0004515 | nicotinate-nucleotide adenylyltransferase activity |
| GO:0009165 | nucleotide biosynthetic process |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q9PQ21 | Probable nicotinate-nucleotide adenylyltransferase | 0.00e+00 | 5.84e-59 | 1.94e-28 | 0.7575 |
| 1. PBF | P75442 | Uncharacterized protein MG240 homolog | 0.00e+00 | 1.26e-73 | 2.13e-43 | 0.891 |
| 1. PBF | P47482 | Uncharacterized protein MG240 | 0.00e+00 | 3.00e-78 | 1.31e-49 | 0.8705 |
| 2. PF | Q979R3 | tRNA (cytidine(56)-2'-O)-methyltransferase | 1.96e-04 | 3.55e-05 | NA | 0.2979 |
| 3. BF | Q6G8X4 | Probable nicotinate-nucleotide adenylyltransferase | 8.19e-14 | NA | 8.16e-21 | 0.8625 |
| 3. BF | Q02SH3 | Probable nicotinate-nucleotide adenylyltransferase | 1.20e-13 | NA | 3.46e-12 | 0.7974 |
| 3. BF | B8FMU1 | Probable nicotinate-nucleotide adenylyltransferase | 3.15e-13 | NA | 6.11e-12 | 0.7602 |
| 3. BF | Q8D330 | Probable nicotinate-nucleotide adenylyltransferase | 9.78e-13 | NA | 9.05e-05 | 0.7786 |
| 3. BF | B5EPW0 | Probable nicotinate-nucleotide adenylyltransferase | 2.73e-13 | NA | 4.76e-10 | 0.771 |
| 3. BF | B9E022 | Probable nicotinate-nucleotide adenylyltransferase | 1.22e-15 | NA | 8.83e-16 | 0.7915 |
| 3. BF | Q5F556 | Probable nicotinate-nucleotide adenylyltransferase | 8.44e-15 | NA | 1.12e-15 | 0.8271 |
| 3. BF | B3E3R0 | Probable nicotinate-nucleotide adenylyltransferase | 1.71e-12 | NA | 1.30e-09 | 0.7835 |
| 3. BF | Q9KD91 | Probable nicotinate-nucleotide adenylyltransferase | 7.55e-14 | NA | 4.88e-17 | 0.8842 |
| 3. BF | Q3AF34 | Probable nicotinate-nucleotide adenylyltransferase | 5.55e-15 | NA | 2.94e-14 | 0.838 |
| 3. BF | B1ILY3 | Probable nicotinate-nucleotide adenylyltransferase | 1.84e-14 | NA | 1.22e-15 | 0.8112 |
| 3. BF | A6V0A4 | Probable nicotinate-nucleotide adenylyltransferase | 1.57e-13 | NA | 9.85e-12 | 0.7961 |
| 3. BF | Q2S0V3 | Probable nicotinate-nucleotide adenylyltransferase | 4.00e-15 | NA | 2.46e-17 | 0.8678 |
| 3. BF | B7J0M8 | Probable nicotinate-nucleotide adenylyltransferase | 1.09e-14 | NA | 2.79e-10 | 0.8194 |
| 3. BF | Q2JDN2 | Probable nicotinate-nucleotide adenylyltransferase | 5.76e-14 | NA | 1.54e-08 | 0.7954 |
| 3. BF | Q3ZW88 | Probable nicotinate-nucleotide adenylyltransferase | 1.32e-13 | NA | 2.47e-13 | 0.839 |
| 3. BF | A4XYY3 | Probable nicotinate-nucleotide adenylyltransferase | 8.20e-14 | NA | 5.88e-12 | 0.8015 |
| 3. BF | A2SFG3 | Probable nicotinate-nucleotide adenylyltransferase | 2.48e-12 | NA | 1.51e-15 | 0.8213 |
| 3. BF | A6WDM4 | Probable nicotinate-nucleotide adenylyltransferase | 8.49e-13 | NA | 7.08e-07 | 0.8749 |
| 3. BF | A0RIU9 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 1.73e-17 | 0.8829 |
| 3. BF | Q21WQ0 | Probable nicotinate-nucleotide adenylyltransferase | 6.44e-14 | NA | 7.92e-15 | 0.8433 |
| 3. BF | A0JXJ4 | Probable nicotinate-nucleotide adenylyltransferase | 2.36e-12 | NA | 4.08e-08 | 0.8676 |
| 3. BF | Q39E98 | Probable nicotinate-nucleotide adenylyltransferase | 5.55e-12 | NA | 3.60e-06 | 0.694 |
| 3. BF | A6WRK2 | Probable nicotinate-nucleotide adenylyltransferase | 5.41e-08 | NA | 1.56e-11 | 0.7589 |
| 3. BF | Q21FD0 | Probable nicotinate-nucleotide adenylyltransferase | 3.69e-13 | NA | 1.09e-10 | 0.7643 |
| 3. BF | B2V0B0 | Probable nicotinate-nucleotide adenylyltransferase | 2.65e-14 | NA | 2.51e-13 | 0.7954 |
| 3. BF | B4U7J9 | Probable nicotinate-nucleotide adenylyltransferase | 1.30e-13 | NA | 1.47e-18 | 0.8286 |
| 3. BF | B9M0D7 | Probable nicotinate-nucleotide adenylyltransferase | 1.52e-13 | NA | 3.65e-09 | 0.7552 |
| 3. BF | A3D7N9 | Probable nicotinate-nucleotide adenylyltransferase | 4.57e-08 | NA | 1.11e-12 | 0.7657 |
| 3. BF | Q88DL5 | Probable nicotinate-nucleotide adenylyltransferase | 2.32e-13 | NA | 9.07e-11 | 0.7997 |
| 3. BF | Q65ZZ2 | Probable nicotinate-nucleotide adenylyltransferase | 9.07e-14 | NA | 1.58e-10 | 0.8162 |
| 3. BF | A5FLZ0 | Probable nicotinate-nucleotide adenylyltransferase | 1.89e-07 | NA | 1.77e-15 | 0.8422 |
| 3. BF | A0KN91 | Probable nicotinate-nucleotide adenylyltransferase | 6.39e-14 | NA | 5.26e-11 | 0.7848 |
| 3. BF | Q2SA28 | Probable nicotinate-nucleotide adenylyltransferase | 5.81e-12 | NA | 1.90e-07 | 0.7324 |
| 3. BF | Q57RT0 | Probable nicotinate-nucleotide adenylyltransferase | 6.16e-14 | NA | 1.09e-10 | 0.7506 |
| 3. BF | A8AJG3 | Probable nicotinate-nucleotide adenylyltransferase | 8.10e-15 | NA | 1.22e-11 | 0.7602 |
| 3. BF | A3DEU4 | Probable nicotinate-nucleotide adenylyltransferase | 3.57e-14 | NA | 9.53e-06 | 0.8106 |
| 3. BF | A4SJW5 | Probable nicotinate-nucleotide adenylyltransferase | 1.20e-14 | NA | 1.73e-11 | 0.7759 |
| 3. BF | B8E4X4 | Probable nicotinate-nucleotide adenylyltransferase | 8.79e-08 | NA | 1.76e-13 | 0.7438 |
| 3. BF | Q6AFX7 | Probable nicotinate-nucleotide adenylyltransferase | 3.54e-14 | NA | 7.42e-11 | 0.8723 |
| 3. BF | P54455 | Nicotinate-nucleotide adenylyltransferase | 1.67e-15 | NA | 2.62e-14 | 0.8726 |
| 3. BF | Q5SHF0 | Probable nicotinate-nucleotide adenylyltransferase | 3.11e-15 | NA | 1.09e-06 | 0.8635 |
| 3. BF | B5EEI3 | Probable nicotinate-nucleotide adenylyltransferase | 1.71e-13 | NA | 2.24e-08 | 0.7746 |
| 3. BF | A8GB18 | Probable nicotinate-nucleotide adenylyltransferase | 6.12e-13 | NA | 4.52e-12 | 0.7729 |
| 3. BF | A6LJZ1 | Probable nicotinate-nucleotide adenylyltransferase | 8.24e-12 | NA | 3.83e-06 | 0.8057 |
| 3. BF | P65502 | Probable nicotinate-nucleotide adenylyltransferase | 7.39e-14 | NA | 8.16e-21 | 0.8625 |
| 3. BF | A9AXY4 | Probable nicotinate-nucleotide adenylyltransferase | 4.44e-16 | NA | 8.64e-12 | 0.8728 |
| 3. BF | Q30PQ2 | Probable nicotinate-nucleotide adenylyltransferase | 1.70e-08 | NA | 7.53e-20 | 0.8539 |
| 3. BF | B3PRZ6 | Probable nicotinate-nucleotide adenylyltransferase | 3.44e-13 | NA | 4.07e-14 | 0.7628 |
| 3. BF | Q5HT13 | Probable nicotinate-nucleotide adenylyltransferase | 2.87e-07 | NA | 1.27e-21 | 0.8535 |
| 3. BF | Q2JWZ1 | Probable nicotinate-nucleotide adenylyltransferase | 4.66e-15 | NA | 8.52e-13 | 0.8462 |
| 3. BF | Q72HR5 | Probable nicotinate-nucleotide adenylyltransferase | 6.22e-15 | NA | 1.63e-06 | 0.8649 |
| 3. BF | Q7MXU9 | Probable nicotinate-nucleotide adenylyltransferase | 1.92e-07 | NA | 4.39e-07 | 0.8443 |
| 3. BF | B1J134 | Probable nicotinate-nucleotide adenylyltransferase | 1.45e-13 | NA | 1.14e-09 | 0.7974 |
| 3. BF | A0KTW4 | Probable nicotinate-nucleotide adenylyltransferase | 2.26e-12 | NA | 2.97e-15 | 0.7464 |
| 3. BF | A1U3C2 | Probable nicotinate-nucleotide adenylyltransferase | 4.55e-14 | NA | 2.19e-11 | 0.7455 |
| 3. BF | A9M0D0 | Probable nicotinate-nucleotide adenylyltransferase | 4.11e-15 | NA | 2.67e-16 | 0.8531 |
| 3. BF | B9KKZ0 | Probable nicotinate-nucleotide adenylyltransferase | 1.62e-10 | NA | 4.15e-13 | 0.7899 |
| 3. BF | Q83G58 | Probable nicotinate-nucleotide adenylyltransferase | 1.54e-13 | NA | 2.83e-07 | 0.8116 |
| 3. BF | Q5HFG7 | Probable nicotinate-nucleotide adenylyltransferase | 8.15e-14 | NA | 1.69e-20 | 0.8442 |
| 3. BF | A9R6Z3 | Probable nicotinate-nucleotide adenylyltransferase | 3.67e-13 | NA | 2.17e-11 | 0.7263 |
| 3. BF | B5XZR5 | Probable nicotinate-nucleotide adenylyltransferase | 5.90e-14 | NA | 2.88e-09 | 0.7703 |
| 3. BF | A8H7C5 | Probable nicotinate-nucleotide adenylyltransferase | 3.19e-12 | NA | 2.12e-21 | 0.7755 |
| 3. BF | Q8YM77 | Probable nicotinate-nucleotide adenylyltransferase | 1.61e-13 | NA | 2.13e-10 | 0.7872 |
| 3. BF | B4S6D9 | Probable nicotinate-nucleotide adenylyltransferase | 2.63e-14 | NA | 7.43e-11 | 0.7994 |
| 3. BF | Q7VJ92 | Probable nicotinate-nucleotide adenylyltransferase | 1.04e-07 | NA | 3.75e-23 | 0.7127 |
| 3. BF | B1ZVV8 | Probable nicotinate-nucleotide adenylyltransferase | 1.76e-13 | NA | 2.56e-17 | 0.8319 |
| 3. BF | Q0TK34 | Probable nicotinate-nucleotide adenylyltransferase | 4.77e-15 | NA | 6.73e-12 | 0.7562 |
| 3. BF | Q8K9B7 | Probable nicotinate-nucleotide adenylyltransferase | 6.87e-12 | NA | 4.19e-11 | 0.7689 |
| 3. BF | Q9HX21 | Probable nicotinate-nucleotide adenylyltransferase | 1.32e-13 | NA | 3.46e-12 | 0.797 |
| 3. BF | Q65H36 | Probable nicotinate-nucleotide adenylyltransferase | 0.00e+00 | NA | 3.37e-18 | 0.8733 |
| 3. BF | C5D4W0 | Probable nicotinate-nucleotide adenylyltransferase | 6.12e-13 | NA | 8.06e-18 | 0.875 |
| 3. BF | Q2LU86 | Probable nicotinate-nucleotide adenylyltransferase | 2.33e-13 | NA | 2.41e-06 | 0.7832 |
| 3. BF | A6GVY8 | Probable nicotinate-nucleotide adenylyltransferase | 6.27e-12 | NA | 5.95e-13 | 0.8232 |
| 3. BF | A9MKD1 | Probable nicotinate-nucleotide adenylyltransferase | 5.96e-14 | NA | 1.09e-10 | 0.7528 |
| 3. BF | B1KZR1 | Probable nicotinate-nucleotide adenylyltransferase | 1.67e-15 | NA | 6.75e-17 | 0.7934 |
| 3. BF | A1W118 | Probable nicotinate-nucleotide adenylyltransferase | 3.27e-07 | NA | 1.45e-21 | 0.8527 |
| 3. BF | A6T6A0 | Probable nicotinate-nucleotide adenylyltransferase | 1.07e-13 | NA | 7.16e-11 | 0.7667 |
| 3. BF | A1WYZ3 | Probable nicotinate-nucleotide adenylyltransferase | 1.81e-12 | NA | 4.53e-07 | 0.787 |
| 3. BF | Q7VWE6 | Probable nicotinate-nucleotide adenylyltransferase | 2.19e-07 | NA | 1.51e-18 | 0.7967 |
| 3. BF | A9L004 | Probable nicotinate-nucleotide adenylyltransferase | 5.71e-08 | NA | 1.27e-11 | 0.7621 |
| 3. BF | Q1QXB3 | Probable nicotinate-nucleotide adenylyltransferase | 9.08e-08 | NA | 6.89e-09 | 0.7672 |
| 3. BF | A8M0Y6 | Probable nicotinate-nucleotide adenylyltransferase | 6.92e-14 | NA | 1.60e-06 | 0.8644 |
| 3. BF | Q15VK3 | Probable nicotinate-nucleotide adenylyltransferase | 6.33e-15 | NA | 5.89e-10 | 0.7654 |
| 3. BF | Q7UFN6 | Probable nicotinate-nucleotide adenylyltransferase | 7.63e-14 | NA | 1.80e-15 | 0.8133 |
| 3. BF | Q2NUV0 | Probable nicotinate-nucleotide adenylyltransferase | 4.47e-12 | NA | 1.32e-06 | 0.7521 |
| 3. BF | Q5LW93 | Probable nicotinate-nucleotide adenylyltransferase | 6.55e-09 | NA | 1.80e-12 | 0.7343 |
| 3. BF | Q087K5 | Probable nicotinate-nucleotide adenylyltransferase | 2.89e-15 | NA | 7.26e-18 | 0.7669 |
| 3. BF | Q8UBS2 | Probable nicotinate-nucleotide adenylyltransferase | 1.92e-12 | NA | 3.60e-12 | 0.7665 |
| 3. BF | Q9A1F2 | Probable nicotinate-nucleotide adenylyltransferase | 8.88e-16 | NA | 5.76e-14 | 0.8794 |
| 3. BF | B9IY99 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 4.93e-18 | 0.8826 |
| 3. BF | Q4K5G0 | Probable nicotinate-nucleotide adenylyltransferase | 2.07e-13 | NA | 6.57e-17 | 0.7962 |
| 3. BF | B0T316 | Probable nicotinate-nucleotide adenylyltransferase | 9.44e-13 | NA | 1.76e-11 | 0.7633 |
| 3. BF | Q6D7L9 | Probable nicotinate-nucleotide adenylyltransferase | 3.31e-13 | NA | 2.17e-10 | 0.7688 |
| 3. BF | A4XAF6 | Probable nicotinate-nucleotide adenylyltransferase | 9.78e-14 | NA | 1.92e-06 | 0.8561 |
| 3. BF | A9NC46 | Probable nicotinate-nucleotide adenylyltransferase | 7.04e-14 | NA | 1.76e-09 | 0.7603 |
| 3. BF | Q9ZJP8 | Probable nicotinate-nucleotide adenylyltransferase | 2.04e-13 | NA | 3.83e-22 | 0.85 |
| 3. BF | Q8CSC1 | Probable nicotinate-nucleotide adenylyltransferase | 6.56e-14 | NA | 1.77e-19 | 0.842 |
| 3. BF | Q4L6U5 | Probable nicotinate-nucleotide adenylyltransferase | 2.58e-14 | NA | 1.12e-17 | 0.8262 |
| 3. BF | B7IYI5 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 1.06e-17 | 0.8824 |
| 3. BF | Q1MA73 | Probable nicotinate-nucleotide adenylyltransferase | 2.90e-13 | NA | 5.95e-15 | 0.7766 |
| 3. BF | B0U379 | Probable nicotinate-nucleotide adenylyltransferase | 7.62e-12 | NA | 0.002 | 0.7378 |
| 3. BF | Q2FGD0 | Probable nicotinate-nucleotide adenylyltransferase | 6.06e-14 | NA | 1.69e-20 | 0.8485 |
| 3. BF | B4E5R9 | Probable nicotinate-nucleotide adenylyltransferase | 6.74e-12 | NA | 1.43e-06 | 0.6902 |
| 3. BF | Q6HDJ0 | Probable nicotinate-nucleotide adenylyltransferase | 1.11e-16 | NA | 8.04e-18 | 0.8816 |
| 3. BF | A3Q2D5 | Probable nicotinate-nucleotide adenylyltransferase | 4.12e-12 | NA | 1.12e-07 | 0.8411 |
| 3. BF | Q71ZI2 | Probable nicotinate-nucleotide adenylyltransferase | 5.88e-15 | NA | 2.91e-14 | 0.8866 |
| 3. BF | Q9PBG5 | Probable nicotinate-nucleotide adenylyltransferase | 8.24e-12 | NA | 0.001 | 0.7379 |
| 3. BF | B1YKR5 | Probable nicotinate-nucleotide adenylyltransferase | 6.22e-15 | NA | 2.39e-17 | 0.8481 |
| 3. BF | Q73XR5 | Probable nicotinate-nucleotide adenylyltransferase | 3.44e-11 | NA | 2.08e-08 | 0.8284 |
| 3. BF | Q4JWT1 | Probable nicotinate-nucleotide adenylyltransferase | 6.98e-14 | NA | 5.45e-06 | 0.7994 |
| 3. BF | B7JNW4 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 1.80e-17 | 0.8827 |
| 3. BF | Q67SC4 | Probable nicotinate-nucleotide adenylyltransferase | 2.36e-12 | NA | 1.24e-11 | 0.8233 |
| 3. BF | Q0SM71 | Probable nicotinate-nucleotide adenylyltransferase | 6.55e-15 | NA | 4.33e-09 | 0.8276 |
| 3. BF | A0AIT7 | Probable nicotinate-nucleotide adenylyltransferase | 5.12e-14 | NA | 2.55e-17 | 0.8712 |
| 3. BF | Q12R42 | Probable nicotinate-nucleotide adenylyltransferase | 3.46e-10 | NA | 2.00e-15 | 0.7562 |
| 3. BF | Q8XBP0 | Nicotinate-nucleotide adenylyltransferase | 5.66e-15 | NA | 2.16e-12 | 0.7558 |
| 3. BF | Q9CBZ8 | Probable nicotinate-nucleotide adenylyltransferase | 6.34e-12 | NA | 1.64e-09 | 0.8391 |
| 3. BF | A1RGU2 | Probable nicotinate-nucleotide adenylyltransferase | 6.37e-14 | NA | 4.35e-14 | 0.7549 |
| 3. BF | Q8Z8H7 | Nicotinate-nucleotide adenylyltransferase | 6.04e-14 | NA | 6.16e-11 | 0.7524 |
| 3. BF | B0KJY4 | Probable nicotinate-nucleotide adenylyltransferase | 1.10e-13 | NA | 1.64e-11 | 0.7989 |
| 3. BF | B2S3Y0 | Probable nicotinate-nucleotide adenylyltransferase | 4.35e-14 | NA | 3.19e-18 | 0.7997 |
| 3. BF | Q6AK10 | Probable nicotinate-nucleotide adenylyltransferase | 1.91e-12 | NA | 5.32e-09 | 0.7759 |
| 3. BF | Q8YJ77 | Probable nicotinate-nucleotide adenylyltransferase | 2.04e-12 | NA | 6.34e-11 | 0.7967 |
| 3. BF | A1TC03 | Probable nicotinate-nucleotide adenylyltransferase | 4.68e-13 | NA | 3.79e-10 | 0.8439 |
| 3. BF | Q0TNI7 | Probable nicotinate-nucleotide adenylyltransferase | 4.55e-15 | NA | 8.32e-17 | 0.8056 |
| 3. BF | B2HME5 | Probable nicotinate-nucleotide adenylyltransferase | 9.47e-12 | NA | 4.04e-09 | 0.8306 |
| 3. BF | O51723 | Probable nicotinate-nucleotide adenylyltransferase | 7.33e-15 | NA | 3.93e-10 | 0.824 |
| 3. BF | O83723 | Probable nicotinate-nucleotide adenylyltransferase | 5.18e-14 | NA | 3.19e-18 | 0.7958 |
| 3. BF | P57089 | Probable nicotinate-nucleotide adenylyltransferase | 7.77e-15 | NA | 2.58e-15 | 0.8558 |
| 3. BF | A5G905 | Probable nicotinate-nucleotide adenylyltransferase | 7.58e-14 | NA | 2.12e-10 | 0.7476 |
| 3. BF | A7GT26 | Probable nicotinate-nucleotide adenylyltransferase | 1.11e-16 | NA | 1.08e-19 | 0.883 |
| 3. BF | A7FKW3 | Probable nicotinate-nucleotide adenylyltransferase | 2.16e-13 | NA | 2.17e-11 | 0.7403 |
| 3. BF | Q892N9 | Probable nicotinate-nucleotide adenylyltransferase | 3.11e-15 | NA | 5.70e-17 | 0.8032 |
| 3. BF | B5YQJ1 | Probable nicotinate-nucleotide adenylyltransferase | 5.55e-15 | NA | 2.16e-12 | 0.7559 |
| 3. BF | P57090 | Probable nicotinate-nucleotide adenylyltransferase | 3.45e-14 | NA | 1.02e-14 | 0.8095 |
| 3. BF | B2RMD0 | Probable nicotinate-nucleotide adenylyltransferase | 1.14e-07 | NA | 2.59e-07 | 0.8403 |
| 3. BF | A6L0W0 | Probable nicotinate-nucleotide adenylyltransferase | 9.46e-13 | NA | 5.07e-11 | 0.8585 |
| 3. BF | A4IR49 | Probable nicotinate-nucleotide adenylyltransferase | 4.87e-13 | NA | 6.08e-18 | 0.881 |
| 3. BF | Q8P2L2 | Probable nicotinate-nucleotide adenylyltransferase | 7.77e-16 | NA | 2.62e-13 | 0.8888 |
| 3. BF | A1AV35 | Probable nicotinate-nucleotide adenylyltransferase | 5.61e-14 | NA | 1.01e-06 | 0.7947 |
| 3. BF | A6QCD6 | Probable nicotinate-nucleotide adenylyltransferase | 1.51e-07 | NA | 5.69e-19 | 0.821 |
| 3. BF | Q054P9 | Probable nicotinate-nucleotide adenylyltransferase | 5.70e-13 | NA | 2.04e-16 | 0.8109 |
| 3. BF | P0DC62 | Probable nicotinate-nucleotide adenylyltransferase | 6.66e-16 | NA | 5.17e-14 | 0.88 |
| 3. BF | Q0T6P9 | Probable nicotinate-nucleotide adenylyltransferase | 4.22e-15 | NA | 2.27e-12 | 0.7826 |
| 3. BF | Q83I10 | Probable nicotinate-nucleotide adenylyltransferase | 2.01e-13 | NA | 4.57e-08 | 0.8597 |
| 3. BF | A5ITC1 | Probable nicotinate-nucleotide adenylyltransferase | 8.19e-14 | NA | 8.16e-21 | 0.8625 |
| 3. BF | Q4ZN74 | Probable nicotinate-nucleotide adenylyltransferase | 4.88e-13 | NA | 1.08e-08 | 0.7995 |
| 3. BF | A1UIY9 | Probable nicotinate-nucleotide adenylyltransferase | 2.87e-12 | NA | 1.12e-07 | 0.8426 |
| 3. BF | Q8DSI6 | Probable nicotinate-nucleotide adenylyltransferase | 6.66e-16 | NA | 4.65e-17 | 0.8857 |
| 3. BF | Q2YT34 | Probable nicotinate-nucleotide adenylyltransferase | 7.46e-14 | NA | 4.77e-21 | 0.8489 |
| 3. BF | B1KDW3 | Probable nicotinate-nucleotide adenylyltransferase | 6.14e-13 | NA | 1.20e-18 | 0.7693 |
| 3. BF | A8FFF0 | Probable nicotinate-nucleotide adenylyltransferase | 1.57e-14 | NA | 4.52e-16 | 0.846 |
| 3. BF | A6LQS1 | Probable nicotinate-nucleotide adenylyltransferase | 8.77e-15 | NA | 2.36e-18 | 0.7559 |
| 3. BF | Q92BM5 | Probable nicotinate-nucleotide adenylyltransferase | 4.30e-13 | NA | 4.16e-15 | 0.8736 |
| 3. BF | C6E7L8 | Probable nicotinate-nucleotide adenylyltransferase | 1.37e-13 | NA | 1.40e-08 | 0.7788 |
| 3. BF | Q9WXV2 | Probable nicotinate-nucleotide adenylyltransferase | 2.15e-08 | NA | 1.74e-13 | 0.829 |
| 3. BF | B7V8A6 | Probable nicotinate-nucleotide adenylyltransferase | 9.93e-14 | NA | 3.46e-12 | 0.7976 |
| 3. BF | A7ZXR5 | Probable nicotinate-nucleotide adenylyltransferase | 6.15e-14 | NA | 2.27e-12 | 0.7787 |
| 3. BF | Q7P0P7 | Probable nicotinate-nucleotide adenylyltransferase | 2.87e-13 | NA | 7.25e-14 | 0.7913 |
| 3. BF | Q6GGA7 | Probable nicotinate-nucleotide adenylyltransferase | 7.37e-14 | NA | 5.52e-20 | 0.8496 |
| 3. BF | A5FP50 | Probable nicotinate-nucleotide adenylyltransferase | 1.22e-13 | NA | 2.65e-13 | 0.8393 |
| 3. BF | A9KMF3 | Probable nicotinate-nucleotide adenylyltransferase | 6.88e-15 | NA | 5.92e-10 | 0.8097 |
| 3. BF | C6BSC2 | Probable nicotinate-nucleotide adenylyltransferase | 3.40e-09 | NA | 3.46e-13 | 0.7476 |
| 3. BF | B6JNH4 | Probable nicotinate-nucleotide adenylyltransferase | 5.61e-13 | NA | 3.83e-20 | 0.8507 |
| 3. BF | P57521 | Probable nicotinate-nucleotide adenylyltransferase | 9.69e-13 | NA | 4.93e-12 | 0.7701 |
| 3. BF | B2K883 | Probable nicotinate-nucleotide adenylyltransferase | 2.65e-13 | NA | 2.17e-11 | 0.7513 |
| 3. BF | Q7W7U1 | Probable nicotinate-nucleotide adenylyltransferase | 2.04e-07 | NA | 1.23e-18 | 0.7957 |
| 3. BF | A4YKF0 | Probable nicotinate-nucleotide adenylyltransferase | 1.63e-10 | NA | 1.66e-06 | 0.7743 |
| 3. BF | B7M5G6 | Probable nicotinate-nucleotide adenylyltransferase | 2.55e-15 | NA | 2.27e-12 | 0.7492 |
| 3. BF | P0A753 | Nicotinate-nucleotide adenylyltransferase | 6.29e-14 | NA | 2.27e-12 | 0.7783 |
| 3. BF | A3PLX6 | Probable nicotinate-nucleotide adenylyltransferase | 1.97e-10 | NA | 4.15e-13 | 0.7891 |
| 3. BF | A1A8R4 | Probable nicotinate-nucleotide adenylyltransferase | 5.66e-15 | NA | 6.73e-12 | 0.7559 |
| 3. BF | Q0HLJ3 | Probable nicotinate-nucleotide adenylyltransferase | 1.53e-12 | NA | 7.93e-17 | 0.744 |
| 3. BF | B5R7Z3 | Probable nicotinate-nucleotide adenylyltransferase | 8.88e-15 | NA | 6.40e-11 | 0.7634 |
| 3. BF | A7MQS3 | Probable nicotinate-nucleotide adenylyltransferase | 6.16e-13 | NA | 1.25e-12 | 0.719 |
| 3. BF | A5CX85 | Probable nicotinate-nucleotide adenylyltransferase | 4.36e-12 | NA | 1.14e-13 | 0.7291 |
| 3. BF | A8F479 | Probable nicotinate-nucleotide adenylyltransferase | 4.92e-08 | NA | 4.95e-11 | 0.767 |
| 3. BF | Q2JNW7 | Probable nicotinate-nucleotide adenylyltransferase | 4.11e-15 | NA | 1.07e-12 | 0.8472 |
| 3. BF | A9VHV9 | Probable nicotinate-nucleotide adenylyltransferase | 3.33e-16 | NA | 2.09e-19 | 0.8831 |
| 3. BF | Q97JL2 | Probable nicotinate-nucleotide adenylyltransferase | 1.11e-15 | NA | 4.32e-18 | 0.839 |
| 3. BF | Q1AVU4 | Probable nicotinate-nucleotide adenylyltransferase | 4.48e-12 | NA | 1.05e-08 | 0.7952 |
| 3. BF | Q5QYC8 | Probable nicotinate-nucleotide adenylyltransferase | 2.59e-13 | NA | 3.79e-14 | 0.7732 |
| 3. BF | B1LL88 | Probable nicotinate-nucleotide adenylyltransferase | 1.12e-13 | NA | 2.27e-12 | 0.7821 |
| 3. BF | B2FPR4 | Probable nicotinate-nucleotide adenylyltransferase | 6.31e-12 | NA | 1.94e-06 | 0.7066 |
| 3. BF | Q7NE64 | Probable nicotinate-nucleotide adenylyltransferase | 4.39e-14 | NA | 5.11e-11 | 0.819 |
| 3. BF | Q8XIJ4 | Probable nicotinate-nucleotide adenylyltransferase | 1.14e-14 | NA | 4.47e-16 | 0.809 |
| 3. BF | C3L3J1 | Probable nicotinate-nucleotide adenylyltransferase | 8.44e-15 | NA | 2.81e-16 | 0.8153 |
| 3. BF | A4SGY4 | Probable nicotinate-nucleotide adenylyltransferase | 1.18e-12 | NA | 3.72e-09 | 0.8348 |
| 3. BF | B0RDF9 | Probable nicotinate-nucleotide adenylyltransferase | 8.44e-15 | NA | 1.21e-12 | 0.8791 |
| 3. BF | A5U5B6 | Probable nicotinate-nucleotide adenylyltransferase | 1.67e-12 | NA | 6.43e-09 | 0.847 |
| 3. BF | Q2RKZ5 | Probable nicotinate-nucleotide adenylyltransferase | 2.71e-12 | NA | 6.53e-06 | 0.8269 |
| 3. BF | A5IKX3 | Probable nicotinate-nucleotide adenylyltransferase | 1.88e-08 | NA | 1.25e-12 | 0.8282 |
| 3. BF | Q31IE3 | Probable nicotinate-nucleotide adenylyltransferase | 3.93e-14 | NA | 1.58e-10 | 0.806 |
| 3. BF | A6QHD6 | Probable nicotinate-nucleotide adenylyltransferase | 7.23e-14 | NA | 1.69e-20 | 0.8445 |
| 3. BF | B0K413 | Probable nicotinate-nucleotide adenylyltransferase | 7.15e-14 | NA | 5.01e-10 | 0.8092 |
| 3. BF | B3PKM9 | Probable nicotinate-nucleotide adenylyltransferase | 5.54e-14 | NA | 1.16e-12 | 0.7874 |
| 3. BF | B9MRP6 | Probable nicotinate-nucleotide adenylyltransferase | 4.59e-13 | NA | 1.41e-12 | 0.7983 |
| 3. BF | Q1I4F1 | Probable nicotinate-nucleotide adenylyltransferase | 2.08e-13 | NA | 1.21e-12 | 0.796 |
| 3. BF | A9KCQ7 | Probable nicotinate-nucleotide adenylyltransferase | 1.81e-13 | NA | 7.46e-09 | 0.7682 |
| 3. BF | A0M6X6 | Probable nicotinate-nucleotide adenylyltransferase | 7.92e-14 | NA | 2.02e-13 | 0.8443 |
| 3. BF | Q24SP2 | Probable nicotinate-nucleotide adenylyltransferase | 6.13e-14 | NA | 6.34e-10 | 0.8391 |
| 3. BF | B3EQ84 | Probable nicotinate-nucleotide adenylyltransferase | 6.85e-14 | NA | 8.90e-12 | 0.818 |
| 3. BF | Q98EZ6 | Probable nicotinate-nucleotide adenylyltransferase | 2.71e-13 | NA | 1.63e-12 | 0.7506 |
| 3. BF | C1KVD5 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-15 | NA | 1.56e-14 | 0.8893 |
| 3. BF | A0Q1T2 | Probable nicotinate-nucleotide adenylyltransferase | 1.89e-15 | NA | 8.95e-18 | 0.817 |
| 3. BF | B5Y804 | Probable nicotinate-nucleotide adenylyltransferase | 4.45e-14 | NA | 7.30e-13 | 0.829 |
| 3. BF | A9HC14 | Probable nicotinate-nucleotide adenylyltransferase | 2.05e-09 | NA | 3.65e-12 | 0.7223 |
| 3. BF | Q5PM85 | Probable nicotinate-nucleotide adenylyltransferase | 1.05e-14 | NA | 1.09e-10 | 0.7626 |
| 3. BF | Q8REH1 | Probable nicotinate-nucleotide adenylyltransferase | 3.25e-08 | NA | 6.12e-17 | 0.8323 |
| 3. BF | Q3J0C4 | Probable nicotinate-nucleotide adenylyltransferase | 4.19e-11 | NA | 3.96e-13 | 0.7901 |
| 3. BF | C3L5T6 | Probable nicotinate-nucleotide adenylyltransferase | 1.11e-16 | NA | 8.04e-18 | 0.8818 |
| 3. BF | Q49Y35 | Probable nicotinate-nucleotide adenylyltransferase | 1.94e-14 | NA | 2.42e-12 | 0.8354 |
| 3. BF | P9WJJ4 | Probable nicotinate-nucleotide adenylyltransferase | 3.28e-11 | NA | 6.43e-09 | 0.8232 |
| 3. BF | B0TR47 | Probable nicotinate-nucleotide adenylyltransferase | 2.29e-11 | NA | 1.17e-18 | 0.7618 |
| 3. BF | A1KLB3 | Probable nicotinate-nucleotide adenylyltransferase | 3.97e-11 | NA | 6.68e-09 | 0.832 |
| 3. BF | Q830B9 | Probable nicotinate-nucleotide adenylyltransferase | 2.26e-14 | NA | 6.14e-15 | 0.8809 |
| 3. BF | Q1CKQ7 | Probable nicotinate-nucleotide adenylyltransferase | 3.24e-13 | NA | 2.17e-11 | 0.7384 |
| 3. BF | P73246 | Probable nicotinate-nucleotide adenylyltransferase | 2.50e-11 | NA | 4.13e-06 | 0.7421 |
| 3. BF | A7HT64 | Probable nicotinate-nucleotide adenylyltransferase | 2.55e-12 | NA | 1.42e-11 | 0.7633 |
| 3. BF | A8EWM2 | Probable nicotinate-nucleotide adenylyltransferase | 4.55e-08 | NA | 2.72e-22 | 0.873 |
| 3. BF | Q5KWX9 | Probable nicotinate-nucleotide adenylyltransferase | 3.71e-13 | NA | 8.36e-20 | 0.8815 |
| 3. BF | A5IBI8 | Probable nicotinate-nucleotide adenylyltransferase | 9.66e-15 | NA | 8.26e-11 | 0.7841 |
| 3. BF | Q87C62 | Probable nicotinate-nucleotide adenylyltransferase | 1.01e-11 | NA | 0.001 | 0.7383 |
| 3. BF | A9BK06 | Probable nicotinate-nucleotide adenylyltransferase | 5.20e-12 | NA | 2.03e-06 | 0.7772 |
| 3. BF | P65501 | Probable nicotinate-nucleotide adenylyltransferase | 8.17e-14 | NA | 8.16e-21 | 0.8625 |
| 3. BF | B7NLZ8 | Probable nicotinate-nucleotide adenylyltransferase | 7.08e-14 | NA | 2.27e-12 | 0.7799 |
| 3. BF | A4XKG5 | Probable nicotinate-nucleotide adenylyltransferase | 2.27e-13 | NA | 5.30e-10 | 0.7909 |
| 3. BF | A4G2M4 | Probable nicotinate-nucleotide adenylyltransferase | 8.48e-14 | NA | 1.68e-10 | 0.7905 |
| 3. BF | Q5ZVU5 | Probable nicotinate-nucleotide adenylyltransferase | 2.69e-14 | NA | 1.12e-10 | 0.7928 |
| 3. BF | B9KYU7 | Probable nicotinate-nucleotide adenylyltransferase | 1.87e-12 | NA | 8.17e-09 | 0.8153 |
| 3. BF | Q1C518 | Probable nicotinate-nucleotide adenylyltransferase | 3.01e-13 | NA | 2.17e-11 | 0.7386 |
| 3. BF | B7LLH4 | Probable nicotinate-nucleotide adenylyltransferase | 7.55e-14 | NA | 9.30e-10 | 0.7636 |
| 3. BF | B5YEQ0 | Probable nicotinate-nucleotide adenylyltransferase | 6.67e-14 | NA | 1.02e-07 | 0.8615 |
| 3. BF | B8D9M4 | Probable nicotinate-nucleotide adenylyltransferase | 4.98e-13 | NA | 4.93e-12 | 0.7698 |
| 3. BF | Q87VV7 | Probable nicotinate-nucleotide adenylyltransferase | 1.25e-13 | NA | 1.69e-08 | 0.7897 |
| 3. BF | Q8A675 | Probable nicotinate-nucleotide adenylyltransferase | 2.30e-09 | NA | 5.28e-11 | 0.8306 |
| 3. BF | Q47JQ3 | Probable nicotinate-nucleotide adenylyltransferase | 5.70e-13 | NA | 1.29e-07 | 0.7752 |
| 3. BF | Q1LTM7 | Probable nicotinate-nucleotide adenylyltransferase | 1.11e-13 | NA | 2.42e-07 | 0.7688 |
| 3. BF | Q1B647 | Probable nicotinate-nucleotide adenylyltransferase | 4.55e-12 | NA | 1.12e-07 | 0.8411 |
| 3. BF | A8FZ13 | Probable nicotinate-nucleotide adenylyltransferase | 2.20e-12 | NA | 4.56e-17 | 0.7698 |
| 3. BF | A0LSX5 | Probable nicotinate-nucleotide adenylyltransferase | 4.93e-13 | NA | 1.29e-07 | 0.8223 |
| 3. BF | Q8F7T9 | Probable nicotinate-nucleotide adenylyltransferase | 1.04e-13 | NA | 3.47e-15 | 0.8507 |
| 3. BF | C1A4H9 | Probable nicotinate-nucleotide adenylyltransferase | 1.09e-11 | NA | 1.41e-16 | 0.8034 |
| 3. BF | B8E0B1 | Probable nicotinate-nucleotide adenylyltransferase | 4.01e-13 | NA | 1.27e-07 | 0.8617 |
| 3. BF | Q0RPE7 | Probable nicotinate-nucleotide adenylyltransferase | 9.07e-14 | NA | 3.08e-08 | 0.8603 |
| 3. BF | A1KWA2 | Probable nicotinate-nucleotide adenylyltransferase | 1.87e-14 | NA | 2.27e-15 | 0.7949 |
| 3. BF | A7FXU4 | Probable nicotinate-nucleotide adenylyltransferase | 1.17e-14 | NA | 2.81e-16 | 0.7996 |
| 3. BF | A7Z6X8 | Probable nicotinate-nucleotide adenylyltransferase | 1.67e-15 | NA | 1.06e-15 | 0.881 |
| 3. BF | Q0SR56 | Probable nicotinate-nucleotide adenylyltransferase | 1.09e-14 | NA | 4.70e-16 | 0.8049 |
| 3. BF | A4WPT1 | Probable nicotinate-nucleotide adenylyltransferase | 1.72e-11 | NA | 2.43e-08 | 0.7477 |
| 3. BF | A5E960 | Probable nicotinate-nucleotide adenylyltransferase | 2.98e-11 | NA | 1.22e-06 | 0.7712 |
| 3. BF | A9MUK6 | Probable nicotinate-nucleotide adenylyltransferase | 6.02e-14 | NA | 1.09e-10 | 0.7517 |
| 3. BF | Q818D2 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 1.26e-17 | 0.8829 |
| 3. BF | A4TP00 | Probable nicotinate-nucleotide adenylyltransferase | 3.72e-13 | NA | 2.17e-11 | 0.7458 |
| 3. BF | Q7TYM1 | Probable nicotinate-nucleotide adenylyltransferase | 3.12e-11 | NA | 6.68e-09 | 0.8248 |
| 3. BF | B7KS48 | Probable nicotinate-nucleotide adenylyltransferase | 3.83e-13 | NA | 6.79e-15 | 0.7747 |
| 3. BF | Q8FN90 | Probable nicotinate-nucleotide adenylyltransferase | 1.05e-13 | NA | 2.09e-07 | 0.8613 |
| 3. BF | B5ZUE6 | Probable nicotinate-nucleotide adenylyltransferase | 5.13e-12 | NA | 1.10e-13 | 0.7705 |
| 3. BF | Q8ZDG1 | Probable nicotinate-nucleotide adenylyltransferase | 3.30e-13 | NA | 2.17e-11 | 0.7267 |
| 3. BF | Q83DY4 | Probable nicotinate-nucleotide adenylyltransferase | 9.00e-14 | NA | 1.76e-09 | 0.7697 |
| 3. BF | A5I664 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-15 | NA | 2.81e-16 | 0.7953 |
| 3. BF | A1JPW3 | Probable nicotinate-nucleotide adenylyltransferase | 9.47e-13 | NA | 1.33e-11 | 0.7439 |
| 3. BF | C1ESM6 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 1.80e-17 | 0.8824 |
| 3. BF | Q5HNV3 | Probable nicotinate-nucleotide adenylyltransferase | 3.69e-14 | NA | 1.77e-19 | 0.836 |
| 3. BF | B7HCV9 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 1.26e-17 | 0.8824 |
| 3. BF | B0KAB6 | Probable nicotinate-nucleotide adenylyltransferase | 5.83e-14 | NA | 5.01e-10 | 0.8087 |
| 3. BF | Q1CRS1 | Probable nicotinate-nucleotide adenylyltransferase | 3.35e-13 | NA | 1.52e-20 | 0.8481 |
| 3. BF | B4SH35 | Probable nicotinate-nucleotide adenylyltransferase | 3.35e-11 | NA | 4.54e-10 | 0.8142 |
| 3. BF | Q606Y2 | Probable nicotinate-nucleotide adenylyltransferase | 3.28e-14 | NA | 2.17e-08 | 0.773 |
| 3. BF | Q04Q93 | Probable nicotinate-nucleotide adenylyltransferase | 2.96e-14 | NA | 2.04e-16 | 0.8248 |
| 3. BF | B3QLU8 | Probable nicotinate-nucleotide adenylyltransferase | 1.24e-14 | NA | 4.59e-12 | 0.8408 |
| 3. BF | Q8Y735 | Probable nicotinate-nucleotide adenylyltransferase | 8.78e-14 | NA | 1.78e-15 | 0.8765 |
| 3. BF | B2S1C4 | Probable nicotinate-nucleotide adenylyltransferase | 4.77e-15 | NA | 1.37e-11 | 0.8853 |
| 3. BF | A8Z4D3 | Probable nicotinate-nucleotide adenylyltransferase | 7.84e-14 | NA | 1.69e-20 | 0.8481 |
| 3. BF | P54456 | Uncharacterized protein YqeK | 0.00e+00 | NA | 1.94e-16 | 0.9092 |
| 3. BF | B1JGA8 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-13 | NA | 2.17e-11 | 0.7411 |
| 3. BF | Q3ZAJ1 | Probable nicotinate-nucleotide adenylyltransferase | 6.53e-13 | NA | 6.31e-15 | 0.8298 |
| 3. BF | B8FUR7 | Probable nicotinate-nucleotide adenylyltransferase | 7.49e-14 | NA | 1.35e-09 | 0.8393 |
| 3. BF | A4Y9F2 | Probable nicotinate-nucleotide adenylyltransferase | 1.07e-12 | NA | 4.74e-14 | 0.7631 |
| 3. BF | B3EIJ2 | Probable nicotinate-nucleotide adenylyltransferase | 1.01e-12 | NA | 1.42e-13 | 0.8275 |
| 3. BF | A1R783 | Probable nicotinate-nucleotide adenylyltransferase | 2.97e-12 | NA | 5.52e-07 | 0.8219 |
| 3. BF | A6Q541 | Probable nicotinate-nucleotide adenylyltransferase | 1.02e-14 | NA | 1.97e-24 | 0.8644 |
| 3. BF | Q1D4R3 | Probable nicotinate-nucleotide adenylyltransferase | 3.45e-12 | NA | 1.17e-11 | 0.8022 |
| 3. BF | C4LJU0 | Probable nicotinate-nucleotide adenylyltransferase | 3.57e-13 | NA | 3.76e-08 | 0.8544 |
| 3. BF | Q324Q5 | Probable nicotinate-nucleotide adenylyltransferase | 5.55e-15 | NA | 2.00e-12 | 0.7468 |
| 3. BF | Q747Q5 | Probable nicotinate-nucleotide adenylyltransferase | 1.27e-13 | NA | 8.08e-09 | 0.7589 |
| 3. BF | A6VZ84 | Probable nicotinate-nucleotide adenylyltransferase | 3.87e-13 | NA | 0.001 | 0.7865 |
| 3. BF | Q8NN57 | Probable nicotinate-nucleotide adenylyltransferase | 3.99e-13 | NA | 2.18e-07 | 0.8308 |
| 3. BF | Q5WX01 | Probable nicotinate-nucleotide adenylyltransferase | 1.62e-14 | NA | 4.23e-11 | 0.7934 |
| 3. BF | O66452 | Probable nicotinate-nucleotide adenylyltransferase | 8.57e-14 | NA | 3.47e-18 | 0.8276 |
| 3. BF | B8DE23 | Probable nicotinate-nucleotide adenylyltransferase | 2.68e-14 | NA | 1.16e-14 | 0.8892 |
| 3. BF | P65503 | Probable nicotinate-nucleotide adenylyltransferase | 8.06e-14 | NA | 8.16e-21 | 0.8626 |
| 3. BF | Q2KYV6 | Probable nicotinate-nucleotide adenylyltransferase | 1.32e-07 | NA | 1.79e-21 | 0.7759 |
| 3. BF | Q57B48 | Probable nicotinate-nucleotide adenylyltransferase | 2.14e-12 | NA | 6.34e-11 | 0.7784 |
| 3. BF | Q3MAP9 | Probable nicotinate-nucleotide adenylyltransferase | 8.48e-13 | NA | 1.57e-10 | 0.7847 |
| 3. BF | Q8CY36 | Probable nicotinate-nucleotide adenylyltransferase | 2.20e-12 | NA | 1.73e-11 | 0.7793 |
| 3. BF | Q9PMQ3 | Probable nicotinate-nucleotide adenylyltransferase | 3.19e-07 | NA | 1.27e-21 | 0.8204 |
| 3. BF | A7GHK0 | Probable nicotinate-nucleotide adenylyltransferase | 9.33e-15 | NA | 1.39e-15 | 0.816 |
| 3. BF | A5N6K3 | Probable nicotinate-nucleotide adenylyltransferase | 2.11e-15 | NA | 8.83e-16 | 0.8094 |
| 3. BF | A9W6Q3 | Probable nicotinate-nucleotide adenylyltransferase | 4.37e-13 | NA | 7.35e-15 | 0.7745 |
| 3. BF | A0QDI7 | Probable nicotinate-nucleotide adenylyltransferase | 3.16e-12 | NA | 1.83e-08 | 0.8453 |
| 3. BF | Q89X84 | Probable nicotinate-nucleotide adenylyltransferase | 7.75e-10 | NA | 4.32e-07 | 0.7411 |
| 3. BF | Q32IU2 | Probable nicotinate-nucleotide adenylyltransferase | 5.55e-15 | NA | 2.16e-12 | 0.7572 |
| 3. BF | Q8ZQZ8 | Nicotinate-nucleotide adenylyltransferase | 7.99e-15 | NA | 1.09e-10 | 0.7505 |
| 3. BF | Q8FJZ1 | Nicotinate-nucleotide adenylyltransferase | 4.88e-15 | NA | 6.73e-12 | 0.7569 |
| 3. BF | Q72NR0 | Probable nicotinate-nucleotide adenylyltransferase | 3.89e-14 | NA | 2.77e-15 | 0.8407 |
| 3. BF | A8LR16 | Probable nicotinate-nucleotide adenylyltransferase | 5.70e-11 | NA | 1.94e-13 | 0.7777 |
| 3. BF | B1LA54 | Probable nicotinate-nucleotide adenylyltransferase | 1.24e-08 | NA | 1.79e-12 | 0.8055 |
| 3. BF | A5UVE4 | Probable nicotinate-nucleotide adenylyltransferase | 4.64e-14 | NA | 4.65e-11 | 0.8439 |
| 3. BF | Q66DE6 | Probable nicotinate-nucleotide adenylyltransferase | 2.53e-13 | NA | 2.17e-11 | 0.7448 |
| 3. BF | B7HPN1 | Probable nicotinate-nucleotide adenylyltransferase | 3.33e-16 | NA | 7.57e-18 | 0.8828 |
| 3. BF | Q4FP43 | Probable nicotinate-nucleotide adenylyltransferase | 9.62e-13 | NA | 3.11e-11 | 0.842 |
| 3. BF | B7N9P5 | Probable nicotinate-nucleotide adenylyltransferase | 1.59e-14 | NA | 3.85e-12 | 0.7797 |
| 3. BF | Q02VX0 | Phosphopantetheine adenylyltransferase | 8.90e-06 | NA | 0.044 | 0.6317 |
| 3. BF | A9NFP5 | Probable nicotinate-nucleotide adenylyltransferase | 1.12e-12 | NA | 8.91e-08 | 0.8047 |
| 3. BF | Q9CGJ7 | Probable nicotinate-nucleotide adenylyltransferase | 1.67e-14 | NA | 4.48e-15 | 0.8776 |
| 3. BF | B6YR44 | Probable nicotinate-nucleotide adenylyltransferase | 8.85e-08 | NA | 4.29e-04 | 0.7719 |
| 3. BF | B8J538 | Probable nicotinate-nucleotide adenylyltransferase | 9.47e-13 | NA | 1.51e-11 | 0.8078 |
| 3. BF | Q2YLI8 | Probable nicotinate-nucleotide adenylyltransferase | 1.86e-12 | NA | 6.34e-11 | 0.781 |
| 3. BF | Q2K2X3 | Probable nicotinate-nucleotide adenylyltransferase | 3.10e-12 | NA | 3.52e-13 | 0.7676 |
| 3. BF | B1H028 | Probable nicotinate-nucleotide adenylyltransferase | 2.44e-15 | NA | 4.94e-20 | 0.8689 |
| 3. BF | Q11XI1 | Probable nicotinate-nucleotide adenylyltransferase | 7.98e-14 | NA | 3.87e-17 | 0.8837 |
| 3. BF | A1S8T1 | Probable nicotinate-nucleotide adenylyltransferase | 6.22e-15 | NA | 1.45e-13 | 0.7883 |
| 3. BF | Q5L9N8 | Probable nicotinate-nucleotide adenylyltransferase | 5.87e-08 | NA | 1.15e-08 | 0.8425 |
| 3. BF | Q88WT5 | Probable nicotinate-nucleotide adenylyltransferase | 5.33e-15 | NA | 1.85e-13 | 0.8596 |
| 3. BF | C3P8N9 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 2.85e-17 | 0.8824 |
| 3. BF | Q0HXU7 | Probable nicotinate-nucleotide adenylyltransferase | 1.83e-12 | NA | 2.28e-16 | 0.7455 |
| 3. BF | A7NPC0 | Probable nicotinate-nucleotide adenylyltransferase | 7.77e-15 | NA | 7.32e-12 | 0.8318 |
| 3. BF | B4UJX6 | Probable nicotinate-nucleotide adenylyltransferase | 6.24e-13 | NA | 2.08e-11 | 0.8034 |
| 3. BF | Q730K3 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 9.06e-18 | 0.8827 |
| 3. BF | Q2IKJ8 | Probable nicotinate-nucleotide adenylyltransferase | 7.44e-13 | NA | 3.71e-12 | 0.8139 |
| 3. BF | B7MFR2 | Probable nicotinate-nucleotide adenylyltransferase | 5.55e-15 | NA | 6.73e-12 | 0.7562 |
| 3. BF | C1FVW3 | Probable nicotinate-nucleotide adenylyltransferase | 2.43e-14 | NA | 2.73e-16 | 0.8122 |
| 3. BF | Q8CX46 | Probable nicotinate-nucleotide adenylyltransferase | 2.09e-12 | NA | 2.86e-15 | 0.7578 |
| 3. BF | Q9RDK7 | Probable nicotinate-nucleotide adenylyltransferase | 5.85e-14 | NA | 8.89e-11 | 0.8758 |
| 3. BF | B2I5T8 | Probable nicotinate-nucleotide adenylyltransferase | 2.10e-11 | NA | 0.001 | 0.7293 |
| 3. BF | Q01X27 | Probable nicotinate-nucleotide adenylyltransferase | 1.90e-14 | NA | 2.14e-11 | 0.8189 |
| 3. BF | Q92LB1 | Probable nicotinate-nucleotide adenylyltransferase | 7.95e-13 | NA | 2.99e-13 | 0.7687 |
| 3. BF | Q5X5M1 | Probable nicotinate-nucleotide adenylyltransferase | 1.25e-14 | NA | 9.82e-11 | 0.7827 |
| 3. BF | Q5FRT1 | Probable nicotinate-nucleotide adenylyltransferase | 7.36e-10 | NA | 9.20e-09 | 0.7727 |
| 3. BF | Q39QR1 | Probable nicotinate-nucleotide adenylyltransferase | 5.71e-14 | NA | 3.25e-10 | 0.7499 |
| 3. BF | A1R0K5 | Probable nicotinate-nucleotide adenylyltransferase | 1.15e-14 | NA | 2.90e-11 | 0.8827 |
| 3. BF | A7X2Z9 | Probable nicotinate-nucleotide adenylyltransferase | 8.09e-14 | NA | 8.16e-21 | 0.8625 |
| 3. BF | P65504 | Probable nicotinate-nucleotide adenylyltransferase | 5.55e-16 | NA | 4.75e-14 | 0.8272 |
| 3. BF | Q64PY0 | Probable nicotinate-nucleotide adenylyltransferase | 7.47e-08 | NA | 1.15e-08 | 0.8385 |
| 3. BF | B4RR84 | Probable nicotinate-nucleotide adenylyltransferase | 1.07e-14 | NA | 1.12e-15 | 0.8246 |
| 3. BF | B2TU80 | Probable nicotinate-nucleotide adenylyltransferase | 5.00e-15 | NA | 3.48e-13 | 0.747 |
| 3. BF | B2TKI3 | Probable nicotinate-nucleotide adenylyltransferase | 1.70e-14 | NA | 3.50e-13 | 0.8245 |
| 3. BF | B6I150 | Probable nicotinate-nucleotide adenylyltransferase | 2.89e-15 | NA | 2.27e-12 | 0.7481 |
| 3. BF | B7J9S1 | Probable nicotinate-nucleotide adenylyltransferase | 3.88e-13 | NA | 4.76e-10 | 0.7717 |
| 3. BF | A0RQT6 | Probable nicotinate-nucleotide adenylyltransferase | 1.01e-07 | NA | 9.37e-25 | 0.8667 |
| 3. BF | C1DA26 | Probable nicotinate-nucleotide adenylyltransferase | 5.62e-12 | NA | 9.28e-12 | 0.7526 |
| 3. BF | Q1GEC6 | Probable nicotinate-nucleotide adenylyltransferase | 1.53e-10 | NA | 2.20e-15 | 0.7566 |
| 3. BF | P0DC63 | Probable nicotinate-nucleotide adenylyltransferase | 5.55e-16 | NA | 5.17e-14 | 0.8886 |
| 3. BF | O25895 | Probable nicotinate-nucleotide adenylyltransferase | 1.99e-13 | NA | 1.00e-20 | 0.8564 |
| 3. BF | Q5XDT7 | Probable nicotinate-nucleotide adenylyltransferase | 8.88e-16 | NA | 2.40e-13 | 0.8798 |
| 3. BF | Q3Z4F3 | Probable nicotinate-nucleotide adenylyltransferase | 5.22e-15 | NA | 2.27e-12 | 0.7827 |
| 3. BF | B1IYG9 | Probable nicotinate-nucleotide adenylyltransferase | 1.30e-13 | NA | 2.27e-12 | 0.7764 |
| 3. BF | P65505 | Probable nicotinate-nucleotide adenylyltransferase | 6.66e-16 | NA | 4.75e-14 | 0.8801 |
| 3. BF | B5BCE9 | Probable nicotinate-nucleotide adenylyltransferase | 9.43e-14 | NA | 1.09e-10 | 0.7527 |
| 3. BF | Q8KGF2 | Probable nicotinate-nucleotide adenylyltransferase | 2.67e-13 | NA | 5.92e-08 | 0.8141 |
| 3. BF | A7ZJ28 | Probable nicotinate-nucleotide adenylyltransferase | 9.73e-14 | NA | 2.27e-12 | 0.778 |
| 3. BF | A4F9M5 | Probable nicotinate-nucleotide adenylyltransferase | 2.42e-12 | NA | 3.01e-08 | 0.8572 |
| 3. BF | B8D7X6 | Probable nicotinate-nucleotide adenylyltransferase | 6.84e-13 | NA | 6.33e-12 | 0.7674 |
| 3. BF | Q8RBA4 | Probable nicotinate-nucleotide adenylyltransferase | 1.76e-13 | NA | 1.43e-09 | 0.8344 |
| 3. BF | A6U266 | Probable nicotinate-nucleotide adenylyltransferase | 8.32e-14 | NA | 8.16e-21 | 0.8624 |
| 3. BF | Q8EPV1 | Probable nicotinate-nucleotide adenylyltransferase | 1.22e-15 | NA | 9.01e-18 | 0.887 |
| 3. BF | A0R112 | Probable nicotinate-nucleotide adenylyltransferase | 1.75e-13 | NA | 1.18e-08 | 0.811 |
| 3. BF | A8FN79 | Probable nicotinate-nucleotide adenylyltransferase | 3.25e-07 | NA | 4.36e-21 | 0.854 |
| 3. BF | A4T2H9 | Probable nicotinate-nucleotide adenylyltransferase | 8.24e-13 | NA | 2.49e-07 | 0.8068 |
| 3. BF | Q16AV3 | Probable nicotinate-nucleotide adenylyltransferase | 1.10e-10 | NA | 1.34e-13 | 0.7605 |
| 3. BF | A1SU57 | Probable nicotinate-nucleotide adenylyltransferase | 2.74e-12 | NA | 9.57e-14 | 0.7732 |
| 3. BF | Q3ANY3 | Probable nicotinate-nucleotide adenylyltransferase | 2.11e-12 | NA | 1.06e-12 | 0.8086 |
| 3. BF | A7HJZ9 | Probable nicotinate-nucleotide adenylyltransferase | 2.34e-06 | NA | 1.03e-04 | 0.7693 |
| 3. BF | Q5WHI0 | Probable nicotinate-nucleotide adenylyltransferase | 1.91e-14 | NA | 1.69e-19 | 0.8618 |
| 3. BF | A9ITN0 | Probable nicotinate-nucleotide adenylyltransferase | 1.73e-07 | NA | 7.80e-13 | 0.7965 |
| 3. BF | A6L8D1 | Probable nicotinate-nucleotide adenylyltransferase | 1.31e-10 | NA | 1.33e-10 | 0.7783 |
| 3. BF | Q634L0 | Probable nicotinate-nucleotide adenylyltransferase | 2.22e-16 | NA | 1.80e-17 | 0.8827 |
| 3. BF | A1SHP7 | Probable nicotinate-nucleotide adenylyltransferase | 7.58e-14 | NA | 9.61e-06 | 0.8254 |
| 3. BF | B3DVR2 | Probable nicotinate-nucleotide adenylyltransferase | 8.92e-13 | NA | 1.73e-19 | 0.8107 |
| 3. BF | Q7WL81 | Probable nicotinate-nucleotide adenylyltransferase | 1.75e-07 | NA | 1.09e-18 | 0.7961 |
| 3. BF | Q3A1E1 | Probable nicotinate-nucleotide adenylyltransferase | 1.65e-12 | NA | 1.35e-09 | 0.7504 |
| 3. BF | Q3B146 | Probable nicotinate-nucleotide adenylyltransferase | 3.11e-13 | NA | 5.73e-14 | 0.8353 |
| 3. BF | B3QYZ5 | Probable nicotinate-nucleotide adenylyltransferase | 1.59e-12 | NA | 1.17e-12 | 0.7903 |
| 3. BF | Q2N6F4 | Probable nicotinate-nucleotide adenylyltransferase | 3.59e-08 | NA | 1.14e-08 | 0.7597 |
| 3. BF | A1BJW0 | Probable nicotinate-nucleotide adenylyltransferase | 1.04e-12 | NA | 2.58e-09 | 0.8036 |
| 3. BF | A5CR36 | Probable nicotinate-nucleotide adenylyltransferase | 7.88e-15 | NA | 1.41e-12 | 0.8792 |
| 3. BF | B5QVP6 | Probable nicotinate-nucleotide adenylyltransferase | 7.33e-15 | NA | 6.40e-11 | 0.7587 |
| 5. P | Q55928 | Bifunctional NMN adenylyltransferase/Nudix hydrolase | 5.11e-03 | 4.10e-04 | NA | NA |
| 5. P | Q6L171 | tRNA (cytidine(56)-2'-O)-methyltransferase | 4.90e-04 | 6.37e-07 | NA | NA |
| 5. P | Q9HJN6 | tRNA (cytidine(56)-2'-O)-methyltransferase | 2.04e-04 | 3.22e-05 | NA | NA |
| 6. F | P44805 | Phosphopantetheine adenylyltransferase | 2.20e-04 | NA | NA | 0.6588 |
| 6. F | Q0A592 | Phosphopantetheine adenylyltransferase | 1.67e-06 | NA | NA | 0.66 |
| 6. F | A8G4U2 | Phosphopantetheine adenylyltransferase | 3.83e-06 | NA | NA | 0.6197 |
| 6. F | B9DUX7 | Phosphopantetheine adenylyltransferase | 5.54e-06 | NA | NA | 0.6358 |
| 6. F | Q2YPY4 | Phosphopantetheine adenylyltransferase | 8.32e-06 | NA | NA | 0.5994 |
| 6. F | Q831P9 | Phosphopantetheine adenylyltransferase | 2.55e-06 | NA | NA | 0.6463 |
| 6. F | A6U0U2 | Phosphopantetheine adenylyltransferase | 1.34e-06 | NA | NA | 0.6613 |
| 6. F | A5CX55 | Phosphopantetheine adenylyltransferase | 2.15e-06 | NA | NA | 0.7296 |
| 6. F | B5ZPR5 | Phosphopantetheine adenylyltransferase | 6.83e-06 | NA | NA | 0.5445 |
| 6. F | B5XMB5 | Phosphopantetheine adenylyltransferase | 2.35e-06 | NA | NA | 0.6528 |
| 6. F | Q8DJQ7 | Phosphopantetheine adenylyltransferase | 4.46e-06 | NA | NA | 0.5661 |
| 6. F | B8ZNX4 | Phosphopantetheine adenylyltransferase | 7.79e-06 | NA | NA | 0.7118 |
| 6. F | A7X140 | Phosphopantetheine adenylyltransferase | 1.38e-06 | NA | NA | 0.6573 |
| 6. F | A5EJR7 | Phosphopantetheine adenylyltransferase | 1.12e-05 | NA | NA | 0.5719 |
| 6. F | A2BR50 | Phosphopantetheine adenylyltransferase | 3.37e-06 | NA | NA | 0.6283 |
| 6. F | Q137B2 | Phosphopantetheine adenylyltransferase | 1.06e-05 | NA | NA | 0.5762 |
| 6. F | B7GN19 | Phosphopantetheine adenylyltransferase | 2.14e-04 | NA | NA | 0.6094 |
| 6. F | C1CTM3 | Phosphopantetheine adenylyltransferase | 6.33e-06 | NA | NA | 0.7105 |
| 6. F | Q31AW9 | Phosphopantetheine adenylyltransferase | 3.89e-06 | NA | NA | 0.6237 |
| 6. F | Q8E1A6 | Phosphopantetheine adenylyltransferase | 3.47e-06 | NA | NA | 0.5817 |
| 6. F | Q8CSZ5 | Phosphopantetheine adenylyltransferase | 2.40e-06 | NA | NA | 0.6827 |
| 6. F | Q3AC43 | Phosphopantetheine adenylyltransferase | 5.21e-06 | NA | NA | 0.6803 |
| 6. F | Q2IW34 | Phosphopantetheine adenylyltransferase | 1.07e-05 | NA | NA | 0.5835 |
| 6. F | Q49WP9 | Phosphopantetheine adenylyltransferase | 1.95e-06 | NA | NA | 0.6801 |
| 6. F | Q8E6R1 | Phosphopantetheine adenylyltransferase | 3.33e-06 | NA | NA | 0.6109 |
| 6. F | Q1MGM6 | Phosphopantetheine adenylyltransferase | 5.49e-06 | NA | NA | 0.5625 |
| 6. F | B0S9J5 | Phosphopantetheine adenylyltransferase | 2.33e-06 | NA | NA | 0.6736 |
| 6. F | Q97NQ2 | Phosphopantetheine adenylyltransferase | 7.28e-06 | NA | NA | 0.7131 |
| 6. F | P0DA43 | Phosphopantetheine adenylyltransferase | 2.52e-06 | NA | NA | 0.6522 |
| 6. F | Q2J6Y5 | Phosphopantetheine adenylyltransferase | 6.81e-06 | NA | NA | 0.6042 |
| 6. F | Q1JFZ7 | Phosphopantetheine adenylyltransferase | 2.57e-06 | NA | NA | 0.6519 |
| 6. F | Q7MX47 | Phosphopantetheine adenylyltransferase | 1.11e-05 | NA | NA | 0.6658 |
| 6. F | Q4L5D8 | Phosphopantetheine adenylyltransferase | 1.72e-06 | NA | NA | 0.6599 |
| 6. F | Q7V7L9 | Phosphopantetheine adenylyltransferase | 3.48e-06 | NA | NA | 0.6369 |
| 6. F | Q3K2R6 | Phosphopantetheine adenylyltransferase | 3.30e-06 | NA | NA | 0.5836 |
| 6. F | A1R0C7 | Phosphopantetheine adenylyltransferase | 4.10e-06 | NA | NA | 0.5882 |
| 6. F | A8Z1Q8 | Phosphopantetheine adenylyltransferase | 1.31e-06 | NA | NA | 0.662 |
| 6. F | B2RL67 | Phosphopantetheine adenylyltransferase | 1.11e-05 | NA | NA | 0.6393 |
| 6. F | Q7NMB9 | Phosphopantetheine adenylyltransferase | 2.80e-06 | NA | NA | 0.6953 |
| 6. F | Q98M51 | Phosphopantetheine adenylyltransferase | 3.53e-03 | NA | NA | 0.6216 |
| 6. F | P63814 | Phosphopantetheine adenylyltransferase | 3.65e-06 | NA | NA | 0.6039 |
| 6. F | Q3SRN1 | Phosphopantetheine adenylyltransferase | 1.47e-05 | NA | NA | 0.5909 |
| 6. F | A3PCX3 | Phosphopantetheine adenylyltransferase | 2.97e-06 | NA | NA | 0.6277 |
| 6. F | P63818 | Phosphopantetheine adenylyltransferase | 1.35e-06 | NA | NA | 0.6579 |
| 6. F | B8IK26 | Phosphopantetheine adenylyltransferase | 1.41e-05 | NA | NA | 0.5426 |
| 6. F | Q11IH7 | Phosphopantetheine adenylyltransferase | 6.41e-06 | NA | NA | 0.6235 |
| 6. F | P63816 | Phosphopantetheine adenylyltransferase | 1.86e-04 | NA | NA | 0.6043 |
| 6. F | B2IHR4 | Phosphopantetheine adenylyltransferase | 9.41e-06 | NA | NA | 0.5717 |
| 6. F | A2C247 | Phosphopantetheine adenylyltransferase | 2.71e-06 | NA | NA | 0.6453 |
| 6. F | Q5HQ42 | Phosphopantetheine adenylyltransferase | 2.36e-06 | NA | NA | 0.6835 |
| 6. F | P44308 | Bifunctional NAD biosynthesis protein NadR | 3.86e-03 | NA | NA | 0.3307 |
| 6. F | P63820 | Phosphopantetheine adenylyltransferase | 1.40e-06 | NA | NA | 0.6564 |
| 6. F | Q6GHW1 | Phosphopantetheine adenylyltransferase | 1.48e-06 | NA | NA | 0.6622 |
| 6. F | Q73MY1 | Phosphopantetheine adenylyltransferase | 4.38e-06 | NA | NA | 0.6073 |
| 6. F | B2IM47 | Phosphopantetheine adenylyltransferase | 6.87e-06 | NA | NA | 0.7152 |
| 6. F | C1CGQ1 | Phosphopantetheine adenylyltransferase | 6.41e-06 | NA | NA | 0.7117 |
| 6. F | A7FW59 | Phosphopantetheine adenylyltransferase | 9.68e-05 | NA | NA | 0.6313 |
| 6. F | P63821 | Phosphopantetheine adenylyltransferase | 2.54e-06 | NA | NA | 0.653 |
| 6. F | A5VQM2 | Phosphopantetheine adenylyltransferase | 6.61e-06 | NA | NA | 0.6143 |
| 6. F | B2GBB0 | Phosphopantetheine adenylyltransferase | 1.15e-04 | NA | NA | 0.631 |
| 6. F | A6QFX8 | Phosphopantetheine adenylyltransferase | 1.47e-06 | NA | NA | 0.662 |
| 6. F | B4U1S8 | Phosphopantetheine adenylyltransferase | 1.83e-06 | NA | NA | 0.6414 |
| 6. F | A1WZG0 | Phosphopantetheine adenylyltransferase | 3.62e-06 | NA | NA | 0.6891 |
| 6. F | Q04IK0 | Phosphopantetheine adenylyltransferase | 6.97e-06 | NA | NA | 0.7139 |
| 6. F | Q0IAF3 | Phosphopantetheine adenylyltransferase | 5.82e-06 | NA | NA | 0.6193 |
| 6. F | A7HXM4 | Phosphopantetheine adenylyltransferase | 2.79e-04 | NA | NA | 0.5538 |
| 6. F | Q1QMG7 | Phosphopantetheine adenylyltransferase | 1.29e-05 | NA | NA | 0.5956 |
| 6. F | A5IS11 | Phosphopantetheine adenylyltransferase | 1.39e-06 | NA | NA | 0.6576 |
| 6. F | A0M4U6 | Phosphopantetheine adenylyltransferase | 8.62e-06 | NA | NA | 0.6254 |
| 6. F | A1WBK4 | Phosphopantetheine adenylyltransferase | 4.69e-06 | NA | NA | 0.6717 |
| 6. F | C0RJ68 | Phosphopantetheine adenylyltransferase | 8.10e-06 | NA | NA | 0.5997 |
| 6. F | A2RDJ7 | Phosphopantetheine adenylyltransferase | 2.42e-06 | NA | NA | 0.6539 |
| 6. F | B8EIU8 | Phosphopantetheine adenylyltransferase | 6.69e-06 | NA | NA | 0.5909 |
| 6. F | C1CMR5 | Phosphopantetheine adenylyltransferase | 6.56e-06 | NA | NA | 0.6877 |
| 6. F | Q07MY1 | Phosphopantetheine adenylyltransferase | 1.17e-05 | NA | NA | 0.5965 |
| 6. F | Q214P8 | Phosphopantetheine adenylyltransferase | 1.14e-05 | NA | NA | 0.6012 |
| 6. F | B5FFG3 | Phosphopantetheine adenylyltransferase | 1.97e-06 | NA | NA | 0.6847 |
| 6. F | B1LVR4 | Phosphopantetheine adenylyltransferase | 1.13e-05 | NA | NA | 0.5547 |
| 6. F | Q1J5R2 | Phosphopantetheine adenylyltransferase | 2.51e-06 | NA | NA | 0.6512 |
| 6. F | B1I8S2 | Phosphopantetheine adenylyltransferase | 6.76e-06 | NA | NA | 0.7097 |
| 6. F | A0LV90 | Phosphopantetheine adenylyltransferase | 3.96e-06 | NA | NA | 0.6023 |
| 6. F | Q2FHV6 | Phosphopantetheine adenylyltransferase | 1.27e-06 | NA | NA | 0.6614 |
| 6. F | Q8DNE6 | Phosphopantetheine adenylyltransferase | 6.09e-06 | NA | NA | 0.7012 |
| 6. F | Q7U6T8 | Phosphopantetheine adenylyltransferase | 3.90e-06 | NA | NA | 0.5695 |
| 6. F | Q0RDM7 | Phosphopantetheine adenylyltransferase | 5.17e-06 | NA | NA | 0.6078 |
| 6. F | P63819 | Phosphopantetheine adenylyltransferase | 1.42e-06 | NA | NA | 0.6405 |
| 6. F | A2C9T2 | Phosphopantetheine adenylyltransferase | 3.44e-06 | NA | NA | 0.6369 |
| 6. F | Q6GA90 | Phosphopantetheine adenylyltransferase | 1.41e-06 | NA | NA | 0.6575 |
| 6. F | B9DPV4 | Phosphopantetheine adenylyltransferase | 2.06e-06 | NA | NA | 0.6928 |
| 6. F | A6X0Z2 | Phosphopantetheine adenylyltransferase | 7.11e-06 | NA | NA | 0.5994 |
| 6. F | B2SHB2 | Phosphopantetheine adenylyltransferase | 5.87e-05 | NA | NA | 0.6886 |
| 6. F | Q8DVH2 | Phosphopantetheine adenylyltransferase | 5.23e-06 | NA | NA | 0.6387 |
| 6. F | B5E2G0 | Phosphopantetheine adenylyltransferase | 6.46e-06 | NA | NA | 0.7113 |
| 6. F | Q1JAS0 | Phosphopantetheine adenylyltransferase | 2.46e-06 | NA | NA | 0.6522 |
| 6. F | A4YV23 | Phosphopantetheine adenylyltransferase | 1.50e-05 | NA | NA | 0.5819 |
| 6. F | A5UE83 | Phosphopantetheine adenylyltransferase | 2.03e-04 | NA | NA | 0.6664 |
| 6. F | C1CY24 | Phosphopantetheine adenylyltransferase | 1.50e-06 | NA | NA | 0.5661 |
| 6. F | C1CA14 | Phosphopantetheine adenylyltransferase | 5.16e-06 | NA | NA | 0.7204 |
| 6. F | B2S5U8 | Phosphopantetheine adenylyltransferase | 3.76e-06 | NA | NA | 0.6051 |
| 6. F | C0MBZ1 | Phosphopantetheine adenylyltransferase | 1.84e-06 | NA | NA | 0.6931 |
| 6. F | Q9RWM4 | Phosphopantetheine adenylyltransferase | 2.66e-06 | NA | NA | 0.5999 |
| 6. F | Q5HGV9 | Phosphopantetheine adenylyltransferase | 1.25e-06 | NA | NA | 0.6565 |
| 6. F | B0UP59 | Phosphopantetheine adenylyltransferase | 1.51e-05 | NA | NA | 0.5604 |
| 7. B | B8FTK5 | Phosphopantetheine adenylyltransferase | 1.32e-06 | NA | 0.005 | NA |
| 7. B | P0A752 | Nicotinate-nucleotide adenylyltransferase | 4.77e-15 | NA | 2.27e-12 | NA |
| 7. B | Q04731 | Uncharacterized protein in pepC 5'region (Fragment) | 1.54e-07 | NA | 5.60e-06 | NA |
| 7. B | Q24XZ0 | Phosphopantetheine adenylyltransferase | 1.33e-06 | NA | 0.006 | NA |
| 7. B | Q98RB3 | Phosphopantetheine adenylyltransferase | 3.60e-05 | NA | 0.022 | NA |
| 7. B | A0Q101 | Phosphopantetheine adenylyltransferase | 5.70e-06 | NA | 0.013 | NA |
| 7. B | B1I2E4 | Phosphopantetheine adenylyltransferase | 3.08e-06 | NA | 0.002 | NA |
| 7. B | P9WJJ5 | Probable nicotinate-nucleotide adenylyltransferase | 1.63e-11 | NA | 6.43e-09 | NA |
| 7. B | Q2FXY3 | Probable nicotinate-nucleotide adenylyltransferase | 5.40e-14 | NA | 1.69e-20 | NA |
| 7. B | Q1GB50 | Ribonuclease Y | 7.08e-02 | NA | 0.022 | NA |
| 7. B | Q04BJ7 | Ribonuclease Y | 5.90e-02 | NA | 0.022 | NA |
| 7. B | A2RNW2 | Phosphopantetheine adenylyltransferase | 6.67e-06 | NA | 0.046 | NA |