Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54753.1
JCVISYN3A_0381
5'-Methylthioadenosine nucleosidase.
M. mycoides homolog: Q6MTG5.
TIGRfam Classification: 5=Equivalog.
Category: Nonessential.
Statistics
Total GO Annotation: 72
Unique PROST Go: 40
Unique BLAST Go: 0
Unique Foldseek Go: 3
Total Homologs: 682
Unique PROST Homologs: 164
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 31
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
C4K6C1
(5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase) with a FATCAT P-Value: 0 and RMSD of 1.81 angstrom. The sequence alignment identity is 31.5%.
Structural alignment shown in left. Query protein AVX54753.1 colored as red in alignment, homolog C4K6C1 colored as blue.
Query protein AVX54753.1 is also shown in right top, homolog C4K6C1 showed in right bottom. They are colored based on secondary structures.
AVX54753.1 MKL-IISAMYEELAYTL--KKTNAQLIIDNDILKLYQ-Y---QNILLAISKIGLVNASCCL--SYILNHYQIDQILNIGTCCSLNQEYKQNDIVIVNKAY 91 C4K6C1 MKVGIIGAMKEEV--TLLCQKIQSCQTLTRAGCSIYSGFLGETNVVLLQSGIG--KTSAALGTTLLLEYFQPDILINTGSAAGLWPDLKIGDIVISTEVR 96 AVX54753.1 YFSVDVTGFSYSYGQI---PKLPKYF----L-------ANNFLNL-SLDYKICNIASGDVFINKSEHLTQFINKINDKIDIVDMEACSLFHVAYLYKRPI 176 C4K6C1 YHDVNVTAFGYEWGQMALCP--PAFFADKKLIEIVLECVKN-LNLNAVQGLIC---SGDAFINGDQALDR-IRTFFPKAVAVEMEAAAIAQVCHQFETPF 189 AVX54753.1 SSIKVISDVMFVSD-SNMLQFDQFI----NKASKKIYQ---ILNDLYFKID 219 C4K6C1 VVIRAISD---VADQASHLSFEQFLCIAAQRSSTVIENMLPILAETYCSIN 237
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0102246 | 6-amino-6-deoxyfutalosine hydrolase activity |
| 1. PBF | GO:0019284 | L-methionine salvage from S-adenosylmethionine |
| 1. PBF | GO:0019509 | L-methionine salvage from methylthioadenosine |
| 1. PBF | GO:0009164 | nucleoside catabolic process |
| 1. PBF | GO:0004731 | purine-nucleoside phosphorylase activity |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0009234 | menaquinone biosynthetic process |
| 1. PBF | GO:0006139 | nucleobase-containing compound metabolic process |
| 1. PBF | GO:0008930 | methylthioadenosine nucleosidase activity |
| 1. PBF | GO:0042278 | purine nucleoside metabolic process |
| 1. PBF | GO:0046124 | purine deoxyribonucleoside catabolic process |
| 1. PBF | GO:0008782 | adenosylhomocysteine nucleosidase activity |
| 2. PF | GO:0009116 | nucleoside metabolic process |
| 2. PF | GO:0006166 | purine ribonucleoside salvage |
| 2. PF | GO:0047975 | guanosine phosphorylase activity |
| 2. PF | GO:0006148 | inosine catabolic process |
| 2. PF | GO:0004850 | uridine phosphorylase activity |
| 2. PF | GO:0005829 | cytosol |
| 2. PF | GO:0017061 | S-methyl-5-thioadenosine phosphorylase activity |
| 2. PF | GO:0009166 | nucleotide catabolic process |
| 2. PF | GO:0006537 | glutamate biosynthetic process |
| 2. PF | GO:0016799 | hydrolase activity, hydrolyzing N-glycosyl compounds |
| 2. PF | GO:0006195 | purine nucleotide catabolic process |
| 2. PF | GO:0044206 | UMP salvage |
| 2. PF | GO:0003824 | catalytic activity |
| 2. PF | GO:0006218 | uridine catabolic process |
| 4. PB | GO:0110052 | toxic metabolite repair |
| 4. PB | GO:0005886 | plasma membrane |
| 4. PB | GO:0010087 | phloem or xylem histogenesis |
| 5. P | GO:0019686 | purine nucleoside interconversion |
| 5. P | GO:0034418 | urate biosynthetic process |
| 5. P | GO:0034356 | NAD biosynthesis via nicotinamide riboside salvage pathway |
| 5. P | GO:0046059 | dAMP catabolic process |
| 5. P | GO:0046055 | dGMP catabolic process |
| 5. P | GO:0032743 | positive regulation of interleukin-2 production |
| 5. P | GO:0046115 | guanosine catabolic process |
| 5. P | GO:0000003 | reproduction |
| 5. P | GO:0000255 | allantoin metabolic process |
| 5. P | GO:0006204 | IMP catabolic process |
| 5. P | GO:0046070 | dGTP metabolic process |
| 5. P | GO:0002060 | purine nucleobase binding |
| 5. P | GO:0009165 | nucleotide biosynthetic process |
| 5. P | GO:0046038 | GMP catabolic process |
| 5. P | GO:0006152 | purine nucleoside catabolic process |
| 5. P | GO:0042102 | positive regulation of T cell proliferation |
| 5. P | GO:0047847 | deoxyuridine phosphorylase activity |
| 5. P | GO:0006157 | deoxyadenosine catabolic process |
| 5. P | GO:0005524 | ATP binding |
| 5. P | GO:0015860 | purine nucleoside transmembrane transport |
| 5. P | GO:0015858 | nucleoside transport |
| 5. P | GO:0046638 | positive regulation of alpha-beta T cell differentiation |
| 5. P | GO:0043101 | purine-containing compound salvage |
| 5. P | GO:0001882 | nucleoside binding |
| 5. P | GO:0006738 | nicotinamide riboside catabolic process |
| 5. P | GO:0006149 | deoxyinosine catabolic process |
| 5. P | GO:0016021 | integral component of membrane |
| 5. P | GO:0046108 | uridine metabolic process |
| 5. P | GO:1903228 | xanthosine catabolic process |
| 5. P | GO:0055086 | nucleobase-containing small molecule metabolic process |
| 5. P | GO:0015506 | nucleoside:proton symporter activity |
| 5. P | GO:0070635 | nicotinamide riboside hydrolase activity |
| 5. P | GO:0019860 | uracil metabolic process |
| 5. P | GO:0042301 | phosphate ion binding |
| 5. P | GO:0047724 | inosine nucleosidase activity |
| 5. P | GO:0016920 | pyroglutamyl-peptidase activity |
| 5. P | GO:0006161 | deoxyguanosine catabolic process |
| 5. P | GO:0019358 | nicotinate nucleotide salvage |
| 5. P | GO:0019428 | allantoin biosynthetic process |
| 5. P | GO:0006508 | proteolysis |
| 6. F | GO:0004045 | aminoacyl-tRNA hydrolase activity |
| 6. F | GO:0005576 | extracellular region |
| 6. F | GO:0008714 | AMP nucleosidase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0009116 | nucleoside metabolic process |
| GO:0019509 | L-methionine salvage from methylthioadenosine |
| GO:0016798 | hydrolase activity, acting on glycosyl bonds |
| GO:0008652 | cellular amino acid biosynthetic process |
| GO:0003824 | catalytic activity |
| GO:0008152 | metabolic process |
| GO:0008930 | methylthioadenosine nucleosidase activity |
| GO:0016787 | hydrolase activity |
| GO:0009086 | methionine biosynthetic process |
| GO:0009164 | nucleoside catabolic process |
| GO:0008782 | adenosylhomocysteine nucleosidase activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | C4K6C1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.52e-34 | 8.07e-18 | 0.843 |
| 1. PBF | C4LAY8 | Purine nucleoside phosphorylase DeoD-type | 6.82e-13 | 3.03e-18 | 0.003 | 0.708 |
| 1. PBF | A9VLN1 | Purine nucleoside phosphorylase DeoD-type | 3.65e-13 | 2.45e-24 | 0.001 | 0.6736 |
| 1. PBF | Q483Q8 | Purine nucleoside phosphorylase DeoD-type | 6.18e-13 | 1.51e-21 | 0.033 | 0.684 |
| 1. PBF | A6WKN2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.03e-33 | 1.25e-11 | 0.8863 |
| 1. PBF | Q1CLU1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.28e-30 | 8.74e-21 | 0.8737 |
| 1. PBF | C3L5Y0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.8673 |
| 1. PBF | Q6LUH1 | Purine nucleoside phosphorylase DeoD-type 1 | 1.01e-12 | 1.99e-20 | 0.013 | 0.6845 |
| 1. PBF | B7LGM1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8836 |
| 1. PBF | B9IVI6 | Purine nucleoside phosphorylase DeoD-type | 3.70e-13 | 2.45e-24 | 0.001 | 0.738 |
| 1. PBF | B6HZD5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8858 |
| 1. PBF | Q9KPM0 | Purine nucleoside phosphorylase DeoD-type 1 | 4.42e-13 | 6.34e-21 | 0.046 | 0.6826 |
| 1. PBF | A3D7J1 | Purine nucleoside phosphorylase DeoD-type | 1.72e-09 | 1.66e-20 | 0.004 | 0.6854 |
| 1. PBF | B8D7B4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.73e-42 | 1.62e-17 | 0.8152 |
| 1. PBF | C3P964 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.867 |
| 1. PBF | Q1RG29 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.884 |
| 1. PBF | Q89AQ7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.07e-37 | 3.52e-20 | 0.8445 |
| 1. PBF | Q6HDF1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.44e-33 | 9.91e-17 | 0.8706 |
| 1. PBF | B7M1A0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8933 |
| 1. PBF | B8CQP2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 6.12e-29 | 5.35e-10 | 0.8522 |
| 1. PBF | A0KIZ1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.15e-32 | 1.20e-16 | 0.8912 |
| 1. PBF | Q73B32 | Purine nucleoside phosphorylase DeoD-type | 3.68e-13 | 2.45e-24 | 0.001 | 0.738 |
| 1. PBF | Q0HSG5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.28e-34 | 2.29e-11 | 0.8762 |
| 1. PBF | B7UIK6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.884 |
| 1. PBF | Q2YT29 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.90e-37 | 5.09e-20 | 0.8932 |
| 1. PBF | Q0I1K5 | Purine nucleoside phosphorylase DeoD-type | 1.33e-13 | 8.73e-24 | 0.002 | 0.6853 |
| 1. PBF | Q92BL9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 6.52e-33 | 2.20e-18 | 0.8718 |
| 1. PBF | C4L559 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.23e-27 | 3.36e-20 | 0.8516 |
| 1. PBF | P0AF14 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8863 |
| 1. PBF | B0TIS5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.01e-29 | 6.87e-12 | 0.8558 |
| 1. PBF | B0URX4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.40e-30 | 1.18e-16 | 0.8598 |
| 1. PBF | A4Y4H9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 9.25e-29 | 5.58e-12 | 0.8755 |
| 1. PBF | B1HUJ1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.00e-34 | 3.63e-14 | 0.8486 |
| 1. PBF | B2K553 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.29e-31 | 1.71e-20 | 0.8564 |
| 1. PBF | Q7A0R5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8923 |
| 1. PBF | Q0TLH2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8836 |
| 1. PBF | C6BU87 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.57e-32 | 2.74e-16 | 0.871 |
| 1. PBF | B5R3H1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.55e-33 | 3.13e-24 | 0.8615 |
| 1. PBF | A9MPK2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.18e-32 | 2.84e-24 | 0.8612 |
| 1. PBF | Q5HFG2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.891 |
| 1. PBF | Q87SE5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.56e-32 | 2.17e-14 | 0.8343 |
| 1. PBF | B8EBS7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.29e-33 | 7.12e-12 | 0.878 |
| 1. PBF | Q1CS88 | Purine nucleoside phosphorylase DeoD-type | 2.91e-13 | 6.73e-23 | 0.009 | 0.7044 |
| 1. PBF | B5Y1L0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.92e-34 | 1.53e-24 | 0.8633 |
| 1. PBF | Q49Y40 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.91e-36 | 3.70e-14 | 0.8863 |
| 1. PBF | A7MXP2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.58e-33 | 2.99e-15 | 0.8539 |
| 1. PBF | Q9KNB2 | Purine nucleoside phosphorylase DeoD-type 2 | 2.64e-13 | 7.59e-21 | 0.021 | 0.6796 |
| 1. PBF | B3H2N4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.58e-33 | 6.60e-14 | 0.8434 |
| 1. PBF | A7ZHQ1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8841 |
| 1. PBF | B2UUU1 | Purine nucleoside phosphorylase DeoD-type | 2.82e-13 | 6.62e-23 | 0.017 | 0.7049 |
| 1. PBF | Q02ZT0 | Purine nucleoside phosphorylase DeoD-type | 6.10e-13 | 5.94e-22 | 9.21e-05 | 0.671 |
| 1. PBF | Q81T09 | Purine nucleoside phosphorylase DeoD-type | 3.59e-13 | 2.45e-24 | 0.001 | 0.7022 |
| 1. PBF | A4IR66 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.62e-34 | 3.00e-22 | 0.8688 |
| 1. PBF | Q8D3Z2 | Purine nucleoside phosphorylase DeoD-type 2 | 2.51e-13 | 6.66e-21 | 0.025 | 0.6987 |
| 1. PBF | P0AF13 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8779 |
| 1. PBF | Q6HL92 | Purine nucleoside phosphorylase DeoD-type | 3.65e-13 | 2.45e-24 | 0.001 | 0.7381 |
| 1. PBF | Q5HNU8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.33e-38 | 3.14e-23 | 0.8649 |
| 1. PBF | Q0HG72 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.09e-34 | 3.41e-11 | 0.8905 |
| 1. PBF | B8F704 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.87e-32 | 6.24e-19 | 0.8449 |
| 1. PBF | Q3Z5J8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8869 |
| 1. PBF | B1IQI1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8803 |
| 1. PBF | P57306 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.43e-42 | 2.12e-17 | 0.8484 |
| 1. PBF | A4TPX2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.28e-30 | 8.74e-21 | 0.864 |
| 1. PBF | A7FM04 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.29e-31 | 1.71e-20 | 0.8499 |
| 1. PBF | A4SP53 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.92e-32 | 8.79e-17 | 0.8966 |
| 1. PBF | A9L5L1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.29e-33 | 7.12e-12 | 0.8781 |
| 1. PBF | B7NIC2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8836 |
| 1. PBF | Q8R973 | Purine nucleoside phosphorylase DeoD-type | 4.06e-13 | 7.34e-20 | 2.61e-04 | 0.7243 |
| 1. PBF | P57606 | Purine nucleoside phosphorylase DeoD-type | 2.96e-13 | 2.92e-24 | 0.004 | 0.6776 |
| 1. PBF | Q730G0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.867 |
| 1. PBF | A6QHE1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8906 |
| 1. PBF | A6U271 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.891 |
| 1. PBF | Q6GGA2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.40e-37 | 5.95e-20 | 0.893 |
| 1. PBF | A1S3V6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 9.93e-30 | 3.79e-08 | 0.857 |
| 1. PBF | Q9CH10 | Purine nucleoside phosphorylase DeoD-type | 6.20e-13 | 1.53e-21 | 8.87e-05 | 0.6592 |
| 1. PBF | Q71ZH6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.00e-34 | 9.96e-18 | 0.8687 |
| 1. PBF | Q12QG0 | Purine nucleoside phosphorylase DeoD-type | 1.64e-09 | 2.62e-20 | 0.007 | 0.6656 |
| 1. PBF | Q7NRT2 | Purine nucleoside phosphorylase DeoD-type | 4.39e-13 | 3.12e-21 | 0.030 | 0.7404 |
| 1. PBF | B2U303 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8833 |
| 1. PBF | O51931 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.02e-32 | 1.77e-19 | 0.8709 |
| 1. PBF | A6WRB5 | Purine nucleoside phosphorylase DeoD-type | 1.69e-09 | 1.66e-20 | 0.004 | 0.6818 |
| 1. PBF | B0BRW3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.42e-34 | 4.18e-14 | 0.8399 |
| 1. PBF | P56463 | Purine nucleoside phosphorylase DeoD-type | 3.50e-13 | 1.22e-22 | 0.001 | 0.7037 |
| 1. PBF | B6EKZ7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.68e-36 | 1.29e-12 | 0.8359 |
| 1. PBF | Q0HLE7 | Purine nucleoside phosphorylase DeoD-type | 1.48e-09 | 1.26e-20 | 0.010 | 0.7618 |
| 1. PBF | A5UCP4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.96e-33 | 8.12e-17 | 0.8286 |
| 1. PBF | Q81FV5 | Purine nucleoside phosphorylase DeoD-type | 5.98e-10 | 7.47e-24 | 0.001 | 0.673 |
| 1. PBF | Q12KE6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.27e-29 | 6.20e-13 | 0.8754 |
| 1. PBF | A1SYK4 | Purine nucleoside phosphorylase DeoD-type | 2.48e-09 | 2.14e-19 | 0.007 | 0.6983 |
| 1. PBF | A7MGS5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.90e-34 | 8.14e-21 | 0.8557 |
| 1. PBF | Q5PD46 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.48e-34 | 1.98e-23 | 0.8635 |
| 1. PBF | A3QGT0 | Purine nucleoside phosphorylase DeoD-type | 1.72e-09 | 1.39e-21 | 0.011 | 0.6859 |
| 1. PBF | O24915 | Aminodeoxyfutalosine nucleosidase | 0.00e+00 | 3.76e-34 | 7.29e-11 | 0.8417 |
| 1. PBF | B4EUF0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.18e-34 | 1.45e-22 | 0.8826 |
| 1. PBF | A5UIX8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.41e-31 | 1.76e-16 | 0.8188 |
| 1. PBF | B2VE28 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.11e-35 | 7.97e-19 | 0.8469 |
| 1. PBF | A7X306 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8907 |
| 1. PBF | Q65SB6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.48e-31 | 4.00e-14 | 0.8567 |
| 1. PBF | A0Q1A0 | Purine nucleoside phosphorylase DeoD-type | 5.25e-13 | 1.39e-20 | 0.003 | 0.7024 |
| 1. PBF | B5Z0D9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.884 |
| 1. PBF | B4TXR1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.38e-33 | 3.47e-24 | 0.8705 |
| 1. PBF | Q8EHK0 | Purine nucleoside phosphorylase DeoD-type 2 | 1.50e-09 | 2.15e-20 | 0.010 | 0.7106 |
| 1. PBF | Q59482 | Purine nucleoside phosphorylase DeoD-type | 1.68e-09 | 1.44e-18 | 0.025 | 0.7145 |
| 1. PBF | B1YJD6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.21e-36 | 1.24e-18 | 0.8509 |
| 1. PBF | Q6AQW7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.12e-32 | 3.29e-13 | 0.8539 |
| 1. PBF | Q9ZK38 | Purine nucleoside phosphorylase DeoD-type | 3.37e-13 | 4.25e-23 | 0.002 | 0.7043 |
| 1. PBF | Q0HXQ1 | Purine nucleoside phosphorylase DeoD-type | 6.61e-13 | 1.26e-20 | 0.010 | 0.722 |
| 1. PBF | Q7N841 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 6.93e-36 | 6.75e-24 | 0.8763 |
| 1. PBF | Q8Y644 | Purine nucleoside phosphorylase DeoD-type | 3.28e-13 | 1.43e-26 | 0.002 | 0.6818 |
| 1. PBF | B7N828 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.893 |
| 1. PBF | B1LGW2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.884 |
| 1. PBF | A7Z721 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.65e-28 | 6.98e-17 | 0.8602 |
| 1. PBF | C1KVE1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 7.70e-35 | 5.58e-18 | 0.8693 |
| 1. PBF | Q6D1Z4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.09e-37 | 5.02e-22 | 0.8631 |
| 1. PBF | O32028 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.66e-29 | 3.21e-18 | 0.8644 |
| 1. PBF | C6DC27 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.35e-35 | 1.74e-22 | 0.8766 |
| 1. PBF | Q7VKK0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.74e-33 | 1.88e-21 | 0.8404 |
| 1. PBF | A1S477 | Purine nucleoside phosphorylase DeoD-type | 1.72e-09 | 1.46e-20 | 0.023 | 0.7558 |
| 1. PBF | B8D909 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.73e-42 | 1.62e-17 | 0.8246 |
| 1. PBF | Q8EHA7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.55e-32 | 3.06e-13 | 0.88 |
| 1. PBF | B0K889 | Purine nucleoside phosphorylase DeoD-type | 5.18e-13 | 2.15e-20 | 2.89e-05 | 0.738 |
| 1. PBF | Q812S1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.12e-33 | 7.74e-17 | 0.8559 |
| 1. PBF | Q1C3X7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 7.28e-31 | 1.62e-21 | 0.8647 |
| 1. PBF | B8D9W3 | Purine nucleoside phosphorylase DeoD-type | 2.75e-13 | 2.50e-24 | 0.005 | 0.6773 |
| 1. PBF | A9VHZ5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.40e-33 | 8.23e-18 | 0.8705 |
| 1. PBF | Q6LUR4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.72e-34 | 2.88e-16 | 0.8343 |
| 1. PBF | B7MBE2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8856 |
| 1. PBF | A8FFL1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.37e-31 | 1.11e-18 | 0.845 |
| 1. PBF | P47295 | Purine nucleoside phosphorylase DeoD-type | 2.43e-13 | 3.93e-24 | 0.007 | 0.6921 |
| 1. PBF | C3L9J6 | Purine nucleoside phosphorylase DeoD-type | 3.75e-13 | 2.45e-24 | 0.001 | 0.7379 |
| 1. PBF | C0Q5S0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.52e-34 | 6.35e-23 | 0.8551 |
| 1. PBF | B7GIU7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.36e-34 | 2.59e-19 | 0.8583 |
| 1. PBF | B7MP21 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8838 |
| 1. PBF | Q1LTN6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.32e-41 | 5.12e-16 | 0.8865 |
| 1. PBF | A1RMF2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.55e-28 | 6.11e-12 | 0.8748 |
| 1. PBF | Q4L6V0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 6.15e-33 | 9.70e-19 | 0.8698 |
| 1. PBF | Q5EEL8 | Purine nucleoside phosphorylase DeoD-type | 3.57e-13 | 2.45e-24 | 0.001 | 0.738 |
| 1. PBF | Q7A5B0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8906 |
| 1. PBF | B5RHE5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.55e-33 | 3.13e-24 | 0.8614 |
| 1. PBF | B7JP64 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.8655 |
| 1. PBF | B6JN17 | Purine nucleoside phosphorylase DeoD-type | 2.89e-13 | 7.08e-23 | 0.004 | 0.7043 |
| 1. PBF | Q8CP08 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.33e-38 | 3.14e-23 | 0.8651 |
| 1. PBF | B5Y274 | Purine nucleoside phosphorylase DeoD-type | 7.18e-13 | 7.97e-21 | 0.005 | 0.679 |
| 1. PBF | Q8DEM9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.73e-32 | 1.56e-19 | 0.8362 |
| 1. PBF | Q1QVV7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.76e-33 | 1.08e-11 | 0.8673 |
| 1. PBF | Q5E2X3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.68e-36 | 3.93e-16 | 0.8664 |
| 1. PBF | P60216 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.54e-34 | 1.32e-23 | 0.8618 |
| 1. PBF | B8DE17 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.88e-35 | 5.52e-18 | 0.869 |
| 1. PBF | B7LWC0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.19e-32 | 4.53e-25 | 0.8356 |
| 1. PBF | B5FAL1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.68e-36 | 3.93e-16 | 0.877 |
| 1. PBF | A4W6Q6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.65e-33 | 1.28e-20 | 0.8534 |
| 1. PBF | B7IYM7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.55e-33 | 4.57e-17 | 0.8508 |
| 1. PBF | P0AF15 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8929 |
| 1. PBF | Q9KPI8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.04e-32 | 1.03e-15 | 0.8332 |
| 1. PBF | B4SUY9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.55e-33 | 3.13e-24 | 0.8632 |
| 1. PBF | Q81LL4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.8699 |
| 1. PBF | A5F5R2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.04e-32 | 1.03e-15 | 0.8427 |
| 1. PBF | Q8K937 | Purine nucleoside phosphorylase DeoD-type | 9.98e-10 | 1.86e-22 | 7.00e-04 | 0.6909 |
| 1. PBF | Q92AF2 | Purine nucleoside phosphorylase DeoD-type | 2.62e-13 | 1.84e-26 | 0.002 | 0.6632 |
| 1. PBF | B9DNJ2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.46e-35 | 1.19e-22 | 0.8574 |
| 1. PBF | Q32JU9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8839 |
| 1. PBF | Q5E7J4 | Purine nucleoside phosphorylase DeoD-type 1 | 8.31e-13 | 5.30e-23 | 0.002 | 0.6946 |
| 1. PBF | A6W3C9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.32e-35 | 1.43e-15 | 0.8263 |
| 1. PBF | Q8Y729 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.09e-34 | 5.08e-18 | 0.8702 |
| 1. PBF | B7HHL7 | Purine nucleoside phosphorylase DeoD-type | 4.04e-13 | 1.76e-24 | 8.64e-04 | 0.7371 |
| 1. PBF | Q5KWV9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.97e-33 | 2.41e-22 | 0.8587 |
| 1. PBF | Q325Y0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.26e-33 | 1.48e-21 | 0.8831 |
| 1. PBF | Q8EPT8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.91e-35 | 2.39e-22 | 0.8697 |
| 1. PBF | A0RBS0 | Purine nucleoside phosphorylase DeoD-type | 3.67e-13 | 2.45e-24 | 0.001 | 0.738 |
| 1. PBF | O32810 | Purine nucleoside phosphorylase DeoD-type | 2.46e-13 | 5.94e-22 | 9.21e-05 | 0.6752 |
| 1. PBF | Q07YV9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.77e-31 | 3.34e-08 | 0.8535 |
| 1. PBF | A1A7K5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8837 |
| 1. PBF | C3LQF1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.04e-32 | 1.03e-15 | 0.8364 |
| 1. PBF | Q0T847 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8933 |
| 1. PBF | P60217 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.54e-34 | 1.32e-23 | 0.8616 |
| 1. PBF | Q63DR9 | Purine nucleoside phosphorylase DeoD-type | 3.97e-13 | 2.45e-23 | 0.002 | 0.6555 |
| 1. PBF | A6VPH1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.99e-31 | 4.13e-21 | 0.8836 |
| 1. PBF | Q57T48 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.52e-34 | 6.35e-23 | 0.8548 |
| 1. PBF | Q0I5K4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.16e-29 | 4.28e-17 | 0.8625 |
| 1. PBF | A7GT52 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.51e-33 | 6.99e-16 | 0.8929 |
| 1. PBF | C4LAP0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 7.49e-38 | 6.41e-14 | 0.8688 |
| 1. PBF | B5F8S1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.38e-33 | 3.47e-24 | 0.8612 |
| 1. PBF | B1KI32 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.06e-27 | 1.04e-11 | 0.8799 |
| 1. PBF | P45113 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.95e-32 | 9.69e-16 | 0.8155 |
| 1. PBF | A5ITC6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8906 |
| 1. PBF | B5Z8H2 | Purine nucleoside phosphorylase DeoD-type | 2.66e-13 | 2.37e-23 | 0.008 | 0.7044 |
| 1. PBF | A1JJQ6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.45e-33 | 3.97e-20 | 0.8656 |
| 1. PBF | A8ALC9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.40e-34 | 2.02e-20 | 0.8552 |
| 1. PBF | B4TK35 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.55e-33 | 3.13e-24 | 0.8707 |
| 1. PBF | Q7CKD4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.28e-30 | 8.74e-21 | 0.8645 |
| 1. PBF | C5D4X9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.20e-30 | 5.12e-14 | 0.8596 |
| 1. PBF | A7GN01 | Purine nucleoside phosphorylase DeoD-type | 4.11e-13 | 1.22e-24 | 4.79e-04 | 0.6651 |
| 1. PBF | B7HKX2 | Purine nucleoside phosphorylase DeoD-type | 3.64e-13 | 2.45e-24 | 0.001 | 0.702 |
| 1. PBF | C0ZDZ3 | Purine nucleoside phosphorylase DeoD-type | 2.43e-13 | 1.28e-26 | 0.021 | 0.6848 |
| 1. PBF | A9N0Q5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.54e-34 | 1.32e-23 | 0.8708 |
| 1. PBF | A6T4W3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 9.83e-35 | 3.16e-24 | 0.8712 |
| 1. PBF | B8D865 | Purine nucleoside phosphorylase DeoD-type | 1.66e-13 | 2.92e-24 | 0.004 | 0.6776 |
| 1. PBF | A8FSA3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 9.37e-31 | 3.24e-12 | 0.8589 |
| 1. PBF | B7HE08 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.12e-33 | 7.74e-17 | 0.8582 |
| 1. PBF | Q3ILJ7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 9.46e-36 | 9.59e-12 | 0.8436 |
| 1. PBF | Q31DQ5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.17e-37 | 1.06e-16 | 0.8599 |
| 1. PBF | A7ZWA7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.36e-32 | 1.68e-21 | 0.8839 |
| 1. PBF | C5BAP4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.03e-33 | 4.33e-17 | 0.8549 |
| 1. PBF | Q47UY5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.67e-33 | 1.12e-12 | 0.857 |
| 1. PBF | A8G9V3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.67e-31 | 1.19e-18 | 0.8465 |
| 1. PBF | Q4QL83 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.65e-33 | 8.18e-16 | 0.846 |
| 1. PBF | B0K6Y4 | Purine nucleoside phosphorylase DeoD-type | 5.33e-13 | 2.15e-20 | 2.89e-05 | 0.7253 |
| 1. PBF | B7JGU6 | Purine nucleoside phosphorylase DeoD-type | 3.69e-13 | 2.45e-24 | 0.001 | 0.738 |
| 1. PBF | Q99TQ0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8906 |
| 1. PBF | Q87M25 | Purine nucleoside phosphorylase DeoD-type 1 | 3.60e-13 | 2.55e-19 | 0.010 | 0.6828 |
| 1. PBF | C1ESR9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.8609 |
| 1. PBF | Q17YP0 | Purine nucleoside phosphorylase DeoD-type | 3.53e-13 | 1.77e-22 | 0.002 | 0.7048 |
| 1. PBF | P77835 | Purine nucleoside phosphorylase DeoD-type | 6.72e-10 | 9.35e-25 | 8.28e-04 | 0.6663 |
| 1. PBF | B0UVM2 | Purine nucleoside phosphorylase DeoD-type | 5.68e-13 | 1.21e-23 | 0.004 | 0.686 |
| 1. PBF | B7VJ21 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.97e-34 | 2.89e-16 | 0.8289 |
| 1. PBF | B1JK17 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.29e-31 | 1.71e-20 | 0.8567 |
| 1. PBF | A0AIU3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.06e-35 | 5.46e-18 | 0.8754 |
| 1. PBF | Q9KDD4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.00e-34 | 2.25e-15 | 0.8676 |
| 1. PBF | A3N2T5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.58e-33 | 6.60e-14 | 0.8433 |
| 1. PBF | B7IP41 | Purine nucleoside phosphorylase DeoD-type | 3.77e-13 | 2.45e-24 | 0.001 | 0.6869 |
| 1. PBF | A0AJW1 | Purine nucleoside phosphorylase DeoD-type | 3.05e-13 | 1.84e-26 | 0.002 | 0.6777 |
| 1. PBF | Q28U96 | Purine nucleoside phosphorylase DeoD-type | 2.32e-13 | 1.49e-23 | 0.036 | 0.6781 |
| 1. PBF | A1STE7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.09e-37 | 5.91e-10 | 0.8611 |
| 1. PBF | Q634H0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.8702 |
| 1. PBF | C1EMV9 | Purine nucleoside phosphorylase DeoD-type | 3.48e-13 | 2.45e-24 | 0.001 | 0.6869 |
| 1. PBF | Q65GT9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.46e-34 | 6.40e-22 | 0.8794 |
| 1. PBF | Q2FGC5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8907 |
| 1. PBF | A0KZQ7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.91e-32 | 6.13e-12 | 0.8734 |
| 1. PBF | A3D1T1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.73e-33 | 1.28e-11 | 0.8688 |
| 1. PBF | A8Z4D8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8909 |
| 1. PBF | Q6G8W9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | 0.8972 |
| 1. PBF | C3P552 | Purine nucleoside phosphorylase DeoD-type | 3.66e-13 | 2.45e-24 | 0.001 | 0.7219 |
| 1. PBF | Q7MNT0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.47e-33 | 5.33e-19 | 0.8303 |
| 1. PBF | A1IGA8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 4.21e-36 | 2.53e-16 | 0.8649 |
| 1. PBF | P96122 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.58e-19 | 7.56e-10 | 0.7742 |
| 1. PBF | A0RIY7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.8699 |
| 1. PBF | Q2NVP7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 6.24e-34 | 8.34e-23 | 0.874 |
| 1. PBF | B1XD29 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8858 |
| 1. PBF | C4ZRQ2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | 0.8778 |
| 1. PBF | B5FJ06 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.10e-33 | 2.43e-24 | 0.8607 |
| 1. PBF | B7HQD2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 2.26e-33 | 5.56e-17 | 0.8672 |
| 1. PBF | Q5WHL7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.82e-30 | 1.37e-14 | 0.8524 |
| 1. PBF | Q9CP62 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 5.39e-30 | 3.40e-13 | 0.843 |
| 1. PBF | A8H191 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.36e-30 | 2.90e-12 | 0.8529 |
| 1. PBF | Q0PC20 | Aminodeoxyfutalosine nucleosidase | 0.00e+00 | 1.33e-32 | 4.81e-09 | 0.8662 |
| 1. PBF | Q71YG0 | Purine nucleoside phosphorylase DeoD-type | 3.30e-13 | 1.43e-26 | 0.002 | 0.6604 |
| 1. PBF | Q8ENY0 | Purine nucleoside phosphorylase DeoD-type | 1.72e-09 | 6.50e-24 | 0.019 | 0.7059 |
| 1. PBF | A9R1E0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.28e-30 | 8.74e-21 | 0.8643 |
| 1. PBF | Q7MFG6 | Purine nucleoside phosphorylase DeoD-type 2 | 2.68e-13 | 6.66e-21 | 0.025 | 0.7365 |
| 1. PBF | Q66EE6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.29e-31 | 1.71e-20 | 0.8737 |
| 1. PBF | Q9ZMY2 | Aminodeoxyfutalosine nucleosidase | 0.00e+00 | 8.02e-35 | 1.32e-12 | 0.8187 |
| 1. PBF | C1KWF5 | Purine nucleoside phosphorylase DeoD-type | 3.36e-13 | 1.43e-26 | 0.002 | 0.6609 |
| 1. PBF | B5BL87 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.54e-34 | 1.32e-23 | 0.8643 |
| 1. PBF | B8DDP6 | Purine nucleoside phosphorylase DeoD-type | 3.24e-13 | 1.43e-26 | 0.002 | 0.6604 |
| 1. PBF | A3QBQ0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 3.82e-29 | 4.68e-14 | 0.854 |
| 1. PBF | B7GKU4 | Purine nucleoside phosphorylase DeoD-type | 1.03e-13 | 6.23e-25 | 0.001 | 0.6663 |
| 1. PBF | B8E6P7 | Purine nucleoside phosphorylase DeoD-type | 1.74e-09 | 1.92e-20 | 0.004 | 0.6821 |
| 2. PF | P0DJF8 | S-methyl-5'-thioadenosine phosphorylase | 1.12e-05 | 2.08e-03 | NA | 0.633 |
| 2. PF | C8VP37 | S-methyl-5'-thioadenosine phosphorylase | 1.24e-08 | 3.95e-02 | NA | 0.5712 |
| 2. PF | B2VH53 | Purine nucleoside phosphorylase DeoD-type | 7.17e-13 | 9.96e-22 | NA | 0.7013 |
| 2. PF | B5FTC8 | Purine nucleoside phosphorylase DeoD-type | 5.72e-13 | 5.04e-21 | NA | 0.6788 |
| 2. PF | Q3ICU8 | Purine nucleoside phosphorylase DeoD-type | 5.54e-13 | 5.80e-18 | NA | 0.7103 |
| 2. PF | Q56037 | Purine nucleoside phosphorylase DeoD-type (Fragment) | 2.24e-09 | 1.06e-23 | NA | 0.5739 |
| 2. PF | C4YQD9 | S-methyl-5'-thioadenosine phosphorylase | 1.33e-08 | 1.37e-06 | NA | 0.4971 |
| 2. PF | B1YJP1 | Purine nucleoside phosphorylase DeoD-type | 3.40e-13 | 1.70e-24 | NA | 0.6941 |
| 2. PF | E3K7C1 | S-methyl-5'-thioadenosine phosphorylase 2 | 2.83e-09 | 4.70e-08 | NA | 0.5703 |
| 2. PF | B2INV3 | Purine nucleoside phosphorylase DeoD-type | 1.10e-09 | 2.58e-23 | NA | 0.6568 |
| 2. PF | Q31SV5 | Purine nucleoside phosphorylase DeoD-type | 6.36e-13 | 4.77e-22 | NA | 0.6796 |
| 2. PF | Q03CD2 | Purine nucleoside phosphorylase DeoD-type | 4.60e-13 | 7.92e-26 | NA | 0.667 |
| 2. PF | A8ALX7 | Purine nucleoside phosphorylase DeoD-type | 6.06e-13 | 2.48e-21 | NA | 0.6787 |
| 2. PF | B1L719 | Probable 6-oxopurine nucleoside phosphorylase | 1.62e-05 | 3.61e-11 | NA | 0.5758 |
| 2. PF | Q8KRT5 | Purine nucleoside phosphorylase DeoD-type | 5.93e-13 | 2.45e-20 | NA | 0.721 |
| 2. PF | Q8EDM4 | Purine nucleoside phosphorylase DeoD-type | 3.26e-13 | 2.21e-23 | NA | 0.6903 |
| 2. PF | Q38XI0 | Purine nucleoside phosphorylase DeoD-type | 4.86e-13 | 3.11e-17 | NA | 0.663 |
| 2. PF | A6TVU0 | Purine nucleoside phosphorylase DeoD-type | 3.59e-13 | 1.86e-22 | NA | 0.7344 |
| 2. PF | Q9KXN0 | Futalosine hydrolase | 1.42e-14 | 6.40e-33 | NA | 0.7096 |
| 2. PF | O83990 | Uridine phosphorylase | 1.07e-11 | 2.04e-17 | NA | 0.6348 |
| 2. PF | P77834 | Purine nucleoside phosphorylase 1 | 2.19e-09 | 3.74e-06 | NA | 0.5634 |
| 2. PF | A9N7E3 | Purine nucleoside phosphorylase DeoD-type | 5.68e-13 | 5.04e-21 | NA | 0.6889 |
| 2. PF | B8ZNN8 | Purine nucleoside phosphorylase DeoD-type | 1.12e-09 | 4.93e-24 | NA | 0.6566 |
| 2. PF | Q72LZ4 | S-methyl-5'-thioadenosine phosphorylase | 1.05e-09 | 7.23e-07 | NA | 0.565 |
| 2. PF | Q1JM69 | Purine nucleoside phosphorylase DeoD-type | 1.16e-09 | 6.97e-24 | NA | 0.6825 |
| 2. PF | B0BPV3 | Purine nucleoside phosphorylase DeoD-type | 7.51e-13 | 2.61e-21 | NA | 0.7009 |
| 2. PF | Q5SKT7 | Futalosine hydrolase | 1.17e-14 | 8.28e-33 | NA | 0.726 |
| 2. PF | O66839 | Probable 6-oxopurine nucleoside phosphorylase | 1.83e-09 | 2.34e-07 | NA | 0.5794 |
| 2. PF | A5EV41 | Purine nucleoside phosphorylase DeoD-type | 1.51e-13 | 1.79e-24 | NA | 0.7035 |
| 2. PF | B2K3J1 | Purine nucleoside phosphorylase DeoD-type | 1.62e-13 | 3.28e-21 | NA | 0.6941 |
| 2. PF | Q5JJB8 | Probable 6-oxopurine nucleoside phosphorylase | 1.81e-09 | 2.09e-08 | NA | 0.6191 |
| 2. PF | A6M0X2 | Purine nucleoside phosphorylase DeoD-type | 2.75e-13 | 4.49e-21 | NA | 0.6449 |
| 2. PF | Q8PB40 | Probable S-methyl-5'-thioinosine phosphorylase | 2.46e-09 | 6.05e-08 | NA | 0.642 |
| 2. PF | A3N122 | Purine nucleoside phosphorylase DeoD-type | 6.95e-13 | 3.07e-21 | NA | 0.6892 |
| 2. PF | G4VGI0 | Uridine phosphorylase A | 4.90e-10 | 1.39e-04 | NA | 0.6037 |
| 2. PF | Q9X0L3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.27e-37 | NA | 0.7544 |
| 2. PF | F6X2V8 | S-methyl-5'-thioadenosine phosphorylase | 1.52e-05 | 1.96e-07 | NA | 0.5618 |
| 2. PF | Q327L2 | Purine nucleoside phosphorylase DeoD-type | 5.59e-13 | 5.11e-22 | NA | 0.6913 |
| 2. PF | Q5JEQ6 | S-methyl-5'-thioadenosine phosphorylase | 1.93e-09 | 2.83e-09 | NA | 0.6457 |
| 2. PF | Q9HZK1 | S-methyl-5'-thioinosine phosphorylase | 1.38e-09 | 2.51e-14 | NA | 0.663 |
| 2. PF | O34925 | Purine nucleoside phosphorylase DeoD-type | 1.60e-13 | 2.16e-18 | NA | 0.713 |
| 2. PF | Q2RKL6 | Probable 6-oxopurine nucleoside phosphorylase | 2.06e-09 | 2.15e-09 | NA | 0.6055 |
| 2. PF | A7SN31 | S-methyl-5'-thioadenosine phosphorylase | 5.09e-09 | 5.24e-05 | NA | 0.5757 |
| 2. PF | Q09117 | Bark storage protein B | 1.46e-08 | 4.12e-10 | NA | 0.6895 |
| 2. PF | B5E3K8 | Purine nucleoside phosphorylase DeoD-type | 1.13e-09 | 4.93e-24 | NA | 0.6566 |
| 2. PF | B1LEI9 | Purine nucleoside phosphorylase DeoD-type | 6.08e-13 | 4.77e-22 | NA | 0.6942 |
| 2. PF | Q74E52 | S-methyl-5'-thioadenosine phosphorylase | 1.45e-09 | 7.34e-05 | NA | 0.6203 |
| 2. PF | Q7N930 | Purine nucleoside phosphorylase DeoD-type | 7.29e-13 | 1.11e-19 | NA | 0.6936 |
| 2. PF | C1CS55 | Purine nucleoside phosphorylase DeoD-type | 1.09e-09 | 2.58e-23 | NA | 0.6583 |
| 2. PF | B5Z4R6 | Purine nucleoside phosphorylase DeoD-type | 6.13e-13 | 4.77e-22 | NA | 0.6951 |
| 2. PF | P9WJM2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.11e-15 | 8.57e-22 | NA | 0.7768 |
| 2. PF | B1IS35 | Purine nucleoside phosphorylase DeoD-type | 5.44e-13 | 5.64e-22 | NA | 0.7163 |
| 2. PF | Q086F7 | Purine nucleoside phosphorylase DeoD-type | 1.64e-09 | 1.03e-21 | NA | 0.6927 |
| 2. PF | Q9KYV7 | Purine nucleoside phosphorylase | 3.17e-09 | 4.20e-04 | NA | 0.5752 |
| 2. PF | Q6LLA7 | Purine nucleoside phosphorylase DeoD-type 2 | 2.21e-13 | 1.43e-20 | NA | 0.6981 |
| 2. PF | Q1D9Z7 | Purine nucleoside phosphorylase DeoD-type | 2.76e-13 | 9.35e-24 | NA | 0.6933 |
| 2. PF | Q8ZIQ2 | Purine nucleoside phosphorylase DeoD-type | 7.49e-13 | 1.72e-21 | NA | 0.67 |
| 2. PF | C0NRX4 | S-methyl-5'-thioadenosine phosphorylase | 3.02e-09 | 1.42e-06 | NA | 0.562 |
| 2. PF | Q4QN30 | Purine nucleoside phosphorylase DeoD-type | 2.64e-13 | 3.02e-24 | NA | 0.6649 |
| 2. PF | Q65RA4 | Purine nucleoside phosphorylase DeoD-type | 5.75e-13 | 1.12e-20 | NA | 0.6857 |
| 2. PF | Q8ZJV7 | Purine nucleoside phosphorylase DeoD-type | 5.82e-13 | 4.04e-22 | NA | 0.7183 |
| 2. PF | Q7VDN6 | S-methyl-5'-thioadenosine phosphorylase | 1.08e-08 | 2.05e-04 | NA | 0.6496 |
| 2. PF | A2BIU4 | S-methyl-5'-thioadenosine phosphorylase | 5.99e-10 | 2.38e-08 | NA | 0.6596 |
| 2. PF | B4TH02 | Purine nucleoside phosphorylase DeoD-type | 6.11e-13 | 4.04e-22 | NA | 0.6787 |
| 2. PF | A5UH23 | Purine nucleoside phosphorylase DeoD-type | 6.09e-13 | 1.26e-24 | NA | 0.6801 |
| 2. PF | Q89VT5 | S-methyl-5'-thioadenosine phosphorylase | 4.87e-09 | 8.77e-05 | NA | 0.62 |
| 2. PF | A5K9M4 | Purine nucleoside phosphorylase | 3.10e-09 | 1.37e-22 | NA | 0.6482 |
| 2. PF | Q03KK1 | Purine nucleoside phosphorylase DeoD-type | 1.10e-09 | 3.97e-23 | NA | 0.6833 |
| 2. PF | P0A539 | Purine nucleoside phosphorylase | 3.32e-10 | 5.48e-03 | NA | 0.6039 |
| 2. PF | Q6D989 | Purine nucleoside phosphorylase DeoD-type | 7.21e-13 | 2.14e-19 | NA | 0.6806 |
| 2. PF | E3XFR6 | S-methyl-5'-thioadenosine phosphorylase | 1.64e-05 | 4.41e-07 | NA | 0.6062 |
| 2. PF | B7LNS4 | Purine nucleoside phosphorylase DeoD-type | 5.79e-13 | 4.77e-22 | NA | 0.6943 |
| 2. PF | A7MIG7 | Purine nucleoside phosphorylase DeoD-type | 7.42e-13 | 3.39e-21 | NA | 0.6794 |
| 2. PF | A0LR22 | Futalosine hydrolase | 1.19e-13 | 7.18e-25 | NA | 0.7059 |
| 2. PF | Q07469 | Bark storage protein A | 9.06e-12 | 1.85e-10 | NA | 0.6987 |
| 2. PF | O27633 | Probable S-methyl-5'-thioinosine phosphorylase | 7.02e-06 | 1.50e-03 | NA | 0.6263 |
| 2. PF | Q57G38 | Purine nucleoside phosphorylase DeoD-type | 6.10e-13 | 5.04e-21 | NA | 0.6787 |
| 2. PF | A6VM01 | Purine nucleoside phosphorylase DeoD-type | 1.39e-13 | 1.93e-22 | NA | 0.666 |
| 2. PF | A8AXN4 | Purine nucleoside phosphorylase DeoD-type | 1.10e-09 | 4.29e-24 | NA | 0.6583 |
| 2. PF | Q7VMS8 | Purine nucleoside phosphorylase DeoD-type | 6.24e-13 | 1.93e-22 | NA | 0.6988 |
| 2. PF | Q8DJE4 | S-methyl-5'-thioadenosine phosphorylase | 9.49e-09 | 1.18e-03 | NA | 0.5976 |
| 2. PF | A0QR54 | S-methyl-5'-thioadenosine phosphorylase | 8.82e-10 | 1.28e-07 | NA | 0.6354 |
| 2. PF | A8LJI8 | Purine nucleoside phosphorylase DeoD-type | 3.13e-13 | 1.33e-22 | NA | 0.695 |
| 2. PF | A7FMH2 | Purine nucleoside phosphorylase DeoD-type | 1.63e-13 | 3.28e-21 | NA | 0.6939 |
| 2. PF | Q4PH43 | S-methyl-5'-thioadenosine phosphorylase | 1.14e-08 | 2.61e-08 | NA | 0.5941 |
| 2. PF | Q169T2 | Purine nucleoside phosphorylase DeoD-type | 1.63e-13 | 4.39e-23 | NA | 0.7097 |
| 2. PF | A4W6A1 | Purine nucleoside phosphorylase DeoD-type | 2.76e-13 | 2.36e-22 | NA | 0.6818 |
| 2. PF | Q87ZC3 | Probable S-methyl-5'-thioinosine phosphorylase | 6.03e-10 | 8.55e-12 | NA | 0.5849 |
| 2. PF | P44417 | Purine nucleoside phosphorylase DeoD-type | 2.73e-13 | 3.02e-24 | NA | 0.6712 |
| 2. PF | A7ZVS7 | Purine nucleoside phosphorylase DeoD-type | 5.75e-13 | 4.77e-22 | NA | 0.6944 |
| 2. PF | O08444 | Uridine phosphorylase | 1.04e-12 | 3.91e-17 | NA | 0.6472 |
| 2. PF | Q97W94 | S-methyl-5'-thioadenosine phosphorylase | 1.03e-09 | 8.49e-09 | NA | 0.5757 |
| 2. PF | Q297F5 | Purine nucleoside phosphorylase | 2.36e-09 | 1.09e-06 | NA | 0.6054 |
| 2. PF | Q1CMY7 | Purine nucleoside phosphorylase DeoD-type | 7.37e-13 | 1.72e-21 | NA | 0.67 |
| 2. PF | C4ZT66 | Purine nucleoside phosphorylase DeoD-type | 6.10e-13 | 4.77e-22 | NA | 0.6941 |
| 2. PF | B2TZR7 | Purine nucleoside phosphorylase DeoD-type | 6.38e-13 | 4.77e-22 | NA | 0.6943 |
| 2. PF | Q6CES3 | S-methyl-5'-thioadenosine phosphorylase | 8.11e-09 | 9.87e-08 | NA | 0.6164 |
| 2. PF | Q8TZB4 | Probable S-methyl-5'-thioinosine phosphorylase | 1.85e-09 | 1.53e-08 | NA | 0.5637 |
| 2. PF | A7Z5M8 | Purine nucleoside phosphorylase DeoD-type | 1.64e-13 | 5.47e-21 | NA | 0.6318 |
| 2. PF | B1JL34 | Purine nucleoside phosphorylase DeoD-type | 1.36e-09 | 3.28e-21 | NA | 0.6952 |
| 2. PF | B6I6N1 | Purine nucleoside phosphorylase DeoD-type | 6.13e-13 | 4.77e-22 | NA | 0.6943 |
| 2. PF | P9WP00 | Purine nucleoside phosphorylase | 3.30e-10 | 5.48e-03 | NA | 0.6044 |
| 2. PF | Q5DYV8 | Purine nucleoside phosphorylase DeoD-type | 4.62e-13 | 9.95e-20 | NA | 0.6688 |
| 2. PF | Q2SHN2 | Purine nucleoside phosphorylase DeoD-type | 2.92e-13 | 1.22e-20 | NA | 0.6715 |
| 2. PF | Q7RZA5 | S-methyl-5'-thioadenosine phosphorylase | 5.52e-09 | 4.71e-06 | NA | 0.6197 |
| 2. PF | B4TU44 | Purine nucleoside phosphorylase DeoD-type | 6.08e-13 | 9.63e-22 | NA | 0.6809 |
| 2. PF | Q1JC85 | Purine nucleoside phosphorylase DeoD-type | 1.17e-09 | 6.97e-24 | NA | 0.6824 |
| 2. PF | B5R2J9 | Purine nucleoside phosphorylase DeoD-type | 5.72e-13 | 5.04e-21 | NA | 0.6787 |
| 2. PF | Q0TQJ7 | Purine nucleoside phosphorylase DeoD-type | 3.78e-13 | 9.32e-22 | NA | 0.754 |
| 2. PF | B7MNJ1 | Purine nucleoside phosphorylase DeoD-type | 5.81e-13 | 4.77e-22 | NA | 0.6943 |
| 2. PF | Q8DBS9 | Purine nucleoside phosphorylase DeoD-type 1 | 3.17e-13 | 5.79e-19 | NA | 0.6767 |
| 2. PF | A8P7Y3 | S-methyl-5'-thioadenosine phosphorylase | 4.46e-06 | 2.72e-05 | NA | 0.6014 |
| 2. PF | B3H1P6 | Purine nucleoside phosphorylase DeoD-type | 7.21e-13 | 3.07e-21 | NA | 0.7011 |
| 2. PF | C7YLQ3 | S-methyl-5'-thioadenosine phosphorylase | 3.00e-09 | 2.24e-06 | NA | 0.6786 |
| 2. PF | Q8FA51 | Purine nucleoside phosphorylase DeoD-type | 6.25e-13 | 5.64e-22 | NA | 0.6913 |
| 2. PF | O83716 | Purine nucleoside phosphorylase DeoD-type | 2.18e-13 | 1.32e-27 | NA | 0.6825 |
| 2. PF | P94164 | Purine nucleoside phosphorylase DeoD-type | 7.13e-13 | 3.07e-21 | NA | 0.701 |
| 2. PF | B5R9V2 | Purine nucleoside phosphorylase DeoD-type | 5.95e-13 | 1.01e-19 | NA | 0.7026 |
| 2. PF | Q0U796 | S-methyl-5'-thioadenosine phosphorylase | 1.38e-08 | 2.64e-02 | NA | 0.5682 |
| 2. PF | Q8T9Z7 | Purine nucleoside phosphorylase | 2.54e-09 | 6.77e-21 | NA | 0.6528 |
| 2. PF | B7LEN0 | Purine nucleoside phosphorylase DeoD-type | 5.78e-13 | 4.77e-22 | NA | 0.6943 |
| 2. PF | B5F527 | Purine nucleoside phosphorylase DeoD-type | 5.68e-13 | 9.63e-22 | NA | 0.689 |
| 2. PF | B7LXU6 | Purine nucleoside phosphorylase DeoD-type | 6.08e-13 | 4.77e-22 | NA | 0.6798 |
| 2. PF | O57865 | S-methyl-5'-thioadenosine phosphorylase | 8.27e-10 | 9.33e-09 | NA | 0.63 |
| 2. PF | P52671 | Uridine phosphorylase | 2.67e-11 | 2.07e-11 | NA | 0.6631 |
| 2. PF | C4L2Y4 | Purine nucleoside phosphorylase DeoD-type | 1.86e-13 | 1.22e-22 | NA | 0.6843 |
| 2. PF | B6ER81 | Purine nucleoside phosphorylase DeoD-type | 6.16e-13 | 5.49e-20 | NA | 0.7807 |
| 2. PF | B7UR12 | Purine nucleoside phosphorylase DeoD-type | 5.80e-13 | 5.64e-22 | NA | 0.6784 |
| 2. PF | A5U9X5 | Purine nucleoside phosphorylase DeoD-type | 2.57e-13 | 6.39e-24 | NA | 0.6779 |
| 2. PF | B4T4H3 | Purine nucleoside phosphorylase DeoD-type | 6.04e-13 | 9.63e-22 | NA | 0.6798 |
| 2. PF | Q9HL98 | S-methyl-5'-thioadenosine phosphorylase | 3.83e-10 | 2.23e-09 | NA | 0.648 |
| 2. PF | Q3YU09 | Purine nucleoside phosphorylase DeoD-type | 5.98e-13 | 4.77e-22 | NA | 0.6943 |
| 2. PF | A9A3N5 | S-methyl-5'-thioadenosine phosphorylase | 7.66e-10 | 1.25e-07 | NA | 0.5761 |
| 2. PF | B8E181 | Probable 6-oxopurine nucleoside phosphorylase | 2.73e-09 | 3.37e-08 | NA | 0.6451 |
| 2. PF | B7NW64 | Purine nucleoside phosphorylase DeoD-type | 5.85e-13 | 5.64e-22 | NA | 0.6913 |
| 2. PF | P0DJF9 | S-methyl-5'-thioadenosine phosphorylase | 1.12e-05 | 2.08e-03 | NA | 0.6094 |
| 2. PF | A9MRA4 | Purine nucleoside phosphorylase DeoD-type | 6.36e-13 | 3.34e-21 | NA | 0.6788 |
| 2. PF | Q894Z3 | Purine nucleoside phosphorylase DeoD-type | 3.74e-13 | 6.55e-21 | NA | 0.636 |
| 2. PF | E3K7C3 | S-methyl-5'-thioadenosine phosphorylase 1 | 4.13e-06 | 1.91e-05 | NA | 0.5366 |
| 2. PF | A8XGS6 | S-methyl-5'-thioadenosine phosphorylase | 4.31e-09 | 8.14e-08 | NA | 0.6072 |
| 2. PF | P55859 | Purine nucleoside phosphorylase | 5.02e-09 | 3.07e-03 | NA | 0.6752 |
| 2. PF | C1C6H0 | Purine nucleoside phosphorylase DeoD-type | 1.14e-09 | 4.93e-24 | NA | 0.6835 |
| 2. PF | G4VGH9 | Inactive uridine phosphorylase B | 4.23e-10 | 1.36e-02 | NA | 0.6255 |
| 2. PF | A4IN93 | Purine nucleoside phosphorylase DeoD-type | 2.93e-13 | 2.58e-23 | NA | 0.6945 |
| 2. PF | A1RXU2 | S-methyl-5'-thioadenosine phosphorylase | 9.33e-07 | 8.52e-10 | NA | 0.642 |
| 2. PF | Q87G42 | Purine nucleoside phosphorylase DeoD-type 2 | 2.61e-09 | 1.18e-20 | NA | 0.6973 |
| 2. PF | Q5KZM1 | Purine nucleoside phosphorylase DeoD-type | 6.25e-10 | 8.58e-24 | NA | 0.624 |
| 2. PF | O93844 | Purine nucleoside permease | 4.36e-09 | 2.41e-08 | NA | 0.6349 |
| 2. PF | Q8CXR2 | S-methyl-5'-thioadenosine phosphorylase | 1.76e-09 | 5.52e-08 | NA | 0.6542 |
| 2. PF | Q0ST47 | Purine nucleoside phosphorylase DeoD-type | 3.78e-13 | 1.72e-21 | NA | 0.7544 |
| 2. PF | P0A1F6 | Uridine phosphorylase | 1.20e-12 | 1.39e-17 | NA | 0.6492 |
| 2. PF | C6DKM0 | Purine nucleoside phosphorylase DeoD-type | 7.27e-13 | 3.18e-20 | NA | 0.696 |
| 2. PF | Q9PAZ2 | Probable S-methyl-5'-thioinosine phosphorylase | 2.32e-08 | 1.01e-05 | NA | 0.5868 |
| 2. PF | A4W2M2 | Purine nucleoside phosphorylase DeoD-type | 7.26e-10 | 2.53e-25 | NA | 0.6865 |
| 2. PF | Q7MI41 | Purine nucleoside phosphorylase DeoD-type 1 | 5.25e-13 | 5.79e-19 | NA | 0.6827 |
| 2. PF | A9WAL0 | S-methyl-5'-thioadenosine phosphorylase | 2.95e-06 | 5.67e-05 | NA | 0.6138 |
| 2. PF | Q89A58 | Purine nucleoside phosphorylase DeoD-type | 1.46e-09 | 1.48e-21 | NA | 0.7202 |
| 2. PF | Q65IE9 | Purine nucleoside phosphorylase DeoD-type | 1.37e-13 | 2.17e-21 | NA | 0.6526 |
| 2. PF | Q1INC3 | S-methyl-5'-thioadenosine phosphorylase | 6.07e-09 | 8.21e-03 | NA | 0.6372 |
| 2. PF | B9DUK0 | Purine nucleoside phosphorylase DeoD-type | 1.11e-09 | 2.54e-23 | NA | 0.7305 |
| 2. PF | B4EWA1 | Purine nucleoside phosphorylase DeoD-type | 9.36e-13 | 3.28e-19 | NA | 0.6768 |
| 2. PF | A4VWC2 | Purine nucleoside phosphorylase DeoD-type | 7.02e-10 | 2.53e-25 | NA | 0.6864 |
| 2. PF | Q4WMU1 | S-methyl-5'-thioadenosine phosphorylase | 1.17e-08 | 4.12e-05 | NA | 0.5739 |
| 2. PF | F6V515 | S-methyl-5'-thioadenosine phosphorylase | 5.05e-09 | 6.92e-07 | NA | 0.5867 |
| 2. PF | B3W8N4 | Purine nucleoside phosphorylase DeoD-type | 5.23e-13 | 7.92e-26 | NA | 0.6746 |
| 2. PF | Q66EV7 | Purine nucleoside phosphorylase DeoD-type | 1.64e-13 | 3.28e-21 | NA | 0.695 |
| 2. PF | B5BAK0 | Purine nucleoside phosphorylase DeoD-type | 6.11e-13 | 9.63e-22 | NA | 0.6797 |
| 2. PF | Q7NHW1 | S-methyl-5'-thioadenosine phosphorylase | 1.57e-08 | 6.45e-05 | NA | 0.6015 |
| 2. PF | B1IB05 | Purine nucleoside phosphorylase DeoD-type | 1.11e-09 | 1.86e-23 | NA | 0.6569 |
| 2. PF | Q9V2F1 | S-methyl-5'-thioadenosine phosphorylase | 1.88e-09 | 3.39e-09 | NA | 0.6607 |
| 2. PF | Q291H4 | S-methyl-5'-thioadenosine phosphorylase | 4.56e-09 | 1.43e-06 | NA | 0.6313 |
| 2. PF | C1CJS5 | Purine nucleoside phosphorylase DeoD-type | 1.10e-09 | 4.93e-24 | NA | 0.6566 |
| 2. PF | Q83P00 | Purine nucleoside phosphorylase DeoD-type | 5.80e-13 | 5.64e-22 | NA | 0.7163 |
| 2. PF | Q04L76 | Purine nucleoside phosphorylase DeoD-type | 1.11e-09 | 4.93e-24 | NA | 0.6566 |
| 2. PF | A1JJA0 | Purine nucleoside phosphorylase DeoD-type | 1.83e-13 | 1.30e-20 | NA | 0.7166 |
| 2. PF | P67657 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.44e-14 | 8.57e-22 | NA | 0.761 |
| 2. PF | O28486 | Probable 6-oxopurine nucleoside phosphorylase | 5.49e-06 | 1.24e-15 | NA | 0.6058 |
| 2. PF | A9R046 | Purine nucleoside phosphorylase DeoD-type | 2.68e-13 | 1.72e-21 | NA | 0.6894 |
| 2. PF | P46354 | Purine nucleoside phosphorylase 1 | 2.16e-09 | 1.56e-05 | NA | 0.5275 |
| 2. PF | A8A8B3 | Purine nucleoside phosphorylase DeoD-type | 6.03e-13 | 4.77e-22 | NA | 0.6797 |
| 2. PF | P43770 | Uridine phosphorylase | 9.16e-13 | 5.19e-19 | NA | 0.6596 |
| 2. PF | P0A1F7 | Uridine phosphorylase | 1.15e-12 | 1.39e-17 | NA | 0.6491 |
| 2. PF | B5YKP5 | Probable S-methyl-5'-thioinosine phosphorylase | 1.75e-09 | 4.07e-10 | NA | 0.5802 |
| 2. PF | Q8U4Q8 | S-methyl-5'-thioadenosine phosphorylase | 1.29e-09 | 2.73e-09 | NA | 0.6583 |
| 2. PF | Q0SX27 | Purine nucleoside phosphorylase DeoD-type | 5.85e-13 | 5.64e-22 | NA | 0.6941 |
| 2. PF | Q0T8S9 | Purine nucleoside phosphorylase DeoD-type | 5.98e-13 | 5.64e-22 | NA | 0.6785 |
| 2. PF | A7EAA1 | S-methyl-5'-thioadenosine phosphorylase | 2.33e-09 | 1.23e-05 | NA | 0.6317 |
| 2. PF | Q9YAQ8 | S-methyl-5'-thioadenosine phosphorylase | 1.62e-09 | 1.90e-09 | NA | 0.6337 |
| 2. PF | Q8Z0U2 | Purine nucleoside phosphorylase DeoD-type | 6.10e-13 | 9.63e-22 | NA | 0.6798 |
| 2. PF | B7NH52 | Purine nucleoside phosphorylase DeoD-type | 6.07e-13 | 4.77e-22 | NA | 0.6797 |
| 2. PF | A5VHR2 | Purine nucleoside phosphorylase DeoD-type | 1.50e-13 | 6.07e-24 | NA | 0.6711 |
| 2. PF | Q03Q52 | Purine nucleoside phosphorylase DeoD-type | 1.33e-09 | 4.84e-24 | NA | 0.6641 |
| 2. PF | Q5E0H4 | Purine nucleoside phosphorylase DeoD-type 2 | 5.92e-13 | 1.18e-20 | NA | 0.7808 |
| 2. PF | P46862 | Purine nucleoside phosphorylase | 4.28e-10 | 9.12e-05 | NA | 0.6418 |
| 2. PF | P75053 | Purine nucleoside phosphorylase DeoD-type | 6.63e-14 | 3.83e-18 | NA | 0.67 |
| 2. PF | Q7Q9N9 | S-methyl-5'-thioadenosine phosphorylase | 1.16e-05 | 4.92e-07 | NA | 0.5697 |
| 2. PF | Q8EKK0 | Purine nucleoside phosphorylase DeoD-type 1 | 1.13e-13 | 4.56e-21 | NA | 0.6697 |
| 2. PF | F6RQL9 | S-methyl-5'-thioadenosine phosphorylase | 2.64e-09 | 1.14e-07 | NA | 0.6532 |
| 2. PF | Q8ZTB2 | S-methyl-5'-thioadenosine phosphorylase | 6.56e-09 | 3.87e-09 | NA | 0.5699 |
| 2. PF | A2RF09 | Purine nucleoside phosphorylase DeoD-type | 1.20e-09 | 1.44e-23 | NA | 0.6828 |
| 2. PF | Q9CLE6 | Purine nucleoside phosphorylase DeoD-type | 6.53e-13 | 1.33e-22 | NA | 0.6932 |
| 2. PF | B8F672 | Purine nucleoside phosphorylase DeoD-type | 6.69e-13 | 7.71e-23 | NA | 0.699 |
| 2. PF | C5D2F9 | Purine nucleoside phosphorylase DeoD-type | 1.29e-13 | 3.02e-25 | NA | 0.686 |
| 2. PF | P0ABP9 | Purine nucleoside phosphorylase DeoD-type | 5.93e-13 | 4.77e-22 | NA | 0.6943 |
| 2. PF | Q5PK20 | Purine nucleoside phosphorylase DeoD-type | 6.09e-13 | 9.63e-22 | NA | 0.6798 |
| 2. PF | Q2RXH9 | S-methyl-5'-thioadenosine phosphorylase | 5.56e-09 | 3.38e-07 | NA | 0.6152 |
| 2. PF | B7N2V8 | Purine nucleoside phosphorylase DeoD-type | 6.01e-13 | 5.64e-22 | NA | 0.6962 |
| 2. PF | Q16MW6 | S-methyl-5'-thioadenosine phosphorylase | 1.11e-05 | 1.96e-07 | NA | 0.5838 |
| 2. PF | Q3MHF7 | S-methyl-5'-thioadenosine phosphorylase | 1.19e-05 | 2.74e-07 | NA | 0.5582 |
| 2. PF | Q87BR7 | Probable S-methyl-5'-thioinosine phosphorylase | 2.67e-09 | 5.47e-09 | NA | 0.5932 |
| 2. PF | B1XFJ4 | Purine nucleoside phosphorylase DeoD-type | 6.31e-13 | 4.77e-22 | NA | 0.6942 |
| 2. PF | Q1C166 | Purine nucleoside phosphorylase DeoD-type | 7.29e-13 | 1.72e-21 | NA | 0.6737 |
| 2. PF | D5GFR0 | S-methyl-5'-thioadenosine phosphorylase | 4.99e-09 | 1.24e-07 | NA | 0.578 |
| 2. PF | Q8TQX8 | Probable S-methyl-5'-thioinosine phosphorylase | 3.12e-09 | 1.46e-06 | NA | 0.6355 |
| 2. PF | A4TQJ0 | Purine nucleoside phosphorylase DeoD-type | 7.57e-13 | 1.72e-21 | NA | 0.6749 |
| 2. PF | A0RVQ7 | S-methyl-5'-thioadenosine phosphorylase | 8.81e-10 | 4.55e-05 | NA | 0.5225 |
| 2. PF | P81989 | Purine nucleoside phosphorylase | 5.48e-10 | 5.06e-03 | NA | 0.6259 |
| 2. PF | Q8U2I1 | Probable 6-oxopurine nucleoside phosphorylase | 1.58e-09 | 1.27e-06 | NA | 0.6356 |
| 2. PF | Q5JEL5 | Pyrrolidone-carboxylate peptidase | 8.45e-05 | 7.07e-03 | NA | 0.4357 |
| 2. PF | Q1J733 | Purine nucleoside phosphorylase DeoD-type | 1.19e-09 | 1.65e-22 | NA | 0.6852 |
| 2. PF | P50389 | Purine nucleoside phosphorylase | 9.17e-13 | 1.93e-21 | NA | 0.687 |
| 2. PF | B2G592 | Purine nucleoside phosphorylase DeoD-type | 1.32e-13 | 6.07e-24 | NA | 0.6713 |
| 2. PF | Q3J5E8 | S-methyl-5'-thioadenosine phosphorylase | 2.38e-09 | 6.52e-05 | NA | 0.6161 |
| 2. PF | Q5KPU2 | S-methyl-5'-thioadenosine phosphorylase | 4.12e-09 | 1.22e-06 | NA | 0.582 |
| 2. PF | C5BHJ5 | Purine nucleoside phosphorylase DeoD-type | 6.58e-13 | 1.46e-20 | NA | 0.6904 |
| 2. PF | C1CDI3 | Purine nucleoside phosphorylase DeoD-type | 1.09e-09 | 1.34e-23 | NA | 0.6565 |
| 3. BF | P27711 | Fibril protein | 3.51e-13 | NA | 8.24e-09 | 0.7683 |
| 4. PB | Q9T0I8 | 5'-methylthioadenosine nucleosidase | 0.00e+00 | 6.84e-12 | 0.010 | NA |
| 4. PB | P0AF12 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 8.12e-33 | 2.47e-21 | NA |
| 4. PB | Q2FXX8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 1.30e-37 | 2.72e-20 | NA |
| 5. P | Q040L6 | Pyrrolidone-carboxylate peptidase | 1.23e-04 | 8.35e-04 | NA | NA |
| 5. P | Q8XKH1 | Pyrrolidone-carboxylate peptidase | 2.07e-06 | 5.08e-04 | NA | NA |
| 5. P | P9WIJ4 | Pyrrolidone-carboxylate peptidase | 1.84e-06 | 2.56e-04 | NA | NA |
| 5. P | A1JR34 | Pyrrolidone-carboxylate peptidase | 4.44e-06 | 1.30e-02 | NA | NA |
| 5. P | C1AJZ7 | Pyrrolidone-carboxylate peptidase | 2.12e-06 | 2.56e-04 | NA | NA |
| 5. P | Q9UYQ9 | Pyrrolidone-carboxylate peptidase | 1.77e-06 | 3.84e-03 | NA | NA |
| 5. P | B7IEE2 | Pyrrolidone-carboxylate peptidase | 7.81e-05 | 1.10e-03 | NA | NA |
| 5. P | A9VKA7 | Pyrrolidone-carboxylate peptidase | 4.95e-06 | 5.37e-04 | NA | NA |
| 5. P | Q6D7H1 | Pyrrolidone-carboxylate peptidase | 2.28e-06 | 5.48e-03 | NA | NA |
| 5. P | A5TZ46 | Pyrrolidone-carboxylate peptidase | 2.13e-06 | 2.56e-04 | NA | NA |
| 5. P | P9WP01 | Purine nucleoside phosphorylase | 3.28e-10 | 5.48e-03 | NA | NA |
| 5. P | Q6HH08 | Pyrrolidone-carboxylate peptidase | 5.39e-06 | 8.12e-04 | NA | NA |
| 5. P | Q9RL48 | Pyrrolidone-carboxylate peptidase | 4.11e-06 | 9.08e-04 | NA | NA |
| 5. P | A5IWB7 | Pyrrolidone-carboxylate peptidase | 4.11e-06 | 2.43e-02 | NA | NA |
| 5. P | Q9CQ65 | S-methyl-5'-thioadenosine phosphorylase | 1.02e-05 | 9.49e-07 | NA | NA |
| 5. P | C3P0R7 | Pyrrolidone-carboxylate peptidase | 2.03e-06 | 3.82e-04 | NA | NA |
| 5. P | C0ZCX0 | Pyrrolidone-carboxylate peptidase | 2.60e-06 | 4.75e-03 | NA | NA |
| 5. P | B5XZE0 | Pyrrolidone-carboxylate peptidase | 2.81e-04 | 7.52e-03 | NA | NA |
| 5. P | C3MP49 | Pyrrolidone-carboxylate peptidase | 9.11e-05 | 4.37e-04 | NA | NA |
| 5. P | C3JZR3 | Pyrrolidone-carboxylate peptidase | 2.81e-06 | 4.59e-03 | NA | NA |
| 5. P | Q8IMU4 | Purine nucleoside phosphorylase | 3.91e-09 | 1.43e-05 | NA | NA |
| 5. P | Q8D4N5 | Pyrrolidone-carboxylate peptidase | 1.51e-06 | 2.68e-02 | NA | NA |
| 5. P | A8Z5J1 | Pyrrolidone-carboxylate peptidase | 3.59e-06 | 4.78e-02 | NA | NA |
| 5. P | A7X782 | Pyrrolidone-carboxylate peptidase | 3.96e-06 | 2.43e-02 | NA | NA |
| 5. P | Q8P243 | Pyrrolidone-carboxylate peptidase | 9.94e-05 | 6.80e-04 | NA | NA |
| 5. P | A8AJA6 | Pyrrolidone-carboxylate peptidase | 2.83e-04 | 1.09e-02 | NA | NA |
| 5. P | C3LDV2 | Pyrrolidone-carboxylate peptidase | 2.00e-06 | 3.82e-04 | NA | NA |
| 5. P | P58202 | Pyrrolidone-carboxylate peptidase 2 | 7.29e-05 | 4.37e-04 | NA | NA |
| 5. P | Q2FDH1 | Pyrrolidone-carboxylate peptidase | 4.09e-06 | 4.78e-02 | NA | NA |
| 5. P | A7GQB6 | Pyrrolidone-carboxylate peptidase | 5.80e-06 | 3.69e-02 | NA | NA |
| 5. P | A7N3R7 | Pyrrolidone-carboxylate peptidase | 2.16e-06 | 1.49e-02 | NA | NA |
| 5. P | Q03P20 | Pyrrolidone-carboxylate peptidase | 2.33e-06 | 1.37e-02 | NA | NA |
| 5. P | P65678 | Pyrrolidone-carboxylate peptidase 1 | 2.24e-06 | 9.96e-04 | NA | NA |
| 5. P | Q8R9J6 | Pyrrolidone-carboxylate peptidase 2 | 2.80e-05 | 2.23e-03 | NA | NA |
| 5. P | P0A5R5 | Pyrrolidone-carboxylate peptidase | 2.22e-06 | 2.56e-04 | NA | NA |
| 5. P | B1JRB0 | Pyrrolidone-carboxylate peptidase | 4.73e-06 | 3.41e-03 | NA | NA |
| 5. P | Q5HCK7 | Pyrrolidone-carboxylate peptidase | 4.22e-06 | 4.78e-02 | NA | NA |
| 5. P | Q2FUS6 | Pyrrolidone-carboxylate peptidase | 3.53e-06 | 4.78e-02 | NA | NA |
| 5. P | Q09438 | S-methyl-5'-thioadenosine phosphorylase | 2.62e-09 | 1.88e-07 | NA | NA |
| 5. P | Q5XDD4 | Pyrrolidone-carboxylate peptidase | 1.08e-04 | 6.86e-04 | NA | NA |
| 5. P | Q6G5Y4 | Pyrrolidone-carboxylate peptidase | 3.92e-06 | 4.78e-02 | NA | NA |
| 5. P | O87765 | Pyrrolidone-carboxylate peptidase | 1.21e-04 | 4.46e-03 | NA | NA |
| 5. P | A2RFZ5 | Pyrrolidone-carboxylate peptidase | 1.23e-04 | 6.86e-04 | NA | NA |
| 5. P | Q59ST1 | S-methyl-5'-thioadenosine phosphorylase | 1.48e-08 | 3.94e-06 | NA | NA |
| 5. P | B0K0D9 | Pyrrolidone-carboxylate peptidase | 9.94e-07 | 4.53e-04 | NA | NA |
| 5. P | Q9V813 | S-methyl-5'-thioadenosine phosphorylase | 4.62e-09 | 7.55e-06 | NA | NA |
| 5. P | B0S415 | Pyrrolidone-carboxylate peptidase | 2.01e-06 | 1.95e-03 | NA | NA |
| 5. P | P23492 | Purine nucleoside phosphorylase | 2.74e-09 | 2.61e-03 | NA | NA |
| 5. P | A1KFE2 | Pyrrolidone-carboxylate peptidase | 1.67e-06 | 2.56e-04 | NA | NA |
| 5. P | B9J587 | Pyrrolidone-carboxylate peptidase | 2.52e-06 | 5.37e-04 | NA | NA |
| 5. P | P65676 | Pyrrolidone-carboxylate peptidase | 4.09e-06 | 2.43e-02 | NA | NA |
| 5. P | C3N2L8 | Pyrrolidone-carboxylate peptidase | 8.96e-05 | 4.37e-04 | NA | NA |
| 5. P | Q81BT3 | Pyrrolidone-carboxylate peptidase | 2.13e-06 | 6.86e-04 | NA | NA |
| 5. P | Q0TQH4 | Pyrrolidone-carboxylate peptidase | 1.92e-06 | 1.02e-03 | NA | NA |
| 5. P | Q07938 | S-methyl-5'-thioadenosine phosphorylase | 7.63e-09 | 5.03e-07 | NA | NA |
| 5. P | Q8I3X4 | Purine nucleoside phosphorylase | 2.59e-09 | 6.77e-21 | NA | NA |
| 5. P | A9R3Y5 | Pyrrolidone-carboxylate peptidase | 5.96e-06 | 2.08e-03 | NA | NA |
| 5. P | A6QKH8 | Pyrrolidone-carboxylate peptidase | 3.14e-06 | 4.78e-02 | NA | NA |
| 5. P | P9WIJ5 | Pyrrolidone-carboxylate peptidase | 2.14e-06 | 2.56e-04 | NA | NA |
| 5. P | O58321 | Pyrrolidone-carboxylate peptidase | 5.75e-05 | 1.43e-02 | NA | NA |
| 5. P | Q73RB6 | Pyrrolidone-carboxylate peptidase | 2.10e-06 | 3.80e-03 | NA | NA |
| 5. P | B7HVU3 | Pyrrolidone-carboxylate peptidase | 2.09e-06 | 3.82e-04 | NA | NA |
| 5. P | O74493 | Probable purine nucleoside permease C285.05 | 1.39e-06 | 2.14e-08 | NA | NA |
| 5. P | Q4L9S3 | Pyrrolidone-carboxylate peptidase | 1.91e-06 | 5.27e-04 | NA | NA |
| 5. P | Q87IL9 | Pyrrolidone-carboxylate peptidase | 1.91e-06 | 1.22e-02 | NA | NA |
| 5. P | Q8ZD86 | Pyrrolidone-carboxylate peptidase | 6.36e-06 | 2.08e-03 | NA | NA |
| 5. P | B2UZU4 | Pyrrolidone-carboxylate peptidase | 2.19e-06 | 4.12e-04 | NA | NA |
| 5. P | Q65FR5 | Pyrrolidone-carboxylate peptidase | 2.45e-06 | 3.60e-02 | NA | NA |
| 5. P | Q7NT84 | Pyrrolidone-carboxylate peptidase | 2.53e-06 | 9.86e-03 | NA | NA |
| 5. P | P68896 | Pyrrolidone-carboxylate peptidase | 1.06e-04 | 6.86e-04 | NA | NA |
| 5. P | C0QXM0 | Pyrrolidone-carboxylate peptidase | 1.14e-06 | 6.42e-03 | NA | NA |
| 5. P | P65679 | Pyrrolidone-carboxylate peptidase 1 | 2.35e-06 | 9.96e-04 | NA | NA |
| 5. P | O06401 | S-methyl-5'-thioadenosine phosphorylase | 7.25e-10 | 3.86e-06 | NA | NA |
| 5. P | O07883 | Pyrrolidone-carboxylate peptidase | 5.88e-05 | 3.57e-03 | NA | NA |
| 5. P | Q735N6 | Pyrrolidone-carboxylate peptidase | 1.94e-04 | 1.32e-04 | NA | NA |
| 5. P | A7FFS3 | Pyrrolidone-carboxylate peptidase | 2.51e-04 | 1.97e-03 | NA | NA |
| 5. P | Q186N3 | Pyrrolidone-carboxylate peptidase | 1.69e-06 | 1.06e-04 | NA | NA |
| 5. P | Q5UR60 | Uncharacterized protein R802 | NA | 1.35e-15 | NA | NA |
| 5. P | P9WJM3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.21e-14 | 8.57e-22 | NA | NA |
| 5. P | C3NL04 | Pyrrolidone-carboxylate peptidase | 7.05e-05 | 5.69e-04 | NA | NA |
| 5. P | Q8XT56 | Pyrrolidone-carboxylate peptidase 2 | 4.23e-06 | 1.17e-03 | NA | NA |
| 5. P | P46107 | Pyrrolidone-carboxylate peptidase | 4.05e-06 | 1.03e-02 | NA | NA |
| 5. P | A4TKZ3 | Pyrrolidone-carboxylate peptidase | 5.39e-06 | 2.08e-03 | NA | NA |
| 5. P | Q0ST25 | Pyrrolidone-carboxylate peptidase | 1.75e-06 | 1.22e-04 | NA | NA |
| 5. P | Q23588 | Uridine and thymidine phosphorylase | 1.33e-10 | 5.84e-05 | NA | NA |
| 5. P | Q7XA67 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.00e+00 | 9.08e-21 | NA | NA |
| 5. P | B3W7M8 | Pyrrolidone-carboxylate peptidase | 1.23e-04 | 4.19e-03 | NA | NA |
| 5. P | B2TK93 | Pyrrolidone-carboxylate peptidase | 1.82e-06 | 2.79e-04 | NA | NA |
| 5. P | Q5AGW8 | Purine nucleoside permease | 3.46e-09 | 1.80e-08 | NA | NA |
| 5. P | A6NFU8 | Pyroglutamyl-peptidase 1-like protein | 6.84e-05 | 1.85e-02 | NA | NA |
| 5. P | A0RFP3 | Pyrrolidone-carboxylate peptidase | 5.03e-06 | 2.30e-04 | NA | NA |
| 5. P | C3NAL6 | Pyrrolidone-carboxylate peptidase | 9.22e-05 | 5.69e-04 | NA | NA |
| 5. P | Q7ZV22 | S-methyl-5'-thioadenosine phosphorylase | 3.29e-09 | 1.75e-07 | NA | NA |
| 5. P | C1F026 | Pyrrolidone-carboxylate peptidase | 5.03e-06 | 3.97e-04 | NA | NA |
| 5. P | Q1J7Y1 | Pyrrolidone-carboxylate peptidase | 9.91e-05 | 6.80e-04 | NA | NA |
| 5. P | P45563 | Purine nucleoside phosphorylase 2 | 4.54e-09 | 9.42e-04 | NA | NA |
| 5. P | B7IMH6 | Pyrrolidone-carboxylate peptidase | 1.62e-04 | 1.27e-04 | NA | NA |
| 5. P | Q667T6 | Pyrrolidone-carboxylate peptidase | 6.31e-06 | 2.08e-03 | NA | NA |
| 5. P | Q13126 | S-methyl-5'-thioadenosine phosphorylase | 2.43e-09 | 1.14e-07 | NA | NA |
| 5. P | Q0KFE0 | Pyrrolidone-carboxylate peptidase | 2.58e-04 | 4.59e-03 | NA | NA |
| 5. P | Q53596 | Pyrrolidone-carboxylate peptidase | 3.70e-06 | 3.07e-02 | NA | NA |
| 5. P | Q1JI40 | Pyrrolidone-carboxylate peptidase | 1.07e-04 | 6.86e-04 | NA | NA |
| 5. P | P85973 | Purine nucleoside phosphorylase | 4.48e-09 | 1.81e-03 | NA | NA |
| 5. P | B2VBP1 | Pyrrolidone-carboxylate peptidase | 1.41e-04 | 3.51e-03 | NA | NA |
| 5. P | Q8ENE4 | Pyrrolidone-carboxylate peptidase | 3.14e-06 | 1.64e-02 | NA | NA |
| 5. P | P12758 | Uridine phosphorylase | 1.20e-12 | 5.36e-17 | NA | NA |
| 5. P | A4W0R4 | Pyrrolidone-carboxylate peptidase | 9.44e-05 | 3.41e-03 | NA | NA |
| 5. P | Q48UT7 | Pyrrolidone-carboxylate peptidase | 1.29e-04 | 6.86e-04 | NA | NA |
| 5. P | B9DND6 | Pyrrolidone-carboxylate peptidase | 1.22e-06 | 2.56e-04 | NA | NA |
| 5. P | Q5E531 | Pyrrolidone-carboxylate peptidase | 2.92e-06 | 3.47e-04 | NA | NA |
| 5. P | Q1C571 | Pyrrolidone-carboxylate peptidase | 5.22e-06 | 2.08e-03 | NA | NA |
| 5. P | A4W870 | Pyrrolidone-carboxylate peptidase | 2.35e-04 | 3.20e-02 | NA | NA |
| 5. P | C6DCC7 | Pyrrolidone-carboxylate peptidase | 2.04e-06 | 1.27e-03 | NA | NA |
| 5. P | O73944 | Pyrrolidone-carboxylate peptidase | 3.17e-06 | 1.90e-03 | NA | NA |
| 5. P | Q03CK3 | Pyrrolidone-carboxylate peptidase | 1.20e-04 | 3.24e-03 | NA | NA |
| 5. P | Q81NT5 | Pyrrolidone-carboxylate peptidase | 2.04e-06 | 3.82e-04 | NA | NA |
| 5. P | P65677 | Pyrrolidone-carboxylate peptidase | 4.06e-06 | 2.43e-02 | NA | NA |
| 5. P | B7H8H3 | Pyrrolidone-carboxylate peptidase | 2.22e-06 | 5.96e-04 | NA | NA |
| 5. P | B5Y5X6 | Pyrrolidone-carboxylate peptidase | 2.56e-06 | 2.68e-03 | NA | NA |
| 5. P | Q05788 | Purine nucleoside phosphorylase | 6.88e-09 | 3.79e-04 | NA | NA |
| 5. P | B7LKQ5 | Pyrrolidone-carboxylate peptidase | 3.15e-04 | 5.15e-03 | NA | NA |
| 5. P | P0ABP8 | Purine nucleoside phosphorylase DeoD-type | 5.87e-13 | 4.77e-22 | NA | NA |
| 5. P | Q7MG84 | Pyrrolidone-carboxylate peptidase | 1.85e-06 | 2.29e-02 | NA | NA |
| 5. P | B1IB28 | Pyrrolidone-carboxylate peptidase | 2.30e-06 | 9.96e-04 | NA | NA |
| 5. P | Q74HE9 | Pyrrolidone-carboxylate peptidase | 1.31e-04 | 1.17e-03 | NA | NA |
| 5. P | Q04L55 | Pyrrolidone-carboxylate peptidase | 2.32e-06 | 9.96e-04 | NA | NA |
| 5. P | Q838N8 | Pyrrolidone-carboxylate peptidase | 3.57e-06 | 5.15e-03 | NA | NA |
| 5. P | A7Z119 | Pyrrolidone-carboxylate peptidase | 5.85e-06 | 1.11e-02 | NA | NA |
| 5. P | Q9UTG1 | Putative purine nucleoside phosphorylase | 7.45e-09 | 2.82e-04 | NA | NA |
| 5. P | Q8NUH2 | Pyrrolidone-carboxylate peptidase | 3.58e-06 | 4.78e-02 | NA | NA |
| 5. P | B5FEA5 | Pyrrolidone-carboxylate peptidase | 2.66e-06 | 3.47e-04 | NA | NA |
| 5. P | B0K8Z7 | Pyrrolidone-carboxylate peptidase | 1.06e-06 | 4.53e-04 | NA | NA |
| 5. P | P58201 | Pyrrolidone-carboxylate peptidase 1 | 6.22e-05 | 1.46e-04 | NA | NA |
| 5. P | Q639M5 | Pyrrolidone-carboxylate peptidase | 1.79e-04 | 1.83e-04 | NA | NA |
| 5. P | P42673 | Pyrrolidone-carboxylate peptidase | 3.03e-06 | 5.38e-03 | NA | NA |
| 5. P | Q8RBX8 | Pyrrolidone-carboxylate peptidase 1 | 8.38e-07 | 3.91e-03 | NA | NA |
| 5. P | P00491 | Purine nucleoside phosphorylase | 4.14e-09 | 2.49e-03 | NA | NA |
| 5. P | P0DC94 | Pyrrolidone-carboxylate peptidase | 1.40e-04 | 5.13e-04 | NA | NA |
| 5. P | A8MJA9 | Pyrrolidone-carboxylate peptidase | 2.22e-06 | 7.33e-04 | NA | NA |
| 5. P | A6LL24 | Pyrrolidone-carboxylate peptidase | 1.64e-06 | 6.19e-04 | NA | NA |
| 5. P | C1C6J3 | Pyrrolidone-carboxylate peptidase | 2.37e-06 | 1.68e-03 | NA | NA |
| 5. P | Q60367 | Probable S-methyl-5'-thioinosine phosphorylase | 6.91e-10 | 6.92e-11 | NA | NA |
| 5. P | B2HP18 | Pyrrolidone-carboxylate peptidase | 1.74e-06 | 1.42e-04 | NA | NA |
| 5. P | Q7NHX6 | Pyrrolidone-carboxylate peptidase | 1.51e-04 | 2.83e-03 | NA | NA |
| 5. P | B2KA64 | Pyrrolidone-carboxylate peptidase | 4.93e-06 | 2.08e-03 | NA | NA |
| 5. P | Q5FMJ2 | Pyrrolidone-carboxylate peptidase | 1.38e-06 | 1.68e-02 | NA | NA |
| 5. P | Q4A002 | Pyrrolidone-carboxylate peptidase | 1.43e-06 | 1.29e-02 | NA | NA |
| 5. P | Q1JD20 | Pyrrolidone-carboxylate peptidase | 1.03e-04 | 8.20e-04 | NA | NA |
| 5. P | B5XK96 | Pyrrolidone-carboxylate peptidase | 1.11e-04 | 6.86e-04 | NA | NA |
| 5. P | A6U575 | Pyrrolidone-carboxylate peptidase | 4.00e-06 | 2.43e-02 | NA | NA |
| 5. P | P28618 | Pyrrolidone-carboxylate peptidase | 5.18e-06 | 1.12e-02 | NA | NA |
| 5. P | Q1JMZ5 | Pyrrolidone-carboxylate peptidase | 1.06e-04 | 8.20e-04 | NA | NA |
| 5. P | Q8RI83 | Pyrrolidone-carboxylate peptidase | 1.66e-06 | 3.31e-04 | NA | NA |
| 5. P | B1HUY7 | Pyrrolidone-carboxylate peptidase | 3.62e-06 | 2.83e-03 | NA | NA |
| 5. P | Q09816 | S-methyl-5'-thioadenosine phosphorylase | 2.62e-06 | 1.65e-06 | NA | NA |
| 5. P | Q1CKF9 | Pyrrolidone-carboxylate peptidase | 5.88e-06 | 2.08e-03 | NA | NA |
| 5. P | A4VUH1 | Pyrrolidone-carboxylate peptidase | 9.15e-05 | 3.41e-03 | NA | NA |
| 5. P | C4KEG7 | Pyrrolidone-carboxylate peptidase | 8.87e-05 | 4.37e-04 | NA | NA |
| 5. P | P0DC95 | Pyrrolidone-carboxylate peptidase | 1.30e-04 | 5.13e-04 | NA | NA |
| 5. P | Q477F9 | Pyrrolidone-carboxylate peptidase | 3.36e-06 | 8.75e-04 | NA | NA |
| 5. P | B7JDC3 | Pyrrolidone-carboxylate peptidase | 2.13e-06 | 5.18e-04 | NA | NA |
| 5. P | Q6GDB4 | Pyrrolidone-carboxylate peptidase | 3.82e-06 | 3.23e-02 | NA | NA |
| 5. P | B6YUJ5 | Pyrrolidone-carboxylate peptidase | 1.35e-06 | 5.63e-04 | NA | NA |
| 5. P | Q97NG9 | Pyrrolidone-carboxylate peptidase 2 | 1.07e-04 | 8.96e-03 | NA | NA |
| 6. F | A2BUN1 | Peptidyl-tRNA hydrolase | 4.32e-06 | NA | NA | 0.4672 |
| 6. F | Q4AAD0 | Peptidyl-tRNA hydrolase | 2.19e-07 | NA | NA | 0.49 |
| 6. F | Q30TD4 | Peptidyl-tRNA hydrolase | 3.01e-07 | NA | NA | 0.469 |
| 6. F | Q5M222 | Peptidyl-tRNA hydrolase | 8.84e-07 | NA | NA | 0.4372 |
| 6. F | A4VS92 | Peptidyl-tRNA hydrolase | 2.21e-06 | NA | NA | 0.4529 |
| 6. F | Q181A2 | Peptidyl-tRNA hydrolase | 1.52e-06 | NA | NA | 0.5143 |
| 6. F | Q98PE2 | Peptidyl-tRNA hydrolase | 6.78e-07 | NA | NA | 0.499 |
| 6. F | A1VY31 | Peptidyl-tRNA hydrolase | 2.28e-07 | NA | NA | 0.5125 |
| 6. F | B4U5H3 | Peptidyl-tRNA hydrolase | 1.46e-06 | NA | NA | 0.471 |
| 6. F | Q8ZVE0 | D-aminoacyl-tRNA deacylase | 4.03e-02 | NA | NA | 0.3579 |
| 6. F | A8GP84 | Peptidyl-tRNA hydrolase | 2.15e-06 | NA | NA | 0.4808 |
| 6. F | A7H088 | Peptidyl-tRNA hydrolase | 4.95e-07 | NA | NA | 0.5349 |
| 6. F | P55519 | Uncharacterized protein y4jS | 7.01e-10 | NA | NA | 0.6333 |
| 6. F | A0RMV6 | Peptidyl-tRNA hydrolase | 2.40e-07 | NA | NA | 0.495 |
| 6. F | O29630 | D-aminoacyl-tRNA deacylase | 2.38e-05 | NA | NA | 0.4196 |
| 6. F | Q92H41 | Peptidyl-tRNA hydrolase | 3.07e-06 | NA | NA | 0.4605 |
| 6. F | Q601M5 | Peptidyl-tRNA hydrolase | 1.77e-07 | NA | NA | 0.4894 |
| 6. F | Q1RI72 | Peptidyl-tRNA hydrolase | 1.91e-06 | NA | NA | 0.5204 |
| 6. F | B9KDP1 | Peptidyl-tRNA hydrolase | 3.35e-07 | NA | NA | 0.488 |
| 6. F | Q4A8G1 | Peptidyl-tRNA hydrolase | 1.97e-07 | NA | NA | 0.4894 |
| 6. F | P0AE13 | AMP nucleosidase | 8.30e-09 | NA | NA | 0.645 |
| 6. F | A4Q998 | Purine nucleoside phosphorylase | 1.40e-05 | NA | NA | 0.5327 |
| 6. F | Q8E2I1 | Peptidyl-tRNA hydrolase | 1.57e-06 | NA | NA | 0.5047 |
| 6. F | C3PP46 | Peptidyl-tRNA hydrolase | 2.91e-06 | NA | NA | 0.4649 |
| 6. F | A4VYI0 | Peptidyl-tRNA hydrolase | 1.70e-06 | NA | NA | 0.4566 |
| 6. F | Q8E7Y8 | Peptidyl-tRNA hydrolase | 1.60e-06 | NA | NA | 0.5045 |
| 6. F | A7SGU6 | Proteasome assembly chaperone 2 | 8.00e-07 | NA | NA | 0.414 |
| 6. F | B3PNH1 | Peptidyl-tRNA hydrolase | 4.00e-07 | NA | NA | 0.4756 |
| 6. F | B4S8L3 | Peptidyl-tRNA hydrolase | 2.49e-06 | NA | NA | 0.5023 |
| 6. F | A8GVL6 | Peptidyl-tRNA hydrolase | 1.64e-06 | NA | NA | 0.5294 |
| 6. F | A5IZI8 | Peptidyl-tRNA hydrolase | 7.13e-07 | NA | NA | 0.451 |