Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54755.1
JCVISYN3A_0387

tRNA 2-thiouridine(34) synthase.
M. mycoides homolog: Q6MTG1.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 49
Unique PROST Go: 27
Unique BLAST Go: 0
Unique Foldseek Go: 5

Total Homologs: 1746
Unique PROST Homologs: 789
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 120

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: mnmA; tRNA-specific 2-thiouridylase
Zhang et al. [4]: GO:0002143|tRNA wobble position uridine thiolation
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was B6IZW5 (tRNA-specific 2-thiouridylase MnmA) with a FATCAT P-Value: 0 and RMSD of 1.42 angstrom. The sequence alignment identity is 43.8%.
Structural alignment shown in left. Query protein AVX54755.1 colored as red in alignment, homolog B6IZW5 colored as blue. Query protein AVX54755.1 is also shown in right top, homolog B6IZW5 showed in right bottom. They are colored based on secondary structures. 

  AVX54755.1 ---------M----KQKVV-VGLSGGVDSSVACYLLLQQGYEVEGLFMRNWDSATNNDILGNININND-ICPQEQDYLDAKAVADKLNIKLHRVDFIKEY 85
      B6IZW5 MGIIFYTTQMPNFEQNQVIAVGLSGGVDSSVAALVLKEKGYEVIGLFMQNWE--T--D-------SKDPFCTAEQDLSDAKAIADHIGIPLYVVNFSKAY 89

  AVX54755.1 WDYVFLYFIEEYKKARTPNPDILCNKYIKFDKFLNYAINQLNADYIAMGHYAKVEFNKTTKQYELFKASDTNKDQTYFLSQLNQNQLSKTLFPLANLTKE 185
      B6IZW5 WNHVFQHCLDEFAQGRTPNPDVWCNREIKFKSLLDHA-KKLGATHLATGHYACIQ-NE-NNEYRLLKSNDSHKDQSYFLHLLNQYQLANSVFPIGGYQKS 186

  AVX54755.1 QVRKIALEQNLITANKKDSTGICFIGERHFTDFLQNYIPSQTGNIVDIKTN--KVLGQHIGIMYYTIGQRKGIHLSGMSE----PYYVADKDVEKKILYV 279
      B6IZW5 EVRAIAKKRGFINHAKKDSTGICFIGERKFKDFLNEFLLAQPGN---IETSEGKIIGKHDGIMFYTVGQRKGLHIGGRPDAGEAPWYVVDKDVKRNVLIV 283

  AVX54755.1 CSTSDQSYLYS--TSCFVNDINWILDLSKYVSDVNQF--KCQAKFRYRQNDNNVVVKKIDDNNYQVIFEKPLKAITIGQQAVFYLDDICLGGAVIDKVVK 375
      B6IZW5 VQGYEHPLLYSQELTC-TN-LHWIRD-----TE-PSFPLTCKAKTRCRQADQTCVVTRLDNDHCHVQFEHPQRAITRGQSVVFYLGNECLGGGIIN---- 371

  AVX54755.1  375
      B6IZW5  371

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0005829 cytosol
1. PBF GO:0000049 tRNA binding
1. PBF GO:0005524 ATP binding
1. PBF GO:0016783 sulfurtransferase activity
1. PBF GO:0005737 cytoplasm
1. PBF GO:0006400 tRNA modification
1. PBF GO:0002143 tRNA wobble position uridine thiolation
1. PBF GO:0061708 tRNA-5-taurinomethyluridine 2-sulfurtransferase
2. PF GO:0006526 arginine biosynthetic process
2. PF GO:0000050 urea cycle
2. PF GO:0000053 argininosuccinate metabolic process
2. PF GO:0004055 argininosuccinate synthase activity
2. PF GO:0016879 ligase activity, forming carbon-nitrogen bonds
2. PF GO:0046872 metal ion binding
4. PB GO:0106054 tRNA U34 sulfurtransferase activity
4. PB GO:1990799 mitochondrial tRNA wobble position uridine thiolation
4. PB GO:0070903 mitochondrial tRNA thio-modification
5. P GO:0003723 RNA binding
5. P GO:0071418 cellular response to amine stimulus
5. P GO:0005886 plasma membrane
5. P GO:0070852 cell body fiber
5. P GO:0006531 aspartate metabolic process
5. P GO:0009507 chloroplast
5. P GO:0016462 pyrophosphatase activity
5. P GO:1903038 negative regulation of leukocyte cell-cell adhesion
5. P GO:0071499 cellular response to laminar fluid shear stress
5. P GO:0047530 2,4-diaminopentanoate dehydrogenase activity
5. P GO:0007494 midgut development
5. P GO:0003921 GMP synthase activity
5. P GO:0060539 diaphragm development
5. P GO:0005634 nucleus
5. P GO:0032267 tRNA(Ile)-lysidine synthase activity
5. P GO:0015643 toxic substance binding
5. P GO:0071400 cellular response to oleic acid
5. P GO:0003922 GMP synthase (glutamine-hydrolyzing) activity
5. P GO:0060416 response to growth hormone
5. P GO:0042803 protein homodimerization activity
5. P GO:0002136 tRNA wobble base lysidine biosynthesis
5. P GO:0000052 citrulline metabolic process
5. P GO:0071242 cellular response to ammonium ion
5. P GO:0006591 ornithine metabolic process
5. P GO:0071377 cellular response to glucagon stimulus
5. P GO:0071549 cellular response to dexamethasone stimulus
5. P GO:0010046 response to mycotoxin
6. F GO:0051539 4 iron, 4 sulfur cluster binding
6. F GO:0008270 zinc ion binding
6. F GO:0005739 mitochondrion
6. F GO:0008616 queuosine biosynthetic process
6. F GO:0005506 iron ion binding

Uniprot GO Annotations

GO Description
GO:0016740 transferase activity
GO:0008033 tRNA processing
GO:0003723 RNA binding
GO:0000049 tRNA binding
GO:0005524 ATP binding
GO:0016783 sulfurtransferase activity
GO:0005737 cytoplasm
GO:0006400 tRNA modification
GO:0000166 nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q5RB73 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 1.02e-28 4.38e-89 0.9074
1. PBF A0RQY3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.62e-44 1.71e-43 0.9048
1. PBF A1AQ29 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.12e-49 3.75e-65 0.9083
1. PBF B9LK98 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.47e-51 4.69e-51 0.9028
1. PBF Q9PDD9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.65e-42 7.02e-99 0.911
1. PBF Q0RDH6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.69e-46 5.92e-43 0.8966
1. PBF Q1IBE4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.55e-56 1.31e-120 0.9109
1. PBF B0BWZ7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.80e-53 8.36e-55 0.9003
1. PBF B0RGA6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.34e-24 1.66e-37 0.8689
1. PBF Q65VV2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.49e-35 7.02e-111 0.9115
1. PBF C1CI29 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.45e-56 7.78e-111 0.913
1. PBF Q6D4E9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.50e-58 5.37e-129 0.9324
1. PBF Q3J358 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.46e-42 4.28e-53 0.8594
1. PBF A5VJ48 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.24e-54 1.22e-119 0.9268
1. PBF A4W4N7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.01e-52 5.00e-113 0.9082
1. PBF C0ZXK1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.22e-38 1.60e-51 0.8672
1. PBF Q5P7R7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.81e-51 1.75e-108 0.9055
1. PBF Q1MC84 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.64e-34 3.17e-56 0.8771
1. PBF P58074 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.30e-50 4.59e-48 0.8503
1. PBF A6W7K7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.40e-37 1.10e-47 0.8877
1. PBF Q8Y714 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.11e-44 4.42e-122 0.9274
1. PBF Q8NZ00 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.25e-52 1.23e-108 0.9117
1. PBF Q92BK1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.50e-46 1.03e-123 0.9282
1. PBF A8AU84 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.70e-54 2.52e-110 0.9099
1. PBF B1YJE9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.38e-48 2.90e-125 0.9251
1. PBF Q74JW9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.46e-57 4.66e-121 0.9141
1. PBF A0LSQ2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.59e-50 8.34e-52 0.8956
1. PBF B2UC85 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.40e-50 8.53e-109 0.9216
1. PBF Q4FME4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.69e-39 2.74e-47 0.8701
1. PBF Q313S6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.69e-45 8.56e-38 0.8962
1. PBF Q5L186 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 1.21e-51 1.68e-130 0.9274
1. PBF A8Z4F9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 0.9294
1. PBF Q8Z7G9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.00e-61 1.88e-119 0.9303
1. PBF Q0S2J4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.33e-39 1.19e-50 0.886
1. PBF A6W0E1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.60e-39 5.73e-122 0.9108
1. PBF B2IBH3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.00e-26 6.00e-46 0.8738
1. PBF Q1BAU9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.54e-47 2.73e-51 0.885
1. PBF Q31GM9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.00e-50 9.50e-106 0.9154
1. PBF C3MI00 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.24e-39 9.94e-55 0.8628
1. PBF A1AA27 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.16e-61 6.51e-119 0.9334
1. PBF Q9JYJ6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.07e-55 4.50e-108 0.9357
1. PBF Q8ZFQ5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-56 1.19e-118 0.9213
1. PBF Q71ZF8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.69e-46 2.33e-123 0.9281
1. PBF A2CB44 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.69e-29 1.45e-58 0.8562
1. PBF Q8YIL6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.20e-36 1.30e-54 0.8652
1. PBF O35020 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.74e-55 2.61e-117 0.9274
1. PBF Q5LFN5 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 6.45e-53 6.45e-66 0.9346
1. PBF B2S746 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.25e-37 2.27e-54 0.8631
1. PBF Q2GFW6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.01e-43 2.05e-49 0.8623
1. PBF Q87QL9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.33e-58 5.04e-132 0.9141
1. PBF Q63QY5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.89e-40 1.73e-112 0.9116
1. PBF A1T6X1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.92e-45 3.12e-53 0.8837
1. PBF A8F5H8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.67e-51 2.54e-53 0.9147
1. PBF Q8CWW0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.94e-56 1.04e-110 0.915
1. PBF Q14FW2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.54e-55 2.98e-118 0.9476
1. PBF A4FMT5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.52e-48 1.25e-51 0.8963
1. PBF A0QJE5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.32e-47 8.31e-50 0.8862
1. PBF A5WE20 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.51e-40 1.13e-111 0.9079
1. PBF Q1J988 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.55e-52 8.61e-109 0.9089
1. PBF Q030C8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.59e-56 8.76e-111 0.9069
1. PBF Q5MZ36 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.44e-47 1.12e-74 0.9105
1. PBF A6TUB2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.55e-52 6.11e-119 0.9337
1. PBF A1K983 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.18e-51 1.48e-109 0.928
1. PBF Q7MAW9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.13e-49 7.30e-62 0.9153
1. PBF Q0T5N9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.09e-60 6.99e-120 0.9336
1. PBF A6QHG3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 0.9284
1. PBF Q9KSX8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.65e-54 5.99e-133 0.9235
1. PBF A0JYI6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.90e-40 1.19e-47 0.8398
1. PBF B0BBR8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.06e-55 7.55e-105 0.9393
1. PBF Q3A3F8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.68e-56 9.03e-72 0.9044
1. PBF A4VLW2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.13e-54 1.54e-122 0.9152
1. PBF Q2RHY7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.99e-48 9.53e-66 0.8992
1. PBF B0CE39 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.96e-55 2.54e-73 0.9162
1. PBF O51625 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.49e-52 2.51e-73 0.9614
1. PBF A9AH63 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.58e-40 4.66e-111 0.9202
1. PBF A2RLX1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.14e-56 4.71e-111 0.9067
1. PBF B6ISD0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.24e-36 3.74e-47 0.866
1. PBF A7H1D7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.31e-51 3.54e-53 0.9178
1. PBF A6SUW6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.57e-50 2.05e-110 0.9237
1. PBF A8FJL3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.69e-52 2.08e-53 0.9196
1. PBF B0VBY5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.20e-53 7.22e-110 0.905
1. PBF Q730D7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.03e-56 5.11e-126 0.9265
1. PBF A4JBM2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.26e-32 3.30e-107 0.909
1. PBF Q6YR90 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.18e-56 8.99e-124 0.9379
1. PBF B0B7K3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.06e-55 7.55e-105 0.9409
1. PBF B0SPC6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.23e-48 1.43e-53 0.8763
1. PBF Q6G2J9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.61e-29 6.32e-53 0.8794
1. PBF A1V076 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.04e-39 5.90e-112 0.9118
1. PBF B1XA43 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.71e-61 3.97e-120 0.933
1. PBF A5W1G2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.39e-52 1.00e-119 0.9151
1. PBF A3QD79 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.20e-53 2.54e-125 0.9203
1. PBF A8LK49 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.34e-39 3.81e-55 0.8582
1. PBF A9W8W7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.71e-41 5.42e-54 0.8683
1. PBF Q2SRW8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.13e-95 0.0 0.9976
1. PBF Q2GJG8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.85e-42 3.57e-46 0.8551
1. PBF Q97GY2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.37e-57 1.51e-71 0.9081
1. PBF A1STI9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.68e-58 4.61e-125 0.9319
1. PBF C0MGQ2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.32e-54 3.54e-108 0.9072
1. PBF Q0TPH2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.39e-52 7.59e-77 0.9067
1. PBF Q9CLA3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.56e-46 6.33e-117 0.909
1. PBF A7GHC7 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 5.61e-58 2.51e-68 0.9314
1. PBF A9L4G9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.60e-51 6.49e-129 0.9235
1. PBF Q3Z8D8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.62e-59 2.25e-55 0.8966
1. PBF A1S7B1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.94e-47 3.17e-128 0.9121
1. PBF A5I123 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 3.72e-51 1.24e-77 0.9165
1. PBF Q812R6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.49e-56 6.64e-126 0.9267
1. PBF Q118B7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.55e-51 2.09e-63 0.9118
1. PBF A5IYK6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.55e-58 6.12e-157 0.94
1. PBF B9J9F7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.25e-38 1.19e-53 0.8652
1. PBF Q82VV0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.88e-51 3.32e-114 0.9492
1. PBF Q9PKA7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.44e-54 1.37e-110 0.9433
1. PBF B3EN11 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.34e-50 1.88e-64 0.8685
1. PBF A7NK07 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.49e-54 2.11e-53 0.8767
1. PBF B5RMM8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.74e-54 8.22e-71 0.9547
1. PBF A5FZD5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.71e-49 2.14e-46 0.9001
1. PBF Q11UP4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-52 1.78e-59 0.8895
1. PBF A7ICB9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.93e-41 1.15e-51 0.8753
1. PBF A5I5Y9 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 9.76e-56 7.41e-71 0.9233
1. PBF A5GMJ9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.31e-33 3.34e-62 0.8629
1. PBF Q4QP16 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.74e-41 3.97e-117 0.9045
1. PBF A1VXD7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.90e-52 9.51e-53 0.9193
1. PBF Q5L6D1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.32e-54 4.05e-99 0.9405
1. PBF B7J5X6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.31e-49 1.79e-65 0.897
1. PBF A9NDN1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.99e-55 2.93e-110 0.9413
1. PBF Q1WTT7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.02e-58 1.26e-119 0.9255
1. PBF A5CW80 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.19e-53 4.49e-109 0.9412
1. PBF C1CP03 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.93e-55 8.03e-111 0.9138
1. PBF Q97T38 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.93e-55 8.03e-111 0.9128
1. PBF A5N749 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.52e-47 2.11e-76 0.9167
1. PBF Q73VF7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.26e-47 6.77e-51 0.8854
1. PBF A0RJ05 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.68e-57 4.64e-126 0.927
1. PBF A6LSF2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.08e-54 4.33e-75 0.8992
1. PBF Q87DM0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.83e-41 2.00e-100 0.9113
1. PBF A8MEV9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.80e-53 2.06e-126 0.9444
1. PBF Q4FSB4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.59e-40 4.75e-109 0.9036
1. PBF Q7U387 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.49e-52 2.02e-104 0.9087
1. PBF A3PXL7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.59e-46 5.63e-52 0.8844
1. PBF C3JY68 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.42e-51 2.27e-117 0.917
1. PBF Q081F9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.51e-54 2.13e-125 0.9255
1. PBF B2SEJ7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.54e-55 2.98e-118 0.9478
1. PBF B2A5K1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.69e-54 1.29e-84 0.8868
1. PBF A1WEN1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-48 1.63e-109 0.9188
1. PBF Q64ZW2 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 2.61e-53 9.35e-44 0.8664
1. PBF A7ZEK1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.62e-50 3.45e-44 0.9023
1. PBF Q0IC49 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.82e-37 2.30e-60 0.8633
1. PBF Q2GDU3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.28e-37 2.77e-46 0.8715
1. PBF Q8FQ01 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.82e-46 9.27e-41 0.862
1. PBF B5ZNK8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.43e-40 4.28e-56 0.8688
1. PBF Q8ZPZ4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.92e-61 1.22e-118 0.931
1. PBF B8ZK04 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.23e-56 3.15e-111 0.9131
1. PBF B1GZY9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.11e-56 6.34e-78 0.9139
1. PBF Q24US9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.10e-52 7.03e-67 0.8611
1. PBF B1AJ41 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.79e-63 1.65e-130 0.945
1. PBF Q2Y6T6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.50e-55 2.29e-103 0.9391
1. PBF A5CFJ6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.34e-49 2.20e-56 0.8723
1. PBF B3ETH8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.83e-53 2.56e-57 0.8695
1. PBF Q6LT18 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.76e-58 2.26e-129 0.9128
1. PBF Q8CY38 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.25e-37 2.27e-54 0.8692
1. PBF A9EXM5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.42e-45 3.58e-60 0.8811
1. PBF A6LNA3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.71e-25 8.14e-45 0.8818
1. PBF B6J7H5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.22e-44 1.56e-110 0.9183
1. PBF A6T7K3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.36e-63 1.72e-121 0.929
1. PBF A6WP69 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.01e-51 1.03e-128 0.9211
1. PBF Q7U320 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.67e-44 7.79e-47 0.8962
1. PBF Q7TTQ1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.53e-38 3.75e-64 0.8571
1. PBF A7MFV2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.93e-60 2.63e-126 0.9256
1. PBF Q2SZ45 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.02e-35 2.17e-111 0.912
1. PBF Q3IH16 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.76e-55 9.14e-129 0.9288
1. PBF A6WZ88 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.22e-38 2.98e-56 0.8642
1. PBF C4L952 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.18e-56 4.06e-123 0.9218
1. PBF A7FH61 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.47e-57 9.24e-119 0.9216
1. PBF Q21RZ7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.43e-52 4.06e-107 0.8926
1. PBF A2BSL2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.89e-39 5.03e-64 0.8617
1. PBF C0QRH5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.36e-59 3.47e-65 0.8997
1. PBF Q49Y59 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.29e-54 2.54e-126 0.9304
1. PBF Q3AL87 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.43e-34 9.04e-57 0.8584
1. PBF B0UIW7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.91e-44 1.24e-55 0.8791
1. PBF A4X484 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.37e-43 1.51e-47 0.8831
1. PBF Q2KZ71 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.91e-53 6.11e-106 0.9118
1. PBF A9AYA7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.80e-51 9.86e-58 0.9012
1. PBF C1B1S2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.90e-42 1.08e-52 0.8805
1. PBF C6DFW7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.64e-60 2.98e-129 0.9313
1. PBF A8YUQ2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.24e-57 2.89e-121 0.9072
1. PBF P66977 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.29e-43 3.45e-47 0.8627
1. PBF Q9CHA1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.26e-56 6.32e-111 0.9068
1. PBF A1TWB8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.07e-46 1.24e-113 0.9171
1. PBF Q820U1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.26e-54 6.26e-111 0.9203
1. PBF P75365 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.59e-53 1.13e-86 0.9549
1. PBF B2RHP0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.81e-49 8.48e-62 0.9239
1. PBF Q5ZKW0 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 2.49e-35 3.38e-92 0.9055
1. PBF A5IJQ4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.18e-56 4.07e-66 0.9224
1. PBF A7FT69 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 3.72e-51 1.24e-77 0.9155
1. PBF B1X0U7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.61e-53 3.11e-72 0.9232
1. PBF Q5LST9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.81e-43 1.99e-55 0.8656
1. PBF Q8A0Y3 tRNA-specific 2-thiouridylase MnmA 3 0.00e+00 2.46e-42 2.04e-53 0.868
1. PBF A5UFX6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.15e-40 5.76e-116 0.9107
1. PBF B2THM7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.06e-49 1.62e-77 0.923
1. PBF Q98HL0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.02e-36 2.63e-55 0.8752
1. PBF A1KN20 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.29e-43 3.45e-47 0.8637
1. PBF B2UV99 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.90e-44 3.29e-51 0.8984
1. PBF A0K4M4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.87e-33 2.22e-104 0.9064
1. PBF C0R4S5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.90e-40 1.51e-43 0.8703
1. PBF B1KZE1 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 1.86e-48 2.66e-79 0.9126
1. PBF Q4A634 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.63e-62 7.79e-145 0.9387
1. PBF C3PN11 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.22e-53 8.91e-55 0.9057
1. PBF Q5ZVQ1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.03e-56 7.01e-125 0.9498
1. PBF Q6MA75 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.43e-44 5.65e-104 0.9227
1. PBF Q1IPC9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.84e-55 1.04e-66 0.8655
1. PBF B1HUL3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.25e-52 6.92e-122 0.9205
1. PBF Q8X735 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.16e-61 6.20e-120 0.9341
1. PBF Q8KBD3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.81e-54 3.72e-72 0.8446
1. PBF Q3AV73 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.48e-33 5.99e-57 0.857
1. PBF Q2RSS1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.46e-45 5.74e-59 0.8575
1. PBF A0LEL7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.23e-48 2.02e-57 0.908
1. PBF Q0TIU0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.16e-61 6.51e-119 0.9338
1. PBF A5FHA9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.11e-49 4.66e-97 0.9116
1. PBF Q3BTY6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.11e-47 6.09e-106 0.912
1. PBF Q47SD2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.05e-45 3.36e-48 0.8748
1. PBF Q1GAS1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.14e-59 5.24e-115 0.9142
1. PBF Q8PL08 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.08e-47 5.01e-107 0.914
1. PBF B2V3V9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.06e-50 4.79e-74 0.921
1. PBF A0KW11 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.24e-51 1.43e-126 0.922
1. PBF Q7MB22 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.00e-61 8.05e-118 0.9301
1. PBF A4J2K1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.32e-55 7.37e-72 0.8951
1. PBF Q2K4M8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.07e-34 3.93e-57 0.8782
1. PBF B3CLZ0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.83e-38 4.15e-42 0.8676
1. PBF Q2YT57 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.99e-51 2.27e-124 0.9287
1. PBF Q3KA70 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.58e-53 1.65e-118 0.9165
1. PBF Q9I0L2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.10e-54 3.72e-122 0.9168
1. PBF Q02NB8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.10e-54 3.72e-122 0.9155
1. PBF Q8RAH7 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 1.22e-53 2.21e-79 0.9014
1. PBF Q9JTJ9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.42e-56 1.40e-106 0.9386
1. PBF A7GCM3 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 3.66e-49 5.75e-78 0.9152
1. PBF Q2IHX6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.04e-48 1.66e-55 0.8994
1. PBF Q68X66 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.77e-59 3.44e-54 0.9041
1. PBF Q4UM73 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.34e-54 6.38e-56 0.8969
1. PBF Q3JYG1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.43e-53 1.37e-110 0.9103
1. PBF Q5PMJ4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.00e-61 1.88e-119 0.9313
1. PBF C1AGE1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.29e-43 3.45e-47 0.864
1. PBF A9BIS3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.47e-58 4.19e-62 0.8716
1. PBF Q1GRI1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.26e-35 2.77e-53 0.8266
1. PBF A1SMB0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.01e-39 3.84e-46 0.8921
1. PBF A3MYN0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.65e-37 4.62e-114 0.9107
1. PBF A3PEC4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.08e-38 2.38e-62 0.8523
1. PBF Q2G2Z1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.47e-36 3.85e-56 0.8552
1. PBF Q4A7U1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.17e-61 3.48e-136 0.9471
1. PBF Q07SU0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.42e-30 1.66e-50 0.873
1. PBF B0UWF2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.10e-40 5.16e-121 0.9138
1. PBF A1UE63 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.54e-47 2.73e-51 0.8836
1. PBF Q1JED4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.35e-54 1.06e-109 0.9116
1. PBF O86583 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.86e-43 1.89e-40 0.8813
1. PBF Q74A22 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.04e-50 4.38e-78 0.905
1. PBF A7ZKS3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.71e-61 3.97e-120 0.9343
1. PBF A9HMI3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.81e-49 4.36e-41 0.8863
1. PBF A9BBQ7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.51e-34 7.53e-57 0.8631
1. PBF Q8NW84 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.22e-51 2.07e-123 0.9293
1. PBF Q4K9U2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.49e-50 4.30e-118 0.9105
1. PBF A9IWH0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.37e-31 1.27e-54 0.8695
1. PBF Q8F625 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.07e-51 4.42e-54 0.8581
1. PBF A4SD47 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.88e-55 3.10e-68 0.8713
1. PBF Q8NR24 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.07e-45 2.32e-41 0.8717
1. PBF B2I9X8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.83e-41 2.00e-100 0.9109
1. PBF Q8P9A1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.80e-45 1.30e-105 0.9115
1. PBF A7HV69 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.85e-31 3.15e-50 0.8686
1. PBF B1I677 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.43e-44 4.53e-56 0.914
1. PBF Q5KWT8 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 5.04e-51 2.78e-130 0.9266
1. PBF Q39XA9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.28e-51 2.05e-73 0.8971
1. PBF A7HNX2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.37e-55 2.35e-53 0.9149
1. PBF A0Q454 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.18e-56 1.70e-117 0.948
1. PBF A7GZX4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.19e-50 3.64e-48 0.9068
1. PBF A7Z745 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.53e-51 1.48e-121 0.9225
1. PBF Q5LXJ9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.30e-53 1.85e-111 0.9134
1. PBF Q7TTZ4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.18e-48 6.85e-63 0.8669
1. PBF Q6MLR7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.34e-58 9.74e-61 0.9063
1. PBF B1LI10 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.21e-60 4.99e-120 0.9344
1. PBF A4VYE7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.01e-52 5.00e-113 0.9101
1. PBF B4EE50 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.63e-33 5.77e-104 0.9066
1. PBF Q8A2F1 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 6.07e-48 1.30e-44 0.8321
1. PBF Q81JE5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.30e-56 4.54e-126 0.9274
1. PBF A8GDD5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.24e-60 2.41e-123 0.9352
1. PBF B6IZW5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.19e-45 9.99e-111 0.9187
1. PBF O67274 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.75e-55 2.82e-66 0.9167
1. PBF Q04TZ4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.34e-47 1.90e-55 0.8552
1. PBF Q1GGT2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.42e-39 7.91e-54 0.8644
1. PBF A8FUG9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.18e-53 1.19e-123 0.9233
1. PBF P73755 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.49e-52 8.04e-77 0.9077
1. PBF B2UPK4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.29e-56 1.25e-80 0.9371
1. PBF Q17Z16 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.02e-42 1.78e-51 0.8988
1. PBF Q1BZ27 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.87e-33 2.22e-104 0.9068
1. PBF B0SWD8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.22e-30 3.11e-49 0.8731
1. PBF A1B9H0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.85e-39 8.91e-48 0.8648
1. PBF B5ENY8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.31e-49 1.79e-65 0.8973
1. PBF A6Q941 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.98e-57 1.17e-57 0.9121
1. PBF Q5PBB1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.16e-36 1.93e-49 0.8404
1. PBF A6U290 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 0.9289
1. PBF A0AIW1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.79e-44 1.44e-124 0.9266
1. PBF Q2A5X5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.07e-55 2.37e-118 0.9491
1. PBF Q72Q44 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.59e-51 4.37e-54 0.8557
1. PBF P59460 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.63e-62 9.04e-106 0.9348
1. PBF Q5WHN4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.32e-54 5.65e-122 0.9448
1. PBF A8G6A1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.38e-36 4.59e-65 0.8619
1. PBF Q73PV6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.28e-51 2.55e-67 0.891
1. PBF A6UCQ0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.73e-36 1.02e-54 0.8694
1. PBF A1BI85 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.03e-52 7.16e-64 0.8656
1. PBF B0K584 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 9.13e-54 6.01e-74 0.8981
1. PBF B1ILH4 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 9.57e-57 4.01e-70 0.9312
1. PBF A2SLT0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.09e-47 1.64e-107 0.903
1. PBF C1F792 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.13e-54 4.95e-67 0.8584
1. PBF A4SKS0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.40e-58 3.08e-122 0.9223
1. PBF Q5GTC8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.44e-39 3.01e-42 0.8678
1. PBF Q2SJL8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.14e-56 1.45e-114 0.9391
1. PBF B9KEW8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.01e-54 2.56e-56 0.9131
1. PBF C5B8B9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.11e-59 1.34e-121 0.9303
1. PBF Q057R1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.68e-56 1.19e-93 0.9239
1. PBF Q131Q8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.22e-35 1.40e-50 0.8609
1. PBF Q83LF7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.09e-60 6.99e-120 0.935
1. PBF Q2FGA5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 0.928
1. PBF B9MIA2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.90e-48 3.96e-111 0.9286
1. PBF Q5M249 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.30e-53 1.85e-111 0.9134
1. PBF Q89ES7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.53e-39 7.05e-46 0.8572
1. PBF A3MP84 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.04e-39 5.90e-112 0.9105
1. PBF B1JI67 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-56 1.19e-118 0.9207
1. PBF B0SG84 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.23e-48 1.43e-53 0.8777
1. PBF Q2ISK2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.30e-34 3.99e-51 0.8608
1. PBF B8E945 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.59e-51 1.83e-128 0.9196
1. PBF Q2J6U1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.48e-44 8.52e-39 0.9015
1. PBF B1ZGZ6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.79e-41 7.65e-53 0.8634
1. PBF Q03EZ6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.91e-54 3.94e-120 0.9259
1. PBF Q3ATZ5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.60e-59 1.09e-65 0.8669
1. PBF Q5NPG7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.08e-40 4.80e-62 0.8428
1. PBF A7MSW1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.08e-58 8.51e-133 0.9163
1. PBF B1VAX7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.29e-64 1.04e-125 0.941
1. PBF C1KVF9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.69e-46 2.33e-123 0.928
1. PBF Q88V96 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.56e-53 6.93e-118 0.9318
1. PBF P0DC34 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.20e-52 7.03e-107 0.9116
1. PBF Q64P39 tRNA-specific 2-thiouridylase MnmA 3 0.00e+00 2.21e-42 4.60e-55 0.869
1. PBF B2GL48 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.94e-27 2.49e-37 0.8622
1. PBF Q5HBV2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.57e-40 2.63e-48 0.8694
1. PBF B0TQ02 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.15e-56 1.01e-121 0.92
1. PBF Q8R7F0 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 1.22e-55 1.38e-76 0.9127
1. PBF A6KZ28 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 1.53e-56 7.02e-51 0.8897
1. PBF B2HIE6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.28e-44 6.20e-51 0.8727
1. PBF Q2LWA6 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 9.93e-46 1.28e-64 0.8789
1. PBF A5GUP6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.22e-29 1.26e-53 0.864
1. PBF Q98Q11 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.24e-60 2.55e-147 0.9444
1. PBF Q02BG1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.88e-56 8.09e-72 0.8874
1. PBF A2BXZ8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.56e-39 4.58e-61 0.8589
1. PBF A5FR85 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.24e-60 3.17e-55 0.8877
1. PBF Q65GR9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.79e-52 2.40e-119 0.9286
1. PBF A1WD47 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.35e-48 1.61e-109 0.9173
1. PBF A8ES35 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 1.68e-56 1.34e-55 0.9081
1. PBF A3PJ71 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.94e-43 1.46e-52 0.8579
1. PBF Q2W2V2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.28e-44 3.41e-58 0.8825
1. PBF A9WFH2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.47e-51 4.69e-51 0.9096
1. PBF Q72DX2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.26e-44 2.94e-50 0.9022
1. PBF B4EVG2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.79e-63 3.46e-121 0.9319
1. PBF Q039P7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.12e-48 3.73e-122 0.9142
1. PBF Q92IL0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.01e-49 9.47e-56 0.8869
1. PBF Q9WYZ0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.87e-56 2.08e-64 0.9256
1. PBF A1VFH0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.07e-43 5.62e-51 0.9018
1. PBF Q2RZN9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.21e-48 7.60e-67 0.8777
1. PBF A9WMS3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.19e-38 2.71e-48 0.8783
1. PBF Q8YX56 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.88e-55 3.77e-73 0.9276
1. PBF Q5FFJ0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.17e-41 6.77e-50 0.8706
1. PBF A6KZV1 tRNA-specific 2-thiouridylase MnmA 3 0.00e+00 1.21e-54 5.87e-59 0.8543
1. PBF Q8DRS4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.96e-54 1.14e-109 0.9136
1. PBF A7ZZ88 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.71e-61 3.97e-120 0.9314
1. PBF A5EVB4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.61e-52 1.86e-100 0.9159
1. PBF Q600M2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.52e-60 3.44e-136 0.947
1. PBF A1VTY5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.20e-43 4.40e-106 0.9031
1. PBF A5D3F0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.07e-48 2.56e-73 0.9134
1. PBF Q5SLN5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.35e-49 7.14e-65 0.867
1. PBF Q8K9Q8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.75e-58 3.35e-98 0.9444
1. PBF Q7MBE1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.15e-25 1.19e-109 0.9055
1. PBF Q1LT51 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.76e-62 6.50e-109 0.9338
1. PBF Q8U9M5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.77e-40 2.79e-57 0.8806
1. PBF B0VUD6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.39e-53 5.32e-110 0.9015
1. PBF A0KI53 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.04e-59 9.81e-123 0.9265
1. PBF A9VIM2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.06e-56 3.41e-125 0.9239
1. PBF A1R0A7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.70e-50 2.64e-68 0.9571
1. PBF B3R6Q0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.41e-50 5.43e-111 0.9399
1. PBF Q5E3W7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.02e-54 1.05e-128 0.9166
1. PBF B1I833 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.71e-55 6.34e-110 0.9147
1. PBF A9KPI9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.03e-52 3.51e-79 0.8953
1. PBF Q31ZK9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.28e-61 3.44e-120 0.936
1. PBF B5XJA6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.11e-52 1.20e-109 0.9116
1. PBF B8DDZ8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.89e-45 7.74e-123 0.9277
1. PBF A3D5F8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.59e-51 1.83e-128 0.9241
1. PBF Q87ZR6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.24e-50 1.10e-117 0.9181
1. PBF Q7U342 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.39e-39 1.65e-122 0.9102
1. PBF Q5QYZ7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.33e-62 4.35e-131 0.9186
1. PBF Q3Z2Y6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.09e-60 7.14e-120 0.9342
1. PBF C1CBU0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.05e-54 2.36e-110 0.9154
1. PBF Q04ZN1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.34e-47 1.90e-55 0.8648
1. PBF B1JBJ1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.90e-52 4.37e-119 0.9179
1. PBF A8GRJ5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.80e-53 8.36e-55 0.8865
1. PBF B7J2N7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.32e-52 3.28e-73 0.9606
1. PBF Q6G8U8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.22e-51 2.07e-123 0.9293
1. PBF Q7VAT9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.72e-31 3.47e-52 0.863
1. PBF Q21K42 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.89e-43 2.05e-116 0.9227
1. PBF A6LIF1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.96e-47 5.51e-64 0.9293
1. PBF B0KC14 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 4.84e-55 2.36e-74 0.8946
1. PBF A4WTT2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.39e-43 7.77e-50 0.8596
1. PBF A2RH05 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.77e-52 1.30e-108 0.912
1. PBF Q6MTG1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.09e-93 0.0 0.9972
1. PBF B9IYG1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.68e-57 4.64e-126 0.9272
1. PBF B0TW32 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.33e-57 1.85e-113 0.9492
1. PBF Q04B58 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.65e-59 1.20e-114 0.9145
1. PBF A9N4K8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.00e-61 1.88e-119 0.9333
1. PBF P47537 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.66e-58 1.79e-96 0.9463
1. PBF A5ITE6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 0.9293
1. PBF B5Z8Y2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.69e-43 4.17e-49 0.8973
1. PBF Q38XI3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.54e-47 1.17e-115 0.9246
1. PBF B5RQ24 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.00e-54 1.08e-70 0.9565
1. PBF A2C457 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.06e-31 4.50e-60 0.8514
1. PBF Q6NA79 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.47e-36 3.30e-52 0.8644
1. PBF Q47AW0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.98e-51 3.38e-110 0.9218
1. PBF B5ZBP8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.95e-63 6.70e-136 0.9407
1. PBF Q9KDF2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.58e-50 3.88e-125 0.9299
1. PBF B1VZW7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.08e-36 7.26e-42 0.8807
1. PBF P66979 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.06e-52 4.23e-111 0.9105
1. PBF Q0SS39 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.31e-53 1.04e-77 0.9066
1. PBF Q6AEE4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.90e-42 8.51e-42 0.8766
1. PBF Q042R4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.13e-54 9.15e-121 0.9055
1. PBF Q5X5H6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.47e-57 1.05e-125 0.9506
1. PBF Q1LJ45 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.39e-50 1.79e-111 0.9459
1. PBF B2FQX2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.97e-39 4.23e-111 0.9123
1. PBF A1U1H5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.45e-41 6.61e-122 0.91
1. PBF Q62H98 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.04e-39 5.90e-112 0.9105
1. PBF C0MB53 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.45e-54 2.61e-107 0.9075
1. PBF Q15T93 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.66e-31 9.39e-133 0.9091
1. PBF B4SIN4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.49e-41 1.44e-110 0.9134
1. PBF B0TFA7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.38e-41 4.02e-72 0.8672
1. PBF Q0AZQ5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.04e-54 4.87e-65 0.9453
1. PBF Q4L6W8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.46e-50 1.54e-123 0.9314
1. PBF B7K1G5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.27e-60 1.58e-75 0.9314
1. PBF A9A0S9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.69e-43 1.04e-56 0.8647
1. PBF P9WJS4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.29e-43 3.45e-47 0.862
1. PBF B0KMQ6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.34e-57 1.50e-119 0.9158
1. PBF A4QDK1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.07e-45 2.32e-41 0.8567
1. PBF Q3B625 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.01e-44 2.14e-71 0.8598
1. PBF Q492R5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.01e-60 2.55e-109 0.9301
1. PBF Q0HW33 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.29e-52 3.13e-129 0.9223
1. PBF A1WWV9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.36e-47 3.68e-90 0.9112
1. PBF B0K0P8 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 4.32e-59 4.74e-78 0.9142
1. PBF Q57QC0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.27e-61 1.84e-119 0.9315
1. PBF A5ED38 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.42e-33 4.38e-51 0.8708
1. PBF Q0I5Y6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.36e-40 6.58e-118 0.9174
1. PBF Q0SMH1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.99e-52 1.27e-73 0.9574
1. PBF A6V4G0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.87e-52 5.61e-121 0.9165
1. PBF B5FG83 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.74e-55 1.07e-128 0.9141
1. PBF B3PYW4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.94e-35 7.11e-57 0.8695
1. PBF Q1J090 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-37 7.68e-67 0.8747
1. PBF A9IQK6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-50 5.02e-106 0.891
1. PBF A7N9A5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.07e-55 2.37e-118 0.9491
1. PBF Q3JNT6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.15e-40 2.55e-112 0.9095
1. PBF Q8ABF5 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 3.34e-56 1.38e-65 0.9358
1. PBF Q0VQ25 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.24e-50 9.94e-117 0.9383
1. PBF A8FFP0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.81e-52 4.42e-122 0.9242
1. PBF B1XX60 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.24e-51 6.40e-114 0.9192
1. PBF Q5HFE1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 0.9289
1. PBF A3NDE4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.89e-40 1.73e-112 0.9121
1. PBF A8F172 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.80e-55 5.24e-57 0.8914
1. PBF C4K1W0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.19e-55 2.46e-55 0.8932
1. PBF Q2YQB2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.25e-37 2.27e-54 0.869
1. PBF B1KID0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.90e-48 2.62e-124 0.9051
1. PBF A9MG80 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.73e-60 2.46e-120 0.9313
1. PBF A8GVU7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.99e-53 3.15e-53 0.894
1. PBF Q73FR5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.25e-39 7.01e-45 0.8707
1. PBF B1YTE9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.34e-33 3.82e-111 0.9034
1. PBF A3CRB2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.30e-55 5.75e-110 0.9102
1. PBF B9DWD3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.84e-55 4.11e-109 0.9109
1. PBF Q83HX5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.23e-52 2.14e-44 0.8991
1. PBF B9KR64 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.69e-45 1.49e-52 0.8624
1. PBF Q9RTK1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.19e-35 6.29e-67 0.8718
1. PBF A4J081 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.41e-55 1.66e-117 0.9484
1. PBF Q0C4H3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.64e-39 9.57e-49 0.8617
1. PBF A7X333 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.53e-51 5.14e-124 0.9285
1. PBF Q6FCW2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.55e-52 7.23e-109 0.9089
1. PBF Q67LS2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.57e-39 6.58e-81 0.8787
1. PBF Q1RD20 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.16e-61 6.51e-119 0.9341
1. PBF Q3AA24 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.40e-57 1.47e-86 0.9063
1. PBF Q607H5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.30e-54 1.56e-121 0.9302
1. PBF Q2JY34 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.22e-41 1.17e-60 0.8719
1. PBF Q31N30 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.44e-47 1.12e-74 0.91
1. PBF Q820Y1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.16e-52 2.55e-44 0.8995
1. PBF A7I2L9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.31e-40 1.46e-46 0.8474
1. PBF Q82JK2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.38e-42 3.46e-42 0.8831
1. PBF B8CWH7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.62e-53 4.74e-72 0.887
1. PBF Q0ADM9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.83e-51 1.10e-111 0.9484
1. PBF Q820W2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.52e-55 7.86e-111 0.9416
1. PBF B1L8X5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.60e-55 8.50e-67 0.9276
1. PBF Q6F152 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-69 0.0 0.9943
1. PBF B0U6Q7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.38e-41 9.35e-101 0.9118
1. PBF B4U0P1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.04e-54 2.29e-108 0.9077
1. PBF Q9PQ88 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.79e-63 1.65e-130 0.9447
1. PBF B9KBD1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.05e-56 7.43e-65 0.9208
1. PBF O25893 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.70e-45 8.73e-51 0.8992
1. PBF Q3J9J6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.43e-52 4.94e-110 0.9319
1. PBF A1JLK6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.96e-57 4.36e-121 0.9165
1. PBF A5IBN1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.86e-57 4.94e-125 0.95
1. PBF B1IUD4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.71e-61 3.97e-120 0.9385
1. PBF Q9ZDM1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.89e-59 4.58e-54 0.9112
1. PBF A0Q152 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.10e-48 1.00e-72 0.9037
1. PBF P66978 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.06e-52 4.23e-111 0.9082
1. PBF Q319J8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.08e-38 6.10e-64 0.8575
1. PBF Q5GZR1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.58e-45 3.86e-106 0.9104
1. PBF Q5YRS5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.08e-35 7.14e-46 0.8571
1. PBF Q8CX40 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.20e-52 3.40e-128 0.926
1. PBF Q6HDD0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.68e-57 4.64e-126 0.9273
1. PBF Q3KM75 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.09e-55 4.43e-105 0.9396
1. PBF B2SMD7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.58e-45 3.86e-106 0.9139
1. PBF Q21AM9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.55e-30 1.88e-52 0.8685
1. PBF Q7MLT4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.01e-60 2.35e-133 0.9152
1. PBF B3E966 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.32e-48 4.02e-65 0.9212
1. PBF B2JGI9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.91e-35 2.02e-110 0.9088
1. PBF Q92MB5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.37e-38 5.10e-55 0.8604
1. PBF B8ZS29 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.47e-51 7.97e-53 0.885
1. PBF A4SZU5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.33e-43 2.48e-104 0.9175
1. PBF Q8CXC7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.32e-55 7.93e-121 0.9288
1. PBF A8HVS0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.11e-38 4.66e-55 0.8694
1. PBF Q145K0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.09e-37 8.85e-111 0.9122
1. PBF Q480B8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.27e-52 3.15e-121 0.913
1. PBF Q5F7G4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.51e-56 5.88e-110 0.9404
1. PBF Q1C6S0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-56 1.19e-118 0.9231
1. PBF A4XUY9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.58e-55 7.23e-120 0.9239
1. PBF A3DDC8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.86e-55 4.67e-77 0.8954
1. PBF A5U737 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.29e-43 3.45e-47 0.8613
1. PBF Q6FZ46 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.27e-27 2.95e-53 0.8695
1. PBF B2GB92 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.63e-50 8.12e-123 0.9273
1. PBF Q12N64 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.38e-52 3.97e-122 0.9195
1. PBF A4W9E5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.21e-59 2.39e-117 0.9307
1. PBF P0DC35 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.20e-52 7.03e-107 0.9125
1. PBF B2SX74 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.65e-40 1.86e-113 0.9178
1. PBF Q1CRS3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.44e-47 1.39e-51 0.8992
1. PBF B3PM68 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.05e-65 2.94e-144 0.9517
1. PBF A9BS40 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.95e-48 3.33e-104 0.9272
1. PBF Q1J455 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.77e-52 1.30e-108 0.9119
1. PBF A8AHK2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.14e-61 1.12e-120 0.9314
1. PBF Q8XJH3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.39e-52 7.59e-77 0.9178
1. PBF B0CI68 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-37 2.37e-54 0.8682
1. PBF B2S125 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.54e-54 6.55e-70 0.957
1. PBF A5VFM2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.82e-39 1.62e-56 0.8364
1. PBF Q5NEF9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.54e-55 2.98e-118 0.9481
1. PBF Q03I88 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.90e-52 5.92e-111 0.9141
1. PBF Q122U9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.08e-38 3.76e-111 0.9058
1. PBF A3M7G3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.20e-53 7.22e-110 0.9055
1. PBF Q4JUL5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.20e-27 2.36e-42 0.8452
1. PBF A5F2F2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.65e-54 5.99e-133 0.9252
1. PBF Q2NU15 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.09e-60 1.00e-117 0.9258
1. PBF A6H0G9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.28e-49 3.96e-90 0.9084
1. PBF C0REM2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.25e-37 2.27e-54 0.8655
1. PBF Q166E3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.56e-41 7.86e-57 0.8529
1. PBF Q2P2Q7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.88e-45 4.30e-103 0.9118
1. PBF B8IU32 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.91e-39 1.75e-51 0.862
1. PBF C3PFT7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.05e-47 2.19e-47 0.8696
1. PBF Q2LVR6 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 2.88e-17 6.04e-62 0.8752
1. PBF A0QUW3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.09e-44 1.54e-52 0.8636
1. PBF Q28PD8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.07e-37 8.88e-51 0.8634
1. PBF Q5X9C1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.77e-52 1.30e-108 0.912
1. PBF Q99TM8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 0.9293
1. PBF Q39JI1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.43e-34 5.39e-108 0.9079
1. PBF B1LV15 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.34e-39 2.22e-58 0.867
1. PBF Q5FR73 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.95e-44 2.89e-48 0.8796
1. PBF Q04MV1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.94e-56 1.04e-110 0.9155
1. PBF O33099 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.47e-51 7.97e-53 0.883
1. PBF A1R863 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.64e-39 5.51e-47 0.8748
1. PBF A8GMY3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.84e-55 3.12e-53 0.901
1. PBF Q0ARV1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.73e-29 1.09e-51 0.8654
1. PBF C5CB51 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.20e-37 3.43e-42 0.8781
1. PBF Q48H61 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.34e-50 1.30e-117 0.9184
1. PBF Q8R5X3 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 3.11e-43 5.92e-60 0.8555
1. PBF A0PPW5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.28e-44 6.20e-51 0.8744
1. PBF Q46XF1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.19e-50 1.74e-112 0.9429
1. PBF Q5WWV9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.58e-57 2.41e-125 0.95
1. PBF A9NFP7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.93e-57 9.82e-133 0.9435
1. PBF A9KE87 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.50e-55 7.52e-111 0.9434
1. PBF B7I4K8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.20e-53 7.22e-110 0.9033
1. PBF Q4A9Q7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.52e-60 3.44e-136 0.9503
1. PBF Q8XVV4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.41e-49 6.54e-111 0.9185
1. PBF Q634E9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.68e-57 4.64e-126 0.9279
1. PBF Q6KHK4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.96e-59 1.82e-142 0.9386
1. PBF Q6GG82 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 0.9295
1. PBF A8EZE8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.31e-56 4.97e-52 0.8871
1. PBF B2IRK2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.05e-55 2.74e-110 0.9155
1. PBF A5CQU4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.54e-27 1.73e-42 0.8594
1. PBF A4TDZ4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.76e-46 1.48e-52 0.8863
1. PBF Q0HJT7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.59e-51 2.39e-127 0.9213
1. PBF Q9Z8A5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.48e-53 6.48e-100 0.9359
1. PBF A7FXG3 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 9.76e-56 7.41e-71 0.9281
1. PBF A4XLP5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.61e-56 2.00e-70 0.9217
1. PBF Q7TTR0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.09e-34 1.61e-59 0.8647
1. PBF A7GT74 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.49e-56 3.75e-128 0.9274
1. PBF Q896F5 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 1.21e-54 5.43e-71 0.8928
1. PBF Q4UUJ7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.80e-45 1.30e-105 0.9116
1. PBF B1VFZ9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.99e-19 1.85e-37 0.8351
1. PBF Q6A8Q1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.34e-48 2.33e-54 0.8865
1. PBF Q11G66 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.13e-39 5.02e-58 0.8693
1. PBF Q4ZRK0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.67e-51 4.74e-118 0.9161
1. PBF Q1QBM4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.43e-38 2.37e-109 0.9027
1. PBF A6VLY4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.94e-35 1.96e-106 0.9115
1. PBF O84289 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.86e-55 1.76e-105 0.9368
1. PBF A4Z082 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.13e-34 6.48e-52 0.8714
1. PBF B9DNH6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.73e-53 1.34e-126 0.9286
1. PBF A1AX17 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.24e-55 2.87e-110 0.9437
1. PBF B1ZZ32 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.83e-54 4.88e-79 0.8824
1. PBF Q660I8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.99e-53 2.42e-74 0.953
1. PBF Q0BI73 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.76e-37 5.82e-113 0.9105
1. PBF Q1D6N0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.09e-44 9.93e-57 0.9145
1. PBF B1KZJ2 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 2.81e-56 5.98e-71 0.9269
1. PBF Q6AIZ6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.09e-52 2.11e-55 0.9182
1. PBF B2K711 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-56 1.19e-118 0.9204
1. PBF Q7M8I9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.33e-48 2.48e-49 0.888
1. PBF B2J5L9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.54e-58 1.43e-74 0.9152
1. PBF Q64WG8 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 1.00e-53 1.06e-65 0.9334
1. PBF B0JVR4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.27e-57 3.26e-75 0.9308
1. PBF Q1RJ52 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.99e-53 3.15e-53 0.8908
1. PBF B0BS63 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.92e-36 5.13e-115 0.9079
1. PBF Q5HXB2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.56e-51 1.91e-53 0.9178
1. PBF Q8D397 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.16e-53 3.78e-108 0.93
1. PBF A1UTJ1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.85e-39 2.39e-54 0.8785
1. PBF B6JCC3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.53e-36 1.38e-50 0.8578
1. PBF A8L536 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.44e-47 5.59e-42 0.9005
1. PBF Q8CXQ3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.01e-59 3.32e-115 0.9493
1. PBF Q57BT1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.25e-37 2.27e-54 0.8648
1. PBF Q0BP64 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.07e-55 2.37e-118 0.9488
1. PBF A8H5M1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.24e-54 1.15e-122 0.92
1. PBF B2HVN5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.83e-53 5.94e-110 0.9058
1. PBF Q7U359 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.49e-52 2.02e-104 0.9096
1. PBF B4U7E2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.00e-53 1.67e-62 0.8919
1. PBF A6KXF7 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 2.16e-54 1.36e-63 0.9254
1. PBF A1RIW8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.05e-51 1.97e-127 0.9212
1. PBF Q8CWM0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.65e-46 3.49e-69 0.8815
1. PBF P44551 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.07e-40 5.62e-117 0.9061
1. PBF Q8R5Z5 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 6.36e-47 9.75e-52 0.9012
1. PBF B2TZ86 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.28e-61 3.46e-119 0.9339
1. PBF Q8CWJ6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.60e-62 3.30e-133 0.9162
1. PBF Q3ZXD7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.24e-60 3.17e-55 0.8864
1. PBF B7GZ21 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.20e-53 7.22e-110 0.9046
1. PBF Q7MBC9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.71e-52 4.81e-63 0.9029
1. PBF Q2JM78 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.46e-43 1.43e-61 0.8722
1. PBF B1XM11 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.47e-55 5.06e-75 0.9287
1. PBF Q3M5R7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.75e-54 1.72e-72 0.9208
1. PBF Q03QJ0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.33e-46 1.16e-117 0.9209
1. PBF A8ES36 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 6.96e-55 1.02e-92 0.9304
1. PBF Q2N6A6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.13e-32 5.02e-54 0.8475
1. PBF A7HCV7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.45e-53 1.50e-61 0.9224
1. PBF Q3SV21 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.19e-36 1.68e-50 0.8681
1. PBF C5C2D6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.83e-39 1.15e-44 0.8654
1. PBF P58075 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.92e-52 2.14e-109 0.912
1. PBF Q1MRW7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.64e-40 5.13e-32 0.8738
1. PBF Q5L8X6 tRNA-specific 2-thiouridylase MnmA 3 0.00e+00 4.29e-42 3.17e-55 0.8704
1. PBF Q46JH9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.09e-34 8.66e-59 0.8596
1. PBF A6Q239 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.10e-50 7.56e-56 0.9189
1. PBF Q3YSN0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.96e-43 8.10e-49 0.8732
1. PBF A3NZ55 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.15e-40 2.55e-112 0.9114
1. PBF Q1QUR7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.46e-47 2.33e-114 0.9201
1. PBF Q7U375 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.21e-53 2.02e-104 0.9096
1. PBF A4Y7M1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.56e-52 2.04e-129 0.9215
1. PBF B8CLH4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.24e-57 9.79e-122 0.9202
1. PBF A5VRW1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.25e-37 2.27e-54 0.8646
1. PBF A8Z5W4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.66e-43 8.87e-79 0.8814
1. PBF Q3SKH7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.16e-49 4.68e-105 0.9507
1. PBF A5GE36 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.09e-47 5.43e-75 0.8715
1. PBF B0S3R4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 7.16e-51 3.14e-122 0.9402
1. PBF B1MDW3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.07e-43 7.41e-54 0.8763
1. PBF A4IR87 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.32e-52 1.89e-130 0.9266
1. PBF A0L678 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.03e-48 6.54e-59 0.9039
1. PBF Q9PJ66 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.56e-51 1.91e-53 0.9177
1. PBF Q1QQB5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.76e-35 9.51e-51 0.8564
1. PBF A8M5E1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.11e-42 5.29e-45 0.882
1. PBF B8DRE0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.67e-46 5.29e-46 0.9049
1. PBF Q931Q6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.53e-51 5.14e-124 0.9285
1. PBF A2S5A6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.04e-39 5.90e-112 0.9101
1. PBF C1CAE7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.45e-56 5.26e-111 0.9153
1. PBF Q820E9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.70e-53 9.29e-103 0.9493
1. PBF Q8CSA5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.06e-50 7.98e-125 0.9273
1. PBF A5UV64 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.71e-52 1.94e-60 0.8766
1. PBF Q669Q4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-56 1.19e-118 0.9205
1. PBF A1KUY0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.41e-55 2.13e-108 0.936
1. PBF Q32EZ1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.24e-61 1.91e-120 0.9341
1. PBF A4TLN3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-56 1.19e-118 0.9213
1. PBF A9M0Y5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.90e-56 7.57e-109 0.9396
1. PBF Q1JJD5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.55e-52 8.61e-109 0.9115
1. PBF B1JVW3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.09e-32 7.35e-108 0.9088
1. PBF Q5HNS9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.06e-50 7.98e-125 0.9267
1. PBF A0M3J2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.47e-47 5.47e-99 0.9041
1. PBF C4LJJ9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.41e-36 1.36e-59 0.8515
1. PBF A9M700 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.38e-34 2.27e-54 0.8611
1. PBF Q7U353 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.92e-52 2.13e-111 0.9232
1. PBF Q1CI58 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-56 1.19e-118 0.9215
1. PBF B5XSN3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 3.13e-63 1.46e-121 0.9369
1. PBF P57349 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.32e-61 4.55e-112 0.9376
1. PBF A4G213 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 7.32e-109 0.9184
1. PBF B1IIY2 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 1.60e-49 1.14e-78 0.9082
1. PBF B8G5F1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.60e-49 2.49e-58 0.9133
1. PBF A9R0L5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.11e-56 1.19e-118 0.9219
1. PBF B0K991 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 4.32e-59 4.74e-78 0.9166
1. PBF Q0A8N7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 9.55e-52 7.99e-93 0.9365
1. PBF Q5FKU0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.04e-59 5.26e-119 0.9024
1. PBF B0RT32 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.80e-45 1.30e-105 0.9098
1. PBF Q7TTU4 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.42e-33 1.55e-57 0.8557
1. PBF Q0K720 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.19e-50 1.92e-110 0.9416
1. PBF Q2NIM9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.75e-59 6.30e-125 0.9391
1. PBF B2G6L9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.24e-54 1.22e-119 0.9269
1. PBF B7UV15 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.62e-54 2.14e-122 0.9156
1. PBF Q1GZF5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.68e-56 1.07e-112 0.9559
1. PBF Q894S7 tRNA-specific 2-thiouridylase MnmA 2 0.00e+00 5.93e-50 2.91e-75 0.9043
1. PBF Q5LIS5 tRNA-specific 2-thiouridylase MnmA 1 0.00e+00 1.11e-52 1.18e-43 0.8602
1. PBF Q48QM8 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.87e-52 7.73e-109 0.9116
1. PBF Q72GX1 tRNA-specific 2-thiouridylase MnmA 0.00e+00 6.35e-49 7.14e-65 0.8749
1. PBF Q253W3 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.26e-56 3.23e-99 0.9485
1. PBF Q18BE2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.68e-56 1.71e-77 0.9035
1. PBF Q6NHQ7 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.08e-47 3.77e-42 0.8646
1. PBF Q88FR9 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.43e-53 3.18e-119 0.9166
1. PBF Q30SP2 tRNA-specific 2-thiouridylase MnmA 0.00e+00 1.71e-57 8.81e-64 0.9252
1. PBF Q9ZJQ0 tRNA-specific 2-thiouridylase MnmA 0.00e+00 4.38e-45 6.28e-51 0.8965
1. PBF B7KHE5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.27e-54 2.89e-75 0.9384
2. PF Q5M8Z6 Argininosuccinate synthase 5.74e-03 3.87e-14 NA 0.5334
2. PF A8F446 Argininosuccinate synthase 6.06e-03 2.06e-08 NA 0.3547
2. PF A5FWI5 Argininosuccinate synthase 5.57e-03 1.02e-12 NA 0.4931
2. PF B2RMB4 tRNA(Ile)-lysidine synthase 1.92e-02 1.91e-07 NA 0.5685
2. PF A8Z067 Argininosuccinate synthase 6.71e-03 2.68e-12 NA 0.5799
2. PF P14568 Argininosuccinate synthase 5.53e-03 1.69e-12 NA 0.3566
2. PF Q6GIC7 Argininosuccinate synthase 5.36e-03 8.70e-12 NA 0.581
2. PF P63644 Argininosuccinate synthase 5.70e-03 2.68e-12 NA 0.5843
2. PF A0AKJ7 Argininosuccinate synthase 3.02e-03 9.25e-11 NA 0.5795
2. PF A3N2I9 tRNA(Ile)-lysidine synthase 6.90e-02 2.35e-05 NA 0.4524
2. PF C1EUX9 Argininosuccinate synthase 2.84e-03 3.46e-12 NA 0.5744
2. PF Q2YWS4 Argininosuccinate synthase 5.46e-03 5.19e-12 NA 0.5816
2. PF P61520 Argininosuccinate synthase 2.77e-03 4.24e-12 NA 0.5709
2. PF Q49WA0 Argininosuccinate synthase 6.78e-03 9.75e-12 NA 0.5835
2. PF O34347 Argininosuccinate synthase 3.19e-03 1.30e-10 NA 0.5703
2. PF B1MZP4 Argininosuccinate synthase 7.31e-03 5.81e-12 NA 0.5575
2. PF A7Z7M0 Argininosuccinate synthase 2.83e-03 2.11e-10 NA 0.5781
2. PF Q9X2A1 Argininosuccinate synthase 8.88e-03 3.07e-11 NA 0.3538
2. PF B2G6Y6 Argininosuccinate synthase 5.26e-03 9.71e-11 NA 0.5453
2. PF Q4L4X7 Argininosuccinate synthase 6.56e-03 1.32e-12 NA 0.5796
2. PF B9DIU4 Argininosuccinate synthase 5.10e-03 1.87e-12 NA 0.3668
2. PF Q8P8J4 Argininosuccinate synthase 4.01e-03 5.37e-15 NA 0.542
2. PF Q7VGR5 tRNA(Ile)-lysidine synthase 1.91e-03 2.51e-05 NA 0.4837
2. PF A5ILL1 Argininosuccinate synthase 5.51e-03 1.30e-11 NA 0.3606
2. PF P59603 Argininosuccinate synthase 6.00e-03 2.68e-11 NA 0.5656
2. PF B0TYH9 tRNA(Ile)-lysidine synthase 7.97e-02 6.36e-07 NA 0.4869
2. PF Q6HCP7 Argininosuccinate synthase 2.89e-03 1.02e-11 NA 0.5697
2. PF A6U068 Argininosuccinate synthase 5.68e-03 2.68e-12 NA 0.5807
2. PF Q032X6 Argininosuccinate synthase 3.56e-03 1.87e-11 NA 0.5346
2. PF C3L9T6 Argininosuccinate synthase 2.89e-03 5.60e-12 NA 0.5711
2. PF Q9K820 Argininosuccinate synthase 3.47e-03 5.54e-10 NA 0.5705
2. PF B9J0E1 Argininosuccinate synthase 2.76e-03 5.46e-12 NA 0.5709
2. PF Q033U7 Argininosuccinate synthase 6.29e-03 1.89e-13 NA 0.5443
2. PF B3QN91 Argininosuccinate synthase 5.56e-03 2.30e-12 NA 0.3622
2. PF Q65G67 Argininosuccinate synthase 2.93e-03 2.04e-11 NA 0.5635
2. PF B7HRS7 Argininosuccinate synthase 2.97e-03 4.13e-12 NA 0.5669
2. PF Q03W70 Argininosuccinate synthase 7.11e-03 1.13e-12 NA 0.4551
2. PF Q6AJ19 tRNA(Ile)-lysidine synthase 1.02e-02 7.92e-06 NA 0.5366
2. PF Q7UFW4 Argininosuccinate synthase 6.80e-03 6.74e-13 NA 0.3595
2. PF Q7PR38 Argininosuccinate synthase 5.97e-03 6.48e-13 NA 0.3502
2. PF Q1WV65 Argininosuccinate synthase 5.01e-03 1.13e-12 NA 0.5609
2. PF A5VJH1 Argininosuccinate synthase 5.28e-03 9.71e-11 NA 0.5053
2. PF B8DH28 Argininosuccinate synthase 3.06e-03 1.08e-10 NA 0.5706
2. PF Q81KV7 Argininosuccinate synthase 2.90e-03 5.60e-12 NA 0.571
2. PF A0RJM4 Argininosuccinate synthase 2.93e-03 3.46e-12 NA 0.5706
2. PF Q5KW94 Argininosuccinate synthase 3.30e-03 2.48e-11 NA 0.576
2. PF P63645 Argininosuccinate synthase 5.66e-03 2.68e-12 NA 0.5846
2. PF Q5HQK0 Argininosuccinate synthase 5.83e-03 6.00e-13 NA 0.5865
2. PF O67213 Argininosuccinate synthase 5.36e-03 1.27e-14 NA 0.371
2. PF Q2FIB4 Argininosuccinate synthase 5.90e-03 2.68e-12 NA 0.5821
2. PF C3PB97 Argininosuccinate synthase 2.93e-03 5.60e-12 NA 0.5709
2. PF A8FG70 Argininosuccinate synthase 2.94e-03 5.92e-13 NA 0.5653
2. PF Q6GAW5 Argininosuccinate synthase 6.79e-03 4.13e-12 NA 0.5815
2. PF Q2A488 tRNA(Ile)-lysidine synthase 7.95e-02 3.33e-08 NA 0.4738
2. PF A9VKE1 Argininosuccinate synthase 2.87e-03 1.43e-12 NA 0.5836
2. PF A7X0H5 Argininosuccinate synthase 5.62e-03 2.68e-12 NA 0.5777
2. PF B9K8S7 Argininosuccinate synthase 4.05e-03 6.68e-12 NA 0.3607
2. PF Q9PEM9 Argininosuccinate synthase 4.09e-03 3.61e-14 NA 0.5534
2. PF B7GGR4 Argininosuccinate synthase 2.86e-03 8.30e-13 NA 0.5797
2. PF Q8NXF2 Argininosuccinate synthase 6.05e-03 4.13e-12 NA 0.5809
2. PF A4IRS3 Argininosuccinate synthase 3.29e-03 3.30e-11 NA 0.5758
2. PF A7NB76 tRNA(Ile)-lysidine synthase 7.09e-02 3.33e-08 NA 0.4739
2. PF Q71XS4 Argininosuccinate synthase 3.03e-03 1.08e-10 NA 0.5464
2. PF Q1AS35 Argininosuccinate synthase 3.20e-03 1.72e-10 NA 0.3602
2. PF B7JS06 Argininosuccinate synthase 2.80e-03 6.94e-12 NA 0.5708
2. PF Q59491 Argininosuccinate synthase 3.31e-03 1.49e-11 NA 0.4389
2. PF Q8A7D1 tRNA(Ile)-lysidine synthase 7.09e-03 2.55e-07 NA 0.5756
2. PF A7GTR5 Argininosuccinate synthase 2.68e-03 1.92e-13 NA 0.5857
2. PF Q0BMM2 tRNA(Ile)-lysidine synthase 7.38e-02 3.33e-08 NA 0.4738
2. PF B1LAP4 Argininosuccinate synthase 6.93e-03 2.14e-11 NA 0.3601
2. PF A6LBU3 tRNA(Ile)-lysidine synthase 7.40e-03 2.06e-07 NA 0.5499
2. PF Q04FC0 Argininosuccinate synthase 6.02e-03 1.31e-14 NA 0.3798
2. PF Q929S9 Argininosuccinate synthase 3.07e-03 5.02e-11 NA 0.5628
2. PF Q7MR31 tRNA(Ile)-lysidine synthase 3.70e-03 4.84e-06 NA 0.4953
2. PF A0Q7B6 tRNA(Ile)-lysidine synthase 7.27e-02 2.67e-08 NA 0.4765
2. PF Q817C6 Argininosuccinate synthase 2.79e-03 2.71e-12 NA 0.5713
2. PF B0BRD5 tRNA(Ile)-lysidine synthase 6.42e-02 2.30e-05 NA 0.4732
2. PF B2SG31 tRNA(Ile)-lysidine synthase 6.49e-02 1.84e-08 NA 0.4767
2. PF Q14H05 tRNA(Ile)-lysidine synthase 6.87e-02 2.06e-08 NA 0.4764
2. PF C5D679 Argininosuccinate synthase 3.16e-03 3.88e-12 NA 0.5864
2. PF B3GYM3 tRNA(Ile)-lysidine synthase 6.49e-02 2.30e-05 NA 0.4647
2. PF Q8PK26 Argininosuccinate synthase 4.62e-03 3.04e-12 NA 0.5472
2. PF Q8CPU3 Argininosuccinate synthase 5.75e-03 6.00e-13 NA 0.5824
2. PF Q9PMK7 tRNA(Ile)-lysidine synthase 5.21e-03 1.11e-03 NA 0.4668
2. PF Q5HSX8 tRNA(Ile)-lysidine synthase 1.27e-02 1.15e-04 NA 0.4705
2. PF B7IK29 Argininosuccinate synthase 2.79e-03 6.12e-12 NA 0.5781
2. PF C1KX43 Argininosuccinate synthase 3.28e-03 1.08e-10 NA 0.5146
2. PF A2BJL6 Argininosuccinate synthase 2.43e-03 4.79e-17 NA 0.4292
2. PF Q8Y5H2 Argininosuccinate synthase 3.30e-03 7.34e-11 NA 0.5411
2. PF P57799 Argininosuccinate synthase 3.55e-03 1.18e-12 NA 0.5671
2. PF Q5NFK3 tRNA(Ile)-lysidine synthase 7.22e-02 2.06e-08 NA 0.4768
2. PF B7H6Y5 Argininosuccinate synthase 2.78e-03 2.71e-12 NA 0.5715
2. PF A4IXE6 tRNA(Ile)-lysidine synthase 7.86e-02 2.06e-08 NA 0.4741
2. PF P59606 Argininosuccinate synthase 4.53e-03 1.59e-13 NA 0.5481
2. PF Q7ZWM4 Argininosuccinate synthase 5.76e-03 2.19e-14 NA 0.4505
2. PF Q5WED8 Argininosuccinate synthase 3.11e-03 1.01e-10 NA 0.5361
2. PF Q5ZJ23 Argininosuccinate synthase 9.05e-03 7.26e-15 NA 0.3506
2. PF Q5HHC4 Argininosuccinate synthase 6.88e-03 2.68e-12 NA 0.5806
2. PF Q633G4 Argininosuccinate synthase 2.78e-03 3.46e-12 NA 0.5707
2. PF Q0IFL5 Argininosuccinate synthase 4.77e-03 2.92e-13 NA 0.5272
3. BF Q7NBZ0 Trifunctional protein RibF/MnmA 0.00e+00 NA 9.83e-92 0.9496
3. BF Q1AWB1 Bifunctional protein NifU/MnmA 0.00e+00 NA 1.14e-45 0.8275
4. PB Q503J2 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 1.04e-37 2.51e-82 NA
4. PB B5E605 tRNA-specific 2-thiouridylase MnmA NA 1.90e-56 3.13e-109 NA
4. PB P9WJS5 tRNA-specific 2-thiouridylase MnmA 0.00e+00 2.29e-43 3.45e-47 NA
4. PB Q54I63 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 8.59e-19 1.18e-72 NA
4. PB O13947 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 2.12e-31 6.52e-69 NA
4. PB Q2FXV6 tRNA-specific 2-thiouridylase MnmA 0.00e+00 5.06e-52 5.37e-124 NA
4. PB P25745 tRNA-specific 2-thiouridylase MnmA 0.00e+00 8.71e-61 3.97e-120 NA
4. PB B1WC37 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 1.05e-26 8.79e-85 NA
4. PB Q17440 Probable mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 7.64e-50 2.51e-78 NA
4. PB Q9W5B6 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 1.25e-43 4.77e-88 NA
4. PB Q8CXZ8 tRNA-specific 2-thiouridylase MnmA NA 4.39e-60 7.07e-118 NA
4. PB Q12093 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 9.11e-35 8.71e-56 NA
4. PB Q9DAT5 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 1.80e-30 1.81e-88 NA
4. PB O75648 Mitochondrial tRNA-specific 2-thiouridylase 1 0.00e+00 5.23e-29 5.66e-92 NA
5. P Q9WZ48 tRNA(Ile)-lysidine synthase 1.28e-02 3.60e-08 NA NA
5. P Q92L73 Argininosuccinate synthase 5.35e-03 8.92e-15 NA NA
5. P Q4ZPK0 Argininosuccinate synthase 4.14e-03 6.04e-12 NA NA
5. P C0MC74 tRNA(Ile)-lysidine synthase 1.04e-01 9.28e-05 NA NA
5. P B4EM48 Argininosuccinate synthase 2.08e-02 2.72e-07 NA NA
5. P A8IQ54 Argininosuccinate synthase 6.71e-03 4.46e-12 NA NA
5. P B0KBW5 Argininosuccinate synthase 4.49e-03 4.38e-13 NA NA
5. P Q899H5 tRNA(Ile)-lysidine synthase 1.01e-02 3.52e-07 NA NA
5. P A5GX16 Argininosuccinate synthase 5.15e-03 1.12e-12 NA NA
5. P O29986 GMP synthase [glutamine-hydrolyzing] subunit B 3.23e-03 1.42e-03 NA NA
5. P C1CN76 tRNA(Ile)-lysidine synthase 1.83e-01 4.35e-07 NA NA
5. P Q3KH95 tRNA(Ile)-lysidine synthase 1.26e-01 2.99e-09 NA NA
5. P P59607 Argininosuccinate synthase 1.96e-02 6.90e-11 NA NA
5. P B7M079 Argininosuccinate synthase 2.06e-02 1.52e-09 NA NA
5. P Q7V9F8 Argininosuccinate synthase 4.91e-03 6.60e-15 NA NA
5. P P00966 Argininosuccinate synthase 9.51e-03 9.45e-13 NA NA
5. P A8F7F8 tRNA(Ile)-lysidine synthase 1.52e-02 1.68e-06 NA NA
5. P A7HSW4 Argininosuccinate synthase 5.30e-03 1.62e-12 NA NA
5. P B2JZQ2 Argininosuccinate synthase 2.09e-02 2.04e-08 NA NA
5. P Q2FLD8 Argininosuccinate synthase 3.77e-03 1.63e-13 NA NA
5. P A1R591 Argininosuccinate synthase 1.95e-03 1.81e-14 NA NA
5. P Q31W50 Argininosuccinate synthase 1.93e-02 2.51e-09 NA NA
5. P Q9A201 tRNA(Ile)-lysidine synthase 2.61e-01 6.05e-05 NA NA
5. P C1DQV2 Argininosuccinate synthase 4.85e-03 6.57e-11 NA NA
5. P B1XRS6 Argininosuccinate synthase 6.82e-03 6.94e-12 NA NA
5. P P77973 Argininosuccinate synthase 6.69e-03 4.36e-14 NA NA
5. P Q5ZY78 Argininosuccinate synthase 8.54e-03 3.68e-12 NA NA
5. P B7GTP0 Argininosuccinate synthase 1.96e-03 4.68e-13 NA NA
5. P A1TNA2 Argininosuccinate synthase 1.98e-02 1.32e-09 NA NA
5. P Q3IYJ1 Argininosuccinate synthase 7.17e-03 2.34e-13 NA NA
5. P Q15X83 Argininosuccinate synthase 5.98e-03 3.16e-13 NA NA
5. P Q827Z1 Argininosuccinate synthase 3.64e-03 1.51e-13 NA NA
5. P Q07VN9 Argininosuccinate synthase 2.10e-02 1.69e-08 NA NA
5. P Q92JY3 tRNA(Ile)-lysidine synthase 1.51e-02 2.54e-09 NA NA
5. P B2SY63 Argininosuccinate synthase 7.26e-03 9.09e-13 NA NA
5. P B9M374 Argininosuccinate synthase 7.76e-03 2.84e-13 NA NA
5. P B8D8K8 Argininosuccinate synthase 3.05e-03 4.36e-14 NA NA
5. P A7GGQ9 Argininosuccinate synthase 4.50e-03 1.27e-13 NA NA
5. P Q667K7 tRNA(Ile)-lysidine synthase 9.23e-02 4.44e-07 NA NA
5. P Q1IWM3 Argininosuccinate synthase 5.64e-03 6.08e-13 NA NA
5. P Q8D2F5 tRNA(Ile)-lysidine synthase 2.31e-02 1.01e-08 NA NA
5. P B5F8V0 tRNA(Ile)-lysidine synthase 5.95e-02 2.08e-07 NA NA
5. P B5ED13 Argininosuccinate synthase 5.72e-03 2.68e-12 NA NA
5. P B1YGQ4 tRNA(Ile)-lysidine synthase 4.82e-02 4.17e-09 NA NA
5. P Q68XR8 tRNA(Ile)-lysidine synthase 3.83e-02 6.67e-08 NA NA
5. P A9WWG9 tRNA(Ile)-lysidine synthase 1.99e-02 3.57e-05 NA NA
5. P B9KG97 Argininosuccinate synthase 7.08e-03 4.18e-12 NA NA
5. P Q7U3B9 Argininosuccinate synthase 7.61e-03 1.66e-13 NA NA
5. P P61525 Argininosuccinate synthase 2.69e-03 9.82e-15 NA NA
5. P P61522 Argininosuccinate synthase 5.01e-03 5.82e-11 NA NA
5. P B5E578 tRNA(Ile)-lysidine synthase 1.85e-01 5.15e-07 NA NA
5. P A3CQQ4 Argininosuccinate synthase 3.64e-03 5.60e-12 NA NA
5. P A1WUZ5 Argininosuccinate synthase 7.49e-03 1.59e-11 NA NA
5. P Q839B3 tRNA(Ile)-lysidine synthase 2.65e-02 8.20e-05 NA NA
5. P P16460 Argininosuccinate synthase 6.96e-03 4.87e-13 NA NA
5. P Q5M6K9 tRNA(Ile)-lysidine synthase 1.44e-01 1.14e-05 NA NA
5. P A3M3K6 Argininosuccinate synthase 1.88e-02 3.35e-09 NA NA
5. P Q2GGE6 Argininosuccinate synthase 5.13e-03 3.05e-15 NA NA
5. P Q3MBE6 Argininosuccinate synthase 6.74e-03 3.13e-15 NA NA
5. P Q5LWG3 Argininosuccinate synthase 6.58e-03 1.37e-11 NA NA
5. P Q3JWY8 Argininosuccinate synthase 2.28e-02 4.94e-07 NA NA
5. P B7MB92 Argininosuccinate synthase 2.05e-02 1.54e-09 NA NA
5. P A6TL10 Argininosuccinate synthase 4.89e-03 1.49e-13 NA NA
5. P Q6DAZ8 Argininosuccinate synthase 2.10e-02 9.42e-10 NA NA
5. P B1XGY3 Argininosuccinate synthase 1.92e-02 1.49e-09 NA NA
5. P Q8DWM9 tRNA(Ile)-lysidine synthase 9.12e-02 4.68e-07 NA NA
5. P Q5P2I9 tRNA(Ile)-lysidine synthase 7.09e-02 1.20e-08 NA NA
5. P B7J0N4 tRNA(Ile)-lysidine synthase 1.01e-02 2.92e-06 NA NA
5. P Q96Y23 GMP synthase [glutamine-hydrolyzing] subunit B 8.19e-03 1.07e-07 NA NA
5. P Q81VX7 tRNA(Ile)-lysidine synthase 2.19e-02 2.61e-08 NA NA
5. P Q04XC4 tRNA(Ile)-lysidine synthase 3.96e-02 9.37e-07 NA NA
5. P Q87MF4 tRNA(Ile)-lysidine synthase 4.72e-02 2.82e-08 NA NA
5. P Q7W7H8 Argininosuccinate synthase 2.30e-02 2.18e-08 NA NA
5. P B1Z0E2 Argininosuccinate synthase 2.10e-02 1.19e-07 NA NA
5. P B8ESL2 Argininosuccinate synthase 7.66e-03 1.44e-11 NA NA
5. P C0R1H5 Argininosuccinate synthase 4.33e-03 1.78e-12 NA NA
5. P Q2RMV0 Argininosuccinate synthase 4.87e-03 1.50e-12 NA NA
5. P A0QHA8 Argininosuccinate synthase 3.83e-03 2.01e-15 NA NA
5. P C1C992 tRNA(Ile)-lysidine synthase 1.67e-01 3.00e-07 NA NA
5. P C4ZSR2 Argininosuccinate synthase 1.98e-02 1.49e-09 NA NA
5. P A5E8P0 Argininosuccinate synthase 2.17e-02 1.32e-09 NA NA
5. P C3LRV3 Argininosuccinate synthase 5.33e-03 5.55e-13 NA NA
5. P A1ATU4 Argininosuccinate synthase 6.18e-03 1.05e-12 NA NA
5. P B1I6Y3 tRNA(Ile)-lysidine synthase 1.80e-01 4.39e-07 NA NA
5. P P61521 Argininosuccinate synthase 3.12e-03 2.12e-15 NA NA
5. P B0T3Z9 Argininosuccinate synthase 5.82e-03 1.10e-12 NA NA
5. P Q0A7K1 tRNA(Ile)-lysidine synthase 7.11e-02 3.84e-08 NA NA
5. P Q8XHL1 tRNA(Ile)-lysidine synthase 1.99e-02 7.29e-07 NA NA
5. P B4TYE9 tRNA(Ile)-lysidine synthase 7.85e-02 1.52e-07 NA NA
5. P B0K4D8 Argininosuccinate synthase 4.57e-03 5.06e-13 NA NA
5. P Q1QHE6 Argininosuccinate synthase 7.28e-03 8.49e-12 NA NA
5. P C1A3S5 Argininosuccinate synthase 1.22e-02 9.77e-08 NA NA
5. P A8GZ21 Argininosuccinate synthase 3.95e-03 2.75e-12 NA NA
5. P A8AA65 Argininosuccinate synthase 7.22e-03 1.66e-13 NA NA
5. P Q7MH72 Argininosuccinate synthase 5.16e-03 4.03e-12 NA NA
5. P Q0SI58 Argininosuccinate synthase 4.08e-03 1.07e-14 NA NA
5. P Q392V6 Argininosuccinate synthase 1.86e-02 7.28e-08 NA NA
5. P Q8PXK0 GMP synthase [glutamine-hydrolyzing] subunit B 6.64e-03 5.24e-03 NA NA
5. P B4U5H9 tRNA(Ile)-lysidine synthase 1.09e-01 9.28e-05 NA NA
5. P E3PY99 2,4-diaminopentanoate dehydrogenase 5.61e-01 2.71e-03 NA NA
5. P Q8CWZ0 Argininosuccinate synthase 3.71e-03 1.47e-11 NA NA
5. P Q7MTC4 tRNA(Ile)-lysidine synthase 2.38e-02 2.37e-07 NA NA
5. P Q8FZ11 tRNA(Ile)-lysidine synthase 2.07e-02 4.00e-05 NA NA
5. P A5V0J9 Argininosuccinate synthase 6.61e-03 3.60e-13 NA NA
5. P Q9XBG6 tRNA(Ile)-lysidine synthase 1.20e-03 2.20e-03 NA NA
5. P Q3AVL9 Argininosuccinate synthase 7.47e-03 4.67e-14 NA NA
5. P C4KJU6 GMP synthase [glutamine-hydrolyzing] subunit B 5.29e-03 2.02e-06 NA NA
5. P Q2GC97 tRNA(Ile)-lysidine synthase 9.47e-03 4.26e-02 NA NA
5. P A5VAK5 Argininosuccinate synthase 6.54e-03 1.51e-13 NA NA
5. P Q8R7C2 Argininosuccinate synthase 5.86e-03 5.00e-13 NA NA
5. P Q1GCK1 Argininosuccinate synthase 7.21e-03 1.05e-12 NA NA
5. P A8GY99 tRNA(Ile)-lysidine synthase 4.25e-02 5.98e-06 NA NA
5. P C1CXR6 Argininosuccinate synthase 6.08e-03 2.15e-12 NA NA
5. P C6E6Y6 Argininosuccinate synthase 6.09e-03 2.51e-12 NA NA
5. P A2BZ94 Argininosuccinate synthase 5.16e-03 9.57e-16 NA NA
5. P B8EBG0 Argininosuccinate synthase 3.59e-03 9.82e-13 NA NA
5. P P61524 Argininosuccinate synthase 6.10e-03 8.52e-13 NA NA
5. P A0QYS6 Argininosuccinate synthase 3.60e-03 8.30e-14 NA NA
5. P Q28WC8 Argininosuccinate synthase 5.13e-03 1.94e-12 NA NA
5. P Q3K3Q4 Argininosuccinate synthase 3.55e-03 6.49e-11 NA NA
5. P Q8E7Y2 tRNA(Ile)-lysidine synthase 1.05e-01 1.53e-06 NA NA
5. P Q6F880 tRNA(Ile)-lysidine synthase 7.98e-02 3.65e-06 NA NA
5. P Q73FR9 tRNA(Ile)-lysidine synthase 6.11e-02 1.04e-06 NA NA
5. P A4SZQ2 Argininosuccinate synthase 5.05e-03 1.02e-10 NA NA
5. P B6JAT0 Argininosuccinate synthase 1.76e-02 1.61e-09 NA NA
5. P Q98E81 Argininosuccinate synthase 4.78e-03 4.27e-10 NA NA
5. P Q3SHT1 Argininosuccinate synthase 7.32e-03 4.33e-11 NA NA
5. P Q8DCN0 Argininosuccinate synthase 3.00e-03 4.03e-12 NA NA
5. P Q83BJ9 tRNA(Ile)-lysidine synthase 4.23e-02 1.80e-06 NA NA
5. P Q87XM3 Argininosuccinate synthase 4.40e-03 3.68e-12 NA NA
5. P Q0I4M1 Argininosuccinate synthase 1.92e-02 4.12e-09 NA NA
5. P Q11D10 Argininosuccinate synthase 5.20e-03 2.21e-12 NA NA
5. P A6M1Z4 Argininosuccinate synthase 5.44e-03 5.40e-13 NA NA
5. P P57877 Argininosuccinate synthase 1.88e-02 9.48e-09 NA NA
5. P Q6GBX9 tRNA(Ile)-lysidine synthase 4.40e-02 9.11e-06 NA NA
5. P Q1H0L1 Argininosuccinate synthase 5.31e-03 2.97e-12 NA NA
5. P C3MRT0 GMP synthase [glutamine-hydrolyzing] subunit B 2.61e-04 2.02e-06 NA NA
5. P Q1Q9L2 Argininosuccinate synthase 4.85e-03 1.05e-12 NA NA
5. P Q32BG2 Argininosuccinate synthase 1.96e-02 1.15e-09 NA NA
5. P Q9ZGE2 tRNA(Ile)-lysidine synthase 1.83e-02 3.07e-06 NA NA
5. P C0R4S1 tRNA(Ile)-lysidine synthase 4.30e-02 8.58e-08 NA NA
5. P Q8TNY5 Argininosuccinate synthase 3.89e-03 1.36e-15 NA NA
5. P P59609 Argininosuccinate synthase 2.00e-02 2.60e-09 NA NA
5. P B1KXY1 Argininosuccinate synthase 4.62e-03 1.47e-13 NA NA
5. P Q6HPV4 tRNA(Ile)-lysidine synthase 1.63e-02 3.64e-08 NA NA
5. P B0S9J6 Argininosuccinate synthase 5.87e-03 1.73e-11 NA NA
5. P Q4FNX4 Argininosuccinate synthase 5.24e-03 3.05e-16 NA NA
5. P A6WV13 Argininosuccinate synthase 4.71e-03 2.37e-13 NA NA
5. P Q8KA60 Argininosuccinate synthase 2.71e-03 2.61e-14 NA NA
5. P A9KTY7 Argininosuccinate synthase 3.43e-03 1.62e-12 NA NA
5. P Q8DKY7 Argininosuccinate synthase 6.41e-03 2.01e-15 NA NA
5. P Q60174 Argininosuccinate synthase 2.10e-03 4.22e-13 NA NA
5. P Q5P0Z7 Argininosuccinate synthase 7.62e-03 2.14e-11 NA NA
5. P A3DBU1 Argininosuccinate synthase 4.18e-03 5.74e-12 NA NA
5. P A4WEY6 Argininosuccinate synthase 1.99e-02 2.51e-09 NA NA
5. P Q2W896 Argininosuccinate synthase 5.22e-03 2.73e-13 NA NA
5. P Q8YYB8 tRNA(Ile)-lysidine synthase 2.02e-02 2.20e-03 NA NA
5. P A8FL83 Argininosuccinate synthase 7.18e-03 3.24e-12 NA NA
5. P B4T702 Argininosuccinate synthase 1.92e-02 3.57e-10 NA NA
5. P Q5X7P9 Argininosuccinate synthase 7.90e-03 1.94e-11 NA NA
5. P Q2JWE1 Argininosuccinate synthase 6.38e-03 4.80e-13 NA NA
5. P A7IGW4 Argininosuccinate synthase 6.57e-03 3.33e-12 NA NA
5. P Q0W468 GMP synthase [glutamine-hydrolyzing] subunit B 7.69e-03 3.63e-02 NA NA
5. P A8B000 tRNA(Ile)-lysidine synthase 1.51e-01 2.00e-06 NA NA
5. P Q1MAN9 Argininosuccinate synthase 2 5.26e-03 3.29e-13 NA NA
5. P Q2YA75 Argininosuccinate synthase 4.62e-03 2.36e-11 NA NA
5. P A7I281 Argininosuccinate synthase 7.80e-03 4.63e-12 NA NA
5. P Q99W94 tRNA(Ile)-lysidine synthase 2.43e-02 9.39e-06 NA NA
5. P Q62J40 tRNA(Ile)-lysidine synthase 1.57e-02 1.54e-08 NA NA
5. P Q8DRI5 Argininosuccinate synthase 3.65e-03 2.48e-11 NA NA
5. P A9M4B1 Argininosuccinate synthase 1.97e-02 2.09e-08 NA NA
5. P B9KPT5 Argininosuccinate synthase 6.60e-03 2.34e-13 NA NA
5. P P13257 Argininosuccinate synthase 3.03e-03 1.30e-15 NA NA
5. P O28032 Argininosuccinate synthase 5.19e-03 1.18e-15 NA NA
5. P Q1MEZ8 Argininosuccinate synthase 1 5.79e-03 8.29e-11 NA NA
5. P Q92JK0 tRNA(Ile)-lysidine synthase 3.56e-02 3.26e-06 NA NA
5. P Q7N8N0 tRNA(Ile)-lysidine synthase 6.97e-02 2.90e-07 NA NA
5. P B0BVY4 tRNA(Ile)-lysidine synthase 3.94e-02 1.72e-05 NA NA
5. P A2SIL9 tRNA(Ile)-lysidine synthase 4.96e-02 2.88e-08 NA NA
5. P Q2RG67 Argininosuccinate synthase 4.49e-03 1.94e-12 NA NA
5. P Q5YYD3 Argininosuccinate synthase 1.74e-03 9.45e-13 NA NA
5. P Q65ZY6 tRNA(Ile)-lysidine synthase 6.85e-03 6.77e-07 NA NA
5. P A4YI75 Argininosuccinate synthase 2.14e-03 9.33e-13 NA NA
5. P A0PP79 Argininosuccinate synthase 3.18e-03 5.60e-16 NA NA
5. P A7GYN4 Argininosuccinate synthase 6.90e-03 5.13e-14 NA NA
5. P Q7NC17 1-deoxy-D-xylulose 5-phosphate reductoisomerase 4.12e-01 3.66e-02 NA NA
5. P A9M7J1 tRNA(Ile)-lysidine synthase 2.03e-02 3.57e-05 NA NA
5. P Q5LXZ8 Argininosuccinate synthase 4.31e-03 1.16e-11 NA NA
5. P O94354 Argininosuccinate synthase 6.39e-03 1.18e-15 NA NA
5. P Q8TWU0 Argininosuccinate synthase 3.15e-03 3.10e-17 NA NA
5. P Q0I607 Argininosuccinate synthase 7.17e-03 5.55e-13 NA NA
5. P B4S7R9 Argininosuccinate synthase 5.15e-03 2.81e-13 NA NA
5. P A1AVI7 Argininosuccinate synthase 6.67e-03 9.70e-13 NA NA
5. P Q9K4Z3 Argininosuccinate synthase 5.66e-03 3.44e-10 NA NA
5. P Q8EK28 Argininosuccinate synthase 3.55e-03 1.77e-13 NA NA
5. P Q5ZXE5 tRNA(Ile)-lysidine synthase 8.85e-02 4.74e-08 NA NA
5. P B8DN64 Argininosuccinate synthase 5.42e-03 1.15e-11 NA NA
5. P C3MJX9 GMP synthase [glutamine-hydrolyzing] subunit B 4.86e-03 2.04e-06 NA NA
5. P Q9SZX3 Argininosuccinate synthase, chloroplastic 7.89e-03 2.27e-02 NA NA
5. P A1K7J8 Argininosuccinate synthase 7.17e-03 1.85e-12 NA NA
5. P Q7NCP5 Argininosuccinate synthase 5.46e-03 6.02e-14 NA NA
5. P Q7UZG0 Argininosuccinate synthase 8.40e-03 8.19e-13 NA NA
5. P A3DA23 Argininosuccinate synthase 3.61e-03 9.82e-13 NA NA
5. P A5U315 Argininosuccinate synthase 3.16e-03 3.91e-15 NA NA
5. P A5CFP2 tRNA(Ile)-lysidine synthase 3.54e-02 5.81e-06 NA NA
5. P Q0I3D1 tRNA(Ile)-lysidine synthase 2.66e-02 1.42e-08 NA NA
5. P Q2K3B7 Argininosuccinate synthase 4.61e-03 5.00e-13 NA NA
5. P Q3IME2 Argininosuccinate synthase 2.38e-03 2.48e-14 NA NA
5. P Q089K8 Argininosuccinate synthase 5.82e-03 2.41e-14 NA NA
5. P Q3IHT8 Argininosuccinate synthase 2.97e-03 7.87e-14 NA NA
5. P Q5UX56 GMP synthase [glutamine-hydrolyzing] subunit B 2.03e-03 2.52e-02 NA NA
5. P A5UFF8 Argininosuccinate synthase 1.86e-02 1.94e-10 NA NA
5. P B0CCQ2 Argininosuccinate synthase 4.51e-03 9.29e-15 NA NA
5. P B1IQV0 Argininosuccinate synthase 1.99e-02 2.11e-09 NA NA
5. P B1L8R5 tRNA(Ile)-lysidine synthase 1.34e-02 4.39e-08 NA NA
5. P A5GDA4 Argininosuccinate synthase 7.32e-03 5.56e-14 NA NA
5. P A0Q1Z2 Argininosuccinate synthase 4.23e-03 5.69e-13 NA NA
5. P Q9HY84 Argininosuccinate synthase 4.15e-03 1.19e-11 NA NA
5. P O25428 tRNA(Ile)-lysidine synthase 1.77e-03 2.39e-07 NA NA
5. P B8HGC9 Argininosuccinate synthase 2.17e-03 4.68e-15 NA NA
5. P Q9KNT8 Argininosuccinate synthase 5.04e-03 5.55e-13 NA NA
5. P B1JPT9 Argininosuccinate synthase 2.12e-02 2.04e-08 NA NA
5. P B5QZW1 Argininosuccinate synthase 1.90e-02 2.71e-10 NA NA
5. P Q5M2K2 Argininosuccinate synthase 6.15e-03 1.16e-11 NA NA
5. P Q0SM64 tRNA(Ile)-lysidine synthase 8.79e-03 3.20e-06 NA NA
5. P A6VVI2 Argininosuccinate synthase 5.39e-03 4.75e-12 NA NA
5. P Q2FZU1 Argininosuccinate synthase 5.88e-03 2.68e-12 NA NA
5. P P61527 Argininosuccinate synthase 9.47e-04 1.12e-12 NA NA
5. P P44315 Argininosuccinate synthase 1.83e-02 1.94e-10 NA NA
5. P O85176 Argininosuccinate synthase 5.46e-03 1.36e-15 NA NA
5. P Q9CC10 Argininosuccinate synthase 3.86e-03 1.48e-15 NA NA
5. P P13256 Argininosuccinate synthase 1.01e-03 3.16e-13 NA NA
5. P Q5LNU7 tRNA(Ile)-lysidine synthase 2.16e-02 5.98e-08 NA NA
5. P Q9UX31 Argininosuccinate synthase 2.55e-03 5.92e-13 NA NA
5. P Q8G376 Argininosuccinate synthase 5.38e-03 4.08e-14 NA NA
5. P C1F510 Argininosuccinate synthase 1.90e-02 2.11e-08 NA NA
5. P A1UUF5 Argininosuccinate synthase 5.26e-03 4.24e-12 NA NA
5. P Q2G933 Argininosuccinate synthase 6.25e-03 6.82e-11 NA NA
5. P B1K5H3 Argininosuccinate synthase 1.91e-02 1.43e-07 NA NA
5. P Q13D88 Argininosuccinate synthase 2.14e-02 2.29e-09 NA NA
5. P A8G7L2 Argininosuccinate synthase 5.07e-03 7.36e-14 NA NA
5. P Q8EU18 tRNA(Ile)-lysidine synthase 2.45e-02 6.82e-08 NA NA
5. P Q0BWI1 Argininosuccinate synthase 7.34e-03 2.06e-11 NA NA
5. P Q97C09 GMP synthase [glutamine-hydrolyzing] subunit B 2.30e-03 2.12e-04 NA NA
5. P A6WTS0 Argininosuccinate synthase 3.74e-03 9.82e-13 NA NA
5. P Q8XMJ7 Argininosuccinate synthase 5.62e-03 1.43e-12 NA NA
5. P A4VXZ4 Argininosuccinate synthase 3.53e-03 1.87e-11 NA NA
5. P A6W614 Argininosuccinate synthase 1.87e-02 1.01e-06 NA NA
5. P A0L251 Argininosuccinate synthase 3.53e-03 6.61e-14 NA NA
5. P Q8RHN5 tRNA(Ile)-lysidine synthase 1.26e-02 7.77e-06 NA NA
5. P C1D9Q4 Argininosuccinate synthase 6.15e-03 1.19e-13 NA NA
5. P A4JLD9 Argininosuccinate synthase 2.09e-02 6.89e-08 NA NA
5. P B2VGA8 Argininosuccinate synthase 3.62e-03 9.61e-14 NA NA
5. P Q6YR87 tRNA(Ile)-lysidine synthase 1.94e-02 1.07e-05 NA NA
5. P Q9KGH8 tRNA(Ile)-lysidine synthase 1.24e-02 1.46e-06 NA NA
5. P Q3SNT5 Argininosuccinate synthase 7.29e-03 1.55e-11 NA NA
5. P B5FBP4 Argininosuccinate synthase 4.87e-03 8.70e-11 NA NA
5. P B5YAL9 Argininosuccinate synthase 5.43e-03 3.75e-13 NA NA
5. P Q8UC31 Argininosuccinate synthase 4.49e-03 1.81e-14 NA NA
5. P P47330 tRNA(Ile)-lysidine synthase 8.94e-03 6.94e-04 NA NA
5. P A4W6T3 tRNA(Ile)-lysidine synthase 7.66e-02 5.43e-07 NA NA
5. P O27322 Argininosuccinate synthase 1.83e-03 1.40e-14 NA NA
5. P B4TK64 tRNA(Ile)-lysidine synthase 6.26e-02 1.44e-07 NA NA
5. P Q5L5B2 tRNA(Ile)-lysidine synthase 3.02e-03 9.31e-03 NA NA
5. P A9IYI2 tRNA(Ile)-lysidine synthase 8.31e-02 1.72e-04 NA NA
5. P Q63ST1 tRNA(Ile)-lysidine synthase 2.31e-02 2.73e-08 NA NA
5. P A7MXB9 Argininosuccinate synthase 4.90e-03 4.92e-10 NA NA
5. P P9WG53 tRNA(Ile)-lysidine synthase 1.71e-02 4.23e-02 NA NA
5. P Q5M217 tRNA(Ile)-lysidine synthase 7.17e-02 1.14e-05 NA NA
5. P Q8F9P6 tRNA(Ile)-lysidine synthase 2.85e-02 2.47e-08 NA NA
5. P B1I814 Argininosuccinate synthase 3.71e-03 2.31e-11 NA NA
5. P Q74C65 tRNA(Ile)-lysidine synthase 2.27e-02 8.58e-08 NA NA
5. P Q8G5F2 Argininosuccinate synthase 2.02e-03 4.27e-13 NA NA
5. P Q2T1W2 Argininosuccinate synthase 2.07e-02 4.68e-07 NA NA
5. P Q63U95 Argininosuccinate synthase 8.04e-03 7.01e-13 NA NA
5. P Q4J8F1 Argininosuccinate synthase 2.47e-03 7.98e-13 NA NA
5. P A8GQJ7 tRNA(Ile)-lysidine synthase 2.47e-02 1.72e-05 NA NA
5. P C5B7T0 tRNA(Ile)-lysidine synthase 9.81e-02 2.61e-07 NA NA
5. P A7ML85 Argininosuccinate synthase 3.36e-03 2.10e-12 NA NA
5. P Q1BLH4 Argininosuccinate synthase 2.10e-02 1.43e-07 NA NA
5. P A4G3H1 Argininosuccinate synthase 1.97e-02 2.52e-08 NA NA
5. P O83388 tRNA(Ile)-lysidine synthase 1.34e-02 2.84e-07 NA NA
5. P A1K3X8 tRNA(Ile)-lysidine synthase 1.35e-01 4.17e-07 NA NA
5. P A4QDZ4 Argininosuccinate synthase 5.77e-03 1.06e-15 NA NA
5. P A7FFI7 tRNA(Ile)-lysidine synthase 7.16e-02 2.94e-06 NA NA
5. P B2IQZ8 tRNA(Ile)-lysidine synthase 1.85e-01 5.15e-07 NA NA
5. P B8D6W2 Argininosuccinate synthase 3.09e-03 4.36e-14 NA NA
5. P B1KND6 Argininosuccinate synthase 3.65e-03 2.33e-12 NA NA
5. P Q8ZRN5 tRNA(Ile)-lysidine synthase 7.77e-02 5.84e-07 NA NA
5. P B3EJ62 Argininosuccinate synthase 5.12e-03 1.31e-13 NA NA
5. P A6WY85 tRNA(Ile)-lysidine synthase 9.25e-02 2.49e-05 NA NA
5. P Q13UR1 Argininosuccinate synthase 7.49e-03 1.80e-12 NA NA
5. P Q97A55 Argininosuccinate synthase 4.70e-03 1.40e-11 NA NA
5. P Q5HRP5 tRNA(Ile)-lysidine synthase 2.35e-02 6.48e-06 NA NA
5. P Q8PIY5 tRNA(Ile)-lysidine synthase 6.38e-02 1.35e-08 NA NA
5. P Q97TC5 tRNA(Ile)-lysidine synthase 1.82e-01 2.87e-07 NA NA
5. P B1KNS7 tRNA(Ile)-lysidine synthase 7.24e-02 1.68e-05 NA NA
5. P A5VS49 tRNA(Ile)-lysidine synthase 2.17e-02 4.85e-05 NA NA
5. P Q0HDU8 Argininosuccinate synthase 5.78e-03 6.61e-14 NA NA
5. P A9HIQ4 Argininosuccinate synthase 5.68e-03 8.92e-11 NA NA
5. P B9E0B1 Argininosuccinate synthase 4.48e-03 2.44e-15 NA NA
5. P A5CXM9 Argininosuccinate synthase 6.11e-03 1.02e-11 NA NA
5. P Q2YQH6 tRNA(Ile)-lysidine synthase 1.90e-02 4.85e-05 NA NA
5. P Q058D6 Argininosuccinate synthase 4.84e-03 2.80e-14 NA NA
5. P Q607F5 tRNA(Ile)-lysidine synthase 8.09e-02 8.75e-06 NA NA
5. P Q0TTA5 Argininosuccinate synthase 5.49e-03 3.55e-12 NA NA
5. P Q98PE3 tRNA(Ile)-lysidine synthase 1.14e-02 9.28e-05 NA NA
5. P B2S7X3 Argininosuccinate synthase 5.54e-03 1.97e-14 NA NA
5. P Q82VP4 tRNA(Ile)-lysidine synthase 4.60e-02 9.77e-06 NA NA
5. P Q0AKJ6 Argininosuccinate synthase 4.98e-03 7.16e-11 NA NA
5. P B9MBJ2 Argininosuccinate synthase 2.21e-02 1.01e-10 NA NA
5. P Q1B7R1 Argininosuccinate synthase 3.45e-03 3.37e-13 NA NA
5. P P09034 Argininosuccinate synthase 5.66e-03 9.95e-13 NA NA
5. P Q8FL00 tRNA(Ile)-lysidine synthase 7.03e-02 5.66e-08 NA NA
5. P B0SJR2 Argininosuccinate synthase 6.22e-03 1.73e-11 NA NA
5. P Q7A7A6 tRNA(Ile)-lysidine synthase 4.09e-02 9.39e-06 NA NA
5. P Q06734 Argininosuccinate synthase 1.93e-02 8.28e-05 NA NA
5. P B3Q9D3 Argininosuccinate synthase 1.99e-02 4.37e-09 NA NA
5. P Q1IE03 Argininosuccinate synthase 4.38e-03 1.87e-11 NA NA
5. P B8ZJI9 tRNA(Ile)-lysidine synthase 1.64e-01 4.78e-07 NA NA
5. P P9WPW7 Argininosuccinate synthase 3.17e-03 3.91e-15 NA NA
5. P P57158 Argininosuccinate synthase 3.11e-03 4.36e-14 NA NA
5. P Q3ASI2 Argininosuccinate synthase 5.32e-03 3.00e-13 NA NA
5. P Q5JFM1 GMP synthase [glutamine-hydrolyzing] subunit B 1.88e-03 4.70e-04 NA NA
5. P Q3A9W5 Argininosuccinate synthase 4.35e-03 3.75e-13 NA NA
5. P C5CUG9 Argininosuccinate synthase 2.06e-02 1.03e-07 NA NA
5. P Q5WZ50 Argininosuccinate synthase 8.58e-03 1.03e-12 NA NA
5. P Q67KE1 Argininosuccinate synthase 5.90e-03 3.65e-11 NA NA
5. P C3N905 GMP synthase [glutamine-hydrolyzing] subunit B 5.26e-03 2.02e-06 NA NA
5. P B8FWX2 Argininosuccinate synthase 4.06e-03 1.67e-11 NA NA
5. P A6VNE4 tRNA(Ile)-lysidine synthase 8.50e-02 2.78e-07 NA NA
5. P B9DVV9 Argininosuccinate synthase 3.79e-03 2.45e-11 NA NA
5. P Q93JQ8 Argininosuccinate synthase 7.43e-03 1.02e-14 NA NA
5. P A9M6S7 Argininosuccinate synthase 4.63e-03 1.97e-14 NA NA
5. P Q7WKW7 Argininosuccinate synthase 2.29e-02 2.18e-08 NA NA
5. P C3PM75 tRNA(Ile)-lysidine synthase 3.76e-02 1.38e-05 NA NA
5. P Q5FH27 Argininosuccinate synthase 5.15e-03 5.83e-15 NA NA
5. P P59602 Argininosuccinate synthase 4.38e-03 6.74e-13 NA NA
5. P Q0RFB2 Argininosuccinate synthase 1.91e-03 1.02e-12 NA NA
5. P C1ASZ6 Argininosuccinate synthase 3.61e-03 1.07e-14 NA NA
5. P Q6D8C5 tRNA(Ile)-lysidine synthase 8.75e-02 5.84e-07 NA NA
5. P A0KFV3 Argininosuccinate synthase 5.45e-03 7.78e-13 NA NA
5. P A1VEQ0 Argininosuccinate synthase 5.02e-03 5.68e-11 NA NA
5. P C0REV5 tRNA(Ile)-lysidine synthase 2.14e-02 4.85e-05 NA NA
5. P B6IVD0 Argininosuccinate synthase 6.51e-03 2.68e-12 NA NA
5. P B1XN65 Argininosuccinate synthase 6.43e-03 1.05e-14 NA NA
5. P B8HSA9 Argininosuccinate synthase 7.44e-03 6.44e-14 NA NA
5. P Q5X6W4 tRNA(Ile)-lysidine synthase 8.51e-02 1.56e-08 NA NA
5. P Q2JRN8 tRNA(Ile)-lysidine synthase 5.48e-03 2.93e-03 NA NA
5. P Q9JUE9 tRNA(Ile)-lysidine synthase 3.15e-02 1.02e-09 NA NA
5. P Q8P322 tRNA(Ile)-lysidine synthase 1.07e-01 1.86e-04 NA NA
5. P B7N0V6 Argininosuccinate synthase 1.98e-02 1.49e-09 NA NA
5. P Q9ZLB5 tRNA(Ile)-lysidine synthase 1.71e-03 2.13e-07 NA NA
5. P B1J4I4 Argininosuccinate synthase 5.05e-03 1.42e-11 NA NA
5. P Q1IIZ2 Argininosuccinate synthase 5.27e-03 5.79e-14 NA NA
5. P Q74LA3 tRNA(Ile)-lysidine synthase 1.55e-02 2.84e-07 NA NA
5. P Q67JG9 tRNA(Ile)-lysidine synthase 2.14e-02 1.04e-07 NA NA
5. P Q7NT72 tRNA(Ile)-lysidine synthase 6.07e-02 5.97e-07 NA NA
5. P Q18E36 Argininosuccinate synthase 3.07e-03 5.99e-15 NA NA
5. P B7VIQ1 tRNA(Ile)-lysidine synthase 9.50e-02 2.26e-09 NA NA
5. P Q8ZU97 Argininosuccinate synthase 4.68e-03 1.63e-14 NA NA
5. P Q5HIG6 tRNA(Ile)-lysidine synthase 3.46e-02 1.08e-05 NA NA
5. P A1RPR6 Argininosuccinate synthase 3.60e-03 3.04e-13 NA NA
5. P B4RQS8 Argininosuccinate synthase 1.98e-02 1.15e-08 NA NA
5. P Q9ABU1 Argininosuccinate synthase 7.36e-03 5.46e-12 NA NA
5. P Q8Q0U5 Argininosuccinate synthase 2.96e-03 1.40e-15 NA NA
5. P Q8YIV0 tRNA(Ile)-lysidine synthase 2.13e-02 4.85e-05 NA NA
5. P A5UA84 tRNA(Ile)-lysidine synthase 8.19e-02 1.07e-08 NA NA
5. P C4K338 tRNA(Ile)-lysidine synthase 1.27e-02 1.34e-09 NA NA
5. P Q5R0Q7 tRNA(Ile)-lysidine synthase 1.75e-01 2.69e-07 NA NA
5. P Q6G5P5 tRNA(Ile)-lysidine synthase 6.87e-02 1.11e-06 NA NA
5. P A5UGS0 tRNA(Ile)-lysidine synthase 7.70e-02 1.91e-08 NA NA
5. P A6QAX6 Argininosuccinate synthase 7.62e-03 9.71e-11 NA NA
5. P Q04W48 tRNA(Ile)-lysidine synthase 2.89e-02 9.37e-07 NA NA
5. P B1WTK3 Argininosuccinate synthase 7.03e-03 5.15e-15 NA NA
5. P A6UE09 Argininosuccinate synthase 4.82e-03 3.50e-15 NA NA
5. P B7UVV5 Argininosuccinate synthase 4.37e-03 1.19e-11 NA NA
5. P B7LHN6 Argininosuccinate synthase 1.90e-02 3.16e-09 NA NA
5. P Q8E2H4 tRNA(Ile)-lysidine synthase 1.19e-01 1.53e-06 NA NA
5. P A1BG29 Argininosuccinate synthase 5.11e-03 1.75e-12 NA NA
5. P P61523 Argininosuccinate synthase 6.70e-03 4.27e-13 NA NA
5. P Q8EGF9 tRNA(Ile)-lysidine synthase 7.39e-02 1.38e-04 NA NA
5. P A2SK99 Argininosuccinate synthase 2.12e-02 1.80e-08 NA NA
5. P Q12SM7 Argininosuccinate synthase 5.98e-03 2.51e-14 NA NA
5. P Q8YEK8 Argininosuccinate synthase 4.51e-03 1.97e-14 NA NA
5. P A9IL50 Argininosuccinate synthase 4.59e-03 9.48e-11 NA NA
5. P B0CII7 Argininosuccinate synthase 5.43e-03 1.97e-14 NA NA
5. P A8GIC1 tRNA(Ile)-lysidine synthase 8.17e-02 2.58e-07 NA NA
5. P B5YS62 Argininosuccinate synthase 1.91e-02 1.97e-09 NA NA
5. P Q0BVJ1 Argininosuccinate synthase 5.70e-03 2.74e-10 NA NA
5. P A0RP84 Argininosuccinate synthase 7.67e-03 4.18e-12 NA NA
5. P Q7VRC9 tRNA(Ile)-lysidine synthase 4.06e-02 9.73e-05 NA NA
5. P C1CH91 tRNA(Ile)-lysidine synthase 1.50e-01 4.49e-07 NA NA
5. P B7LR40 Argininosuccinate synthase 1.96e-02 7.19e-10 NA NA
5. P Q21DC6 Argininosuccinate synthase 2.19e-02 1.28e-09 NA NA
5. P B4TJ09 Argininosuccinate synthase 1.88e-02 6.85e-10 NA NA
5. P A2S7V6 Argininosuccinate synthase 1.94e-02 4.94e-07 NA NA
5. P Q98F87 tRNA(Ile)-lysidine synthase 2.36e-02 7.52e-07 NA NA
5. P P75549 tRNA(Ile)-lysidine synthase 5.26e-03 4.00e-05 NA NA
5. P Q10441 Probable tRNA(Ile)-lysidine synthase 1.67e-02 4.17e-09 NA NA
5. P Q4UN67 tRNA(Ile)-lysidine synthase 4.27e-02 3.95e-07 NA NA
5. P B2GKD7 Argininosuccinate synthase 1.86e-03 5.86e-14 NA NA
5. P Q5QWZ9 Argininosuccinate synthase 3.06e-03 9.82e-13 NA NA
5. P Q8ZFV7 Argininosuccinate synthase 2.10e-02 2.04e-08 NA NA
5. P C0RGD6 Argininosuccinate synthase 5.42e-03 1.97e-14 NA NA
5. P Q8DRP9 tRNA(Ile)-lysidine synthase 1.95e-01 2.93e-07 NA NA
5. P A5I5A4 Argininosuccinate synthase 4.51e-03 8.99e-14 NA NA
5. P A0LUB9 Argininosuccinate synthase 3.67e-03 3.97e-12 NA NA
5. P C3NMG4 GMP synthase [glutamine-hydrolyzing] subunit B 4.38e-03 2.02e-06 NA NA
5. P A7FJE9 Argininosuccinate synthase 2.17e-02 2.04e-08 NA NA
5. P Q7UDQ6 tRNA(Ile)-lysidine synthase 6.99e-02 2.28e-08 NA NA
5. P P0A6E4 Argininosuccinate synthase 1.98e-02 1.49e-09 NA NA
5. P B5F6U1 Argininosuccinate synthase 1.89e-02 2.71e-10 NA NA
5. P A1V7X3 Argininosuccinate synthase 2.13e-02 4.94e-07 NA NA
5. P Q5UZ46 Argininosuccinate synthase 3.53e-03 3.40e-15 NA NA
5. P P52097 tRNA(Ile)-lysidine synthase 2.81e-02 2.13e-08 NA NA
5. P B8E0N9 Argininosuccinate synthase 5.45e-03 1.01e-12 NA NA
5. P B0UW58 Argininosuccinate synthase 1.82e-02 3.63e-09 NA NA
5. P Q65PF4 tRNA(Ile)-lysidine synthase 3.35e-02 9.02e-06 NA NA
5. P A9N735 Argininosuccinate synthase 1.91e-02 2.71e-10 NA NA
5. P Q3Z727 Argininosuccinate synthase 6.35e-03 5.61e-10 NA NA
5. P Q04N53 tRNA(Ile)-lysidine synthase 2.08e-01 2.93e-07 NA NA
5. P A9R622 Argininosuccinate synthase 2.10e-02 2.04e-08 NA NA
5. P Q65UE9 tRNA(Ile)-lysidine synthase 7.25e-02 2.88e-09 NA NA
5. P Q87BE2 tRNA(Ile)-lysidine synthase 1.01e-01 5.55e-09 NA NA
5. P Q5GTD2 tRNA(Ile)-lysidine synthase 1.26e-02 1.03e-07 NA NA
5. P Q7MIH8 tRNA(Ile)-lysidine synthase 5.09e-02 2.39e-07 NA NA
5. P P59604 Argininosuccinate synthase 4.37e-03 1.87e-11 NA NA
5. P Q1QVN0 Argininosuccinate synthase 5.42e-03 2.71e-12 NA NA
5. P A9N0U0 tRNA(Ile)-lysidine synthase 2.31e-02 6.63e-07 NA NA
5. P Q04P84 Argininosuccinate synthase 6.41e-03 5.47e-13 NA NA
5. P Q3J9C8 Argininosuccinate synthase 4.50e-03 5.34e-14 NA NA
5. P Q63HD6 tRNA(Ile)-lysidine synthase 2.09e-02 6.11e-08 NA NA
5. P Q9PHK7 Argininosuccinate synthase 7.37e-03 7.21e-12 NA NA
5. P B2U204 Argininosuccinate synthase 1.93e-02 2.51e-09 NA NA
5. P A8GLX9 tRNA(Ile)-lysidine synthase 5.53e-02 2.39e-07 NA NA
5. P Q9CJH4 tRNA(Ile)-lysidine synthase 9.34e-02 1.26e-05 NA NA
5. P A7ZS69 Argininosuccinate synthase 1.88e-02 3.16e-09 NA NA
5. P C0QU23 tRNA(Ile)-lysidine synthase 1.70e-02 2.17e-07 NA NA
5. P Q47BM0 Argininosuccinate synthase 1.08e-02 2.32e-04 NA NA
5. P A3PFJ6 Argininosuccinate synthase 5.00e-03 5.71e-14 NA NA
5. P A4T9W4 Argininosuccinate synthase 3.55e-03 4.93e-13 NA NA
5. P A5GPT0 Argininosuccinate synthase 6.70e-03 1.55e-13 NA NA
5. P C1FW05 2,4-diaminopentanoate dehydrogenase 4.18e-01 7.06e-03 NA NA
5. P A8EUB2 Argininosuccinate synthase 9.21e-03 2.71e-12 NA NA
5. P Q0C5V2 tRNA(Ile)-lysidine synthase 3.39e-02 2.55e-04 NA NA
5. P A4SEI8 Argininosuccinate synthase 4.64e-03 2.46e-13 NA NA
5. P A2CE29 Argininosuccinate synthase 3.99e-03 7.78e-13 NA NA
5. P B7JVH4 Argininosuccinate synthase 5.99e-03 6.07e-15 NA NA
5. P C1FU68 Argininosuccinate synthase 4.65e-03 6.44e-14 NA NA
5. P A0LE34 Argininosuccinate synthase 5.70e-03 1.89e-13 NA NA
5. P A5IHA3 Argininosuccinate synthase 7.96e-03 1.40e-11 NA NA
5. P A4YBT9 Argininosuccinate synthase 3.59e-03 2.22e-13 NA NA
5. P B2TQ23 Argininosuccinate synthase 5.24e-03 1.80e-12 NA NA
5. P Q6L1N7 Argininosuccinate synthase 5.87e-03 7.36e-14 NA NA
5. P Q31H63 Argininosuccinate synthase 5.07e-03 1.16e-13 NA NA
5. P Q4K749 Argininosuccinate synthase 4.99e-03 3.92e-12 NA NA
5. P P55744 Argininosuccinate synthase 2.11e-02 9.88e-10 NA NA
5. P Q8CQV3 tRNA(Ile)-lysidine synthase 3.56e-02 6.48e-06 NA NA
5. P A4XKG4 Argininosuccinate synthase 5.09e-03 1.17e-13 NA NA
5. P Q9KPX0 tRNA(Ile)-lysidine synthase 8.04e-02 6.45e-08 NA NA
5. P A8AUN6 Argininosuccinate synthase 3.76e-03 5.53e-12 NA NA
5. P B3DSY7 Argininosuccinate synthase 2.05e-03 3.00e-13 NA NA
5. P Q6LYU3 GMP synthase [glutamine-hydrolyzing] subunit B 9.47e-03 1.42e-02 NA NA
5. P Q65SH4 Argininosuccinate synthase 1.95e-02 4.15e-08 NA NA
5. P A4TKI3 Argininosuccinate synthase 2.08e-02 2.04e-08 NA NA
5. P Q8U0R8 GMP synthase [glutamine-hydrolyzing] subunit B 1.94e-03 3.87e-02 NA NA
5. P Q489P3 Argininosuccinate synthase 7.05e-03 4.07e-11 NA NA
5. P B2UBA3 Argininosuccinate synthase 2.11e-02 7.22e-09 NA NA
5. P Q5F5G5 Argininosuccinate synthase 2.02e-02 1.15e-08 NA NA
5. P Q62EQ4 Argininosuccinate synthase 1.92e-02 4.94e-07 NA NA
5. P A5N6U2 Argininosuccinate synthase 4.51e-03 2.44e-15 NA NA
5. P Q5N517 tRNA(Ile)-lysidine synthase 2.70e-02 1.46e-02 NA NA
5. P Q6MUI9 tRNA(Ile)-lysidine synthase 8.61e-03 2.15e-07 NA NA
5. P B6EMN8 Argininosuccinate synthase 5.00e-03 2.71e-11 NA NA
5. P C4K162 tRNA(Ile)-lysidine synthase 5.14e-02 2.25e-03 NA NA
5. P C0MAT4 tRNA(Ile)-lysidine synthase 1.17e-01 3.14e-05 NA NA
5. P Q1RGN9 tRNA(Ile)-lysidine synthase 2.32e-02 3.33e-06 NA NA
5. P B0TL85 Argininosuccinate synthase 6.54e-03 1.73e-12 NA NA
5. P A9IQ90 Argininosuccinate synthase 1.85e-02 2.48e-09 NA NA
5. P Q6MDI6 tRNA(Ile)-lysidine synthase 2.37e-02 1.43e-06 NA NA
5. P Q57T19 tRNA(Ile)-lysidine synthase 8.60e-02 2.27e-07 NA NA
5. P C3L1U3 Argininosuccinate synthase 4.53e-03 1.41e-13 NA NA
5. P B9MRP5 Argininosuccinate synthase 4.93e-03 1.72e-14 NA NA
5. P C4Z4C1 Argininosuccinate synthase 4.52e-03 4.25e-14 NA NA
5. P A7IA92 GMP synthase [glutamine-hydrolyzing] subunit B 2.65e-03 2.71e-03 NA NA
5. P Q255L6 tRNA(Ile)-lysidine synthase 1.82e-03 1.62e-02 NA NA
5. P P0DG01 tRNA(Ile)-lysidine synthase 8.62e-02 6.23e-05 NA NA
5. P B2JP23 Argininosuccinate synthase 1.82e-02 2.04e-07 NA NA
5. P B2S7D1 tRNA(Ile)-lysidine synthase 2.14e-02 4.85e-05 NA NA
5. P A8LE46 Argininosuccinate synthase 1.88e-03 4.29e-12 NA NA
5. P Q47N84 Argininosuccinate synthase 1.80e-03 1.31e-14 NA NA
5. P Q7VTJ9 Argininosuccinate synthase 1.74e-02 2.09e-08 NA NA
5. P Q0B4C4 Argininosuccinate synthase 2.04e-02 9.67e-08 NA NA
5. P A7H4E9 Argininosuccinate synthase 5.41e-03 3.46e-12 NA NA
5. P Q609X7 Argininosuccinate synthase 4.78e-03 7.07e-11 NA NA
5. P B5XSX1 Argininosuccinate synthase 2.09e-02 1.72e-10 NA NA
5. P Q9JWM1 Argininosuccinate synthase 2.06e-02 2.36e-08 NA NA
5. P Q4JVZ8 Argininosuccinate synthase 1.65e-03 3.17e-15 NA NA
5. P A1SJJ3 Argininosuccinate synthase 2.28e-02 1.49e-07 NA NA
5. P Q57FU2 Argininosuccinate synthase 4.76e-03 1.97e-14 NA NA
5. P Q9HIH8 GMP synthase [glutamine-hydrolyzing] subunit B 8.82e-03 8.61e-04 NA NA
5. P Q72C25 tRNA(Ile)-lysidine synthase 1.31e-02 3.51e-02 NA NA
5. P Q16D10 Argininosuccinate synthase 5.12e-03 2.01e-11 NA NA
5. P Q8KA23 tRNA(Ile)-lysidine synthase 8.17e-02 1.81e-03 NA NA
5. P A4W488 Argininosuccinate synthase 3.56e-03 1.87e-11 NA NA
5. P A5F4Z4 Argininosuccinate synthase 4.96e-03 5.55e-13 NA NA
5. P A6V1S1 Argininosuccinate synthase 4.30e-03 8.28e-12 NA NA
5. P C1A051 Argininosuccinate synthase 3.23e-03 4.30e-15 NA NA
5. P A4SIM5 Argininosuccinate synthase 5.29e-03 1.65e-12 NA NA
5. P Q31G65 tRNA(Ile)-lysidine synthase 3.74e-02 4.47e-10 NA NA
5. P Q8EWQ7 tRNA(Ile)-lysidine synthase 1.01e-02 3.26e-04 NA NA
5. P Q0VRM5 Argininosuccinate synthase 5.37e-03 2.21e-12 NA NA
5. P Q6LVG8 Argininosuccinate synthase 4.78e-03 3.76e-14 NA NA
5. P Q3YX68 Argininosuccinate synthase 1.98e-02 1.52e-09 NA NA
5. P Q02QZ6 Argininosuccinate synthase 4.30e-03 1.19e-11 NA NA
5. P P24532 Argininosuccinate synthase 2.70e-02 8.85e-05 NA NA
5. P Q66C31 Argininosuccinate synthase 2.12e-02 2.04e-08 NA NA
5. P Q8ELT8 Argininosuccinate synthase 4.15e-03 6.15e-09 NA NA
5. P Q3YS95 Argininosuccinate synthase 5.04e-03 2.38e-17 NA NA
5. P A5CSJ0 Argininosuccinate synthase 2.76e-03 1.02e-11 NA NA
5. P Q8X8W8 tRNA(Ile)-lysidine synthase 6.86e-02 1.44e-08 NA NA
5. P A7ZDF2 Argininosuccinate synthase 7.47e-03 1.16e-14 NA NA
5. P A1W9F9 Argininosuccinate synthase 2.15e-02 1.01e-10 NA NA
5. P Q64WF9 tRNA(Ile)-lysidine synthase 2.13e-02 2.97e-07 NA NA
5. P A1UH96 Argininosuccinate synthase 3.16e-03 3.37e-13 NA NA
5. P Q9A3H7 tRNA(Ile)-lysidine synthase 1.56e-02 4.08e-07 NA NA
5. P Q3K7K0 Argininosuccinate synthase 4.47e-03 1.11e-11 NA NA
5. P A6SW90 Argininosuccinate synthase 1.90e-02 3.20e-07 NA NA
5. P Q9PR68 tRNA(Ile)-lysidine synthase 5.50e-03 2.55e-03 NA NA
5. P Q03IP8 Argininosuccinate synthase 3.79e-03 1.16e-11 NA NA
5. P Q24ZG8 Argininosuccinate synthase 4.42e-03 1.99e-12 NA NA
5. P Q1MQL7 Argininosuccinate synthase 4.58e-03 1.19e-10 NA NA
5. P Q9RWJ4 Argininosuccinate synthase 3.86e-03 1.92e-12 NA NA
5. P B7IFR8 tRNA(Ile)-lysidine synthase 1.59e-02 4.90e-08 NA NA
5. P B8GXL9 Argininosuccinate synthase 7.34e-03 5.46e-12 NA NA
5. P P37563 tRNA(Ile)-lysidine synthase 1.50e-02 1.42e-05 NA NA
5. P B3ECP2 Argininosuccinate synthase 4.78e-03 4.68e-13 NA NA
5. P C1CNP4 tRNA(Ile)-lysidine synthase 1.85e-01 5.20e-07 NA NA
5. P Q1GVV6 Argininosuccinate synthase 6.16e-03 3.24e-10 NA NA
5. P Q9ZEA3 tRNA(Ile)-lysidine synthase 3.63e-02 1.28e-06 NA NA
5. P A5IRD9 Argininosuccinate synthase 5.57e-03 2.68e-12 NA NA
5. P Q8NXZ4 tRNA(Ile)-lysidine synthase 5.40e-02 9.11e-06 NA NA
5. P Q2JKS2 Argininosuccinate synthase 6.08e-03 2.41e-14 NA NA
5. P A4FDS0 Argininosuccinate synthase 1.73e-02 5.98e-08 NA NA
5. P A1VZ24 Argininosuccinate synthase 7.06e-03 3.83e-12 NA NA
5. P A5WCA0 tRNA(Ile)-lysidine synthase 1.26e-01 2.77e-04 NA NA
5. P Q8DBE4 tRNA(Ile)-lysidine synthase 1.49e-01 1.23e-07 NA NA
5. P Q469Z8 Argininosuccinate synthase 3.20e-03 2.18e-15 NA NA
5. P Q82UP5 Argininosuccinate synthase 4.56e-03 5.94e-14 NA NA
5. P Q8ZLT0 Argininosuccinate synthase 1.92e-02 3.48e-10 NA NA
5. P B0UUD3 tRNA(Ile)-lysidine synthase 2.73e-02 1.44e-08 NA NA
5. P A5WG08 Argininosuccinate synthase 5.32e-03 1.16e-11 NA NA
5. P P59605 Argininosuccinate synthase 4.83e-03 6.26e-11 NA NA
5. P A8G1A4 Argininosuccinate synthase 3.83e-03 1.45e-13 NA NA
5. P C5CAM5 Argininosuccinate synthase 3.59e-03 3.37e-12 NA NA
5. P Q8KDE0 Argininosuccinate synthase 3.62e-03 5.33e-13 NA NA
5. P A8LYQ9 Argininosuccinate synthase 2.94e-03 3.29e-13 NA NA
5. P Q3B425 Argininosuccinate synthase 5.21e-03 1.89e-13 NA NA
5. P O59072 GMP synthase [glutamine-hydrolyzing] subunit B 1.75e-03 6.57e-04 NA NA
5. P Q48F14 Argininosuccinate synthase 4.18e-03 9.75e-12 NA NA
5. P Q46I72 Argininosuccinate synthase 4.38e-03 9.36e-14 NA NA
5. P A4J173 Argininosuccinate synthase 4.12e-03 8.10e-15 NA NA
5. P A6Q3P9 Argininosuccinate synthase 5.44e-03 4.73e-14 NA NA
5. P P59608 Argininosuccinate synthase 2.05e-02 3.63e-07 NA NA
5. P A1JTL6 Argininosuccinate synthase 2.07e-02 3.09e-09 NA NA
5. P B2S2X0 tRNA(Ile)-lysidine synthase 1.06e-02 2.84e-07 NA NA
5. P B0RHD5 Argininosuccinate synthase 2.84e-03 8.60e-12 NA NA
5. P B1YJ35 Argininosuccinate synthase 5.39e-03 2.10e-12 NA NA
5. P Q66I24 Argininosuccinate synthase 5.09e-03 9.11e-14 NA NA
5. P Q8U484 Argininosuccinate synthase 3.24e-03 1.27e-10 NA NA
5. P C4LIE1 Argininosuccinate synthase 3.13e-03 5.00e-16 NA NA
5. P Q886M6 tRNA(Ile)-lysidine synthase 1.05e-01 1.06e-08 NA NA
5. P Q2LT97 Argininosuccinate synthase 5.32e-03 1.60e-12 NA NA
5. P Q5XEL7 tRNA(Ile)-lysidine synthase 1.18e-01 1.59e-04 NA NA
5. P O26806 GMP synthase [glutamine-hydrolyzing] subunit B 4.54e-02 2.80e-02 NA NA
5. P Q7M7P6 Argininosuccinate synthase 5.39e-03 7.39e-12 NA NA
5. P B3CUJ5 tRNA(Ile)-lysidine synthase 6.31e-02 4.94e-07 NA NA
5. P B1IK08 Argininosuccinate synthase 4.48e-03 1.47e-13 NA NA
5. P Q181G3 tRNA(Ile)-lysidine synthase 1.76e-02 4.69e-08 NA NA
5. P Q9PFJ8 tRNA(Ile)-lysidine synthase 9.75e-02 7.82e-09 NA NA
5. P B1W3B3 Argininosuccinate synthase 3.07e-03 1.86e-14 NA NA
5. P Q2NEC4 Argininosuccinate synthase 1.64e-03 5.78e-17 NA NA
5. P Q5PD76 tRNA(Ile)-lysidine synthase 2.38e-02 2.97e-07 NA NA
5. P B4SV18 tRNA(Ile)-lysidine synthase 2.29e-02 3.75e-07 NA NA
5. P Q72W10 tRNA(Ile)-lysidine synthase 2.75e-02 2.64e-08 NA NA
5. P Q39Z72 Argininosuccinate synthase 6.55e-03 5.55e-13 NA NA
5. P Q01QT2 tRNA(Ile)-lysidine synthase 3.02e-02 1.54e-06 NA NA
5. P Q4UWI7 tRNA(Ile)-lysidine synthase 1.37e-01 3.33e-07 NA NA
5. P Q6AR59 Argininosuccinate synthase 4.70e-03 4.42e-15 NA NA
5. P Q5L3T3 tRNA(Ile)-lysidine synthase 1.75e-02 1.29e-05 NA NA
5. P Q5FQB6 tRNA(Ile)-lysidine synthase 7.22e-03 3.83e-10 NA NA
5. P Q8FTM9 Argininosuccinate synthase 3.00e-03 2.44e-15 NA NA
5. P Q12XK3 Argininosuccinate synthase 2.76e-03 3.03e-14 NA NA
5. P B6I1P6 Argininosuccinate synthase 1.91e-02 3.16e-09 NA NA
5. P Q97EB0 tRNA(Ile)-lysidine synthase 2.38e-02 2.02e-07 NA NA
5. P Q8Z996 tRNA(Ile)-lysidine synthase 8.44e-02 2.34e-07 NA NA
5. P B8CNI0 Argininosuccinate synthase 3.71e-03 2.63e-13 NA NA
5. P Q6LN41 tRNA(Ile)-lysidine synthase 1.62e-01 1.81e-07 NA NA
5. P B3CLY6 tRNA(Ile)-lysidine synthase 3.64e-02 5.47e-06 NA NA
5. P Q05FN6 Argininosuccinate synthase 2.95e-03 7.16e-15 NA NA
5. P P94463 Methionyl-tRNA formyltransferase 3.19e-01 3.60e-02 NA NA
5. P A1KWJ8 Argininosuccinate synthase 2.00e-02 6.52e-09 NA NA
5. P B7NDF7 Argininosuccinate synthase 1.98e-02 1.49e-09 NA NA
5. P Q822B9 tRNA(Ile)-lysidine synthase 5.44e-03 4.58e-03 NA NA
5. P A3CWS6 GMP synthase [glutamine-hydrolyzing] subunit B 8.43e-03 4.86e-03 NA NA
5. P Q88Z33 tRNA(Ile)-lysidine synthase 2.79e-02 2.28e-06 NA NA
5. P Q8R7K9 tRNA(Ile)-lysidine synthase 3.07e-02 8.28e-05 NA NA
5. P C0Z6S0 Argininosuccinate synthase 4.33e-03 5.47e-10 NA NA
5. P Q73FE5 tRNA(Ile)-lysidine synthase 1.71e-02 7.36e-08 NA NA
5. P Q8X9M0 Argininosuccinate synthase 2.07e-02 1.97e-09 NA NA
5. P A9BDR3 Argininosuccinate synthase 4.13e-03 1.31e-13 NA NA
5. P A0AYH4 Argininosuccinate synthase 1.90e-02 1.43e-07 NA NA
5. P A1KJ75 Argininosuccinate synthase 3.11e-03 3.91e-15 NA NA
5. P A3NQI1 Argininosuccinate synthase 2.09e-02 4.94e-07 NA NA
5. P Q3ZYX5 tRNA(Ile)-lysidine synthase 2.33e-02 1.64e-03 NA NA
5. P Q1CGZ2 Argininosuccinate synthase 2.16e-02 2.04e-08 NA NA
5. P P44689 tRNA(Ile)-lysidine synthase 6.75e-02 1.18e-08 NA NA
5. P Q7NWJ5 Argininosuccinate synthase 6.13e-03 1.99e-12 NA NA
5. P Q4QND8 tRNA(Ile)-lysidine synthase 6.81e-02 7.14e-09 NA NA
5. P Q9HXZ3 tRNA(Ile)-lysidine synthase 1.15e-01 1.20e-07 NA NA
5. P Q5FUA8 Argininosuccinate synthase 5.79e-03 2.45e-12 NA NA
5. P A8F0E8 tRNA(Ile)-lysidine synthase 4.15e-02 1.04e-06 NA NA
5. P Q2YPQ8 Argininosuccinate synthase 4.72e-03 1.97e-14 NA NA
5. P B2UYI0 Argininosuccinate synthase 4.92e-03 2.59e-13 NA NA
5. P A5F623 tRNA(Ile)-lysidine synthase 1.32e-01 4.69e-08 NA NA
5. P B4F252 tRNA(Ile)-lysidine synthase 6.64e-02 7.24e-06 NA NA
5. P C1A873 tRNA(Ile)-lysidine synthase 7.98e-02 4.33e-06 NA NA
5. P Q5P9R1 tRNA(Ile)-lysidine synthase 3.74e-02 3.01e-08 NA NA
5. P P9WG52 tRNA(Ile)-lysidine synthase 5.42e-02 4.23e-02 NA NA
5. P Q4FR79 Argininosuccinate synthase 5.31e-03 4.80e-13 NA NA
5. P A4YJX9 Argininosuccinate synthase 2.22e-02 2.36e-08 NA NA
5. P Q9HMQ2 Argininosuccinate synthase 2.81e-03 3.65e-15 NA NA
5. P B8FH30 Argininosuccinate synthase 5.02e-03 9.83e-11 NA NA
5. P P59412 Argininosuccinate synthase 3.65e-03 3.16e-13 NA NA
5. P C6DIG9 Argininosuccinate synthase 2.11e-02 1.75e-09 NA NA
5. P A8GL82 Argininosuccinate synthase 3.32e-03 1.94e-14 NA NA
5. P A6VN06 Argininosuccinate synthase 1.94e-02 2.21e-08 NA NA
5. P Q0TMI0 tRNA(Ile)-lysidine synthase 2.02e-02 6.63e-07 NA NA
5. P Q5WYB4 tRNA(Ile)-lysidine synthase 1.16e-01 9.92e-09 NA NA
5. P B1H0L3 Argininosuccinate synthase 6.53e-03 3.14e-11 NA NA
5. P Q8ZH50 tRNA(Ile)-lysidine synthase 8.60e-02 2.78e-07 NA NA
5. P Q12D55 Argininosuccinate synthase 1.80e-02 1.69e-08 NA NA
5. P Q7VPN7 tRNA(Ile)-lysidine synthase 5.29e-02 2.09e-05 NA NA
5. P A5VN19 Argininosuccinate synthase 5.39e-03 1.97e-14 NA NA
5. P Q1R6G5 Argininosuccinate synthase 2.08e-02 1.54e-09 NA NA
5. P P22768 Argininosuccinate synthase 5.31e-03 2.02e-14 NA NA
5. P Q6GJG2 tRNA(Ile)-lysidine synthase 3.48e-02 5.52e-06 NA NA
5. P Q8E272 Argininosuccinate synthase 3.76e-03 4.84e-11 NA NA
5. P Q2SCE5 Argininosuccinate synthase 4.79e-03 1.10e-13 NA NA
5. P A0JV26 Argininosuccinate synthase 2.01e-03 4.14e-14 NA NA
5. P B4TWE1 Argininosuccinate synthase 1.94e-02 3.48e-10 NA NA
5. P B1LFS3 Argininosuccinate synthase 2.08e-02 1.49e-09 NA NA
5. P A8AQ63 Argininosuccinate synthase 1.92e-02 3.24e-10 NA NA
5. P Q8Z3H5 Argininosuccinate synthase 1.95e-02 1.54e-10 NA NA
5. P Q21HZ6 Argininosuccinate synthase 5.47e-03 2.64e-12 NA NA
5. P Q6ACL1 Argininosuccinate synthase 2.43e-02 8.71e-07 NA NA
5. P A8A4Y7 Argininosuccinate synthase 2.05e-02 2.11e-09 NA NA
5. P A1S264 Argininosuccinate synthase 3.69e-03 4.99e-12 NA NA
5. P C3LPP6 tRNA(Ile)-lysidine synthase 3.50e-02 4.69e-08 NA NA
5. P Q5NNQ0 Argininosuccinate synthase 5.46e-03 2.10e-12 NA NA
5. P A1AG76 Argininosuccinate synthase 1.96e-02 1.54e-09 NA NA
5. P Q8THK3 GMP synthase [glutamine-hydrolyzing] subunit B 7.14e-03 3.92e-03 NA NA
5. P A9BM60 Argininosuccinate synthase 2.01e-02 1.44e-09 NA NA
5. P Q97KE6 Argininosuccinate synthase 4.65e-03 8.63e-13 NA NA
5. P P9WPW6 Argininosuccinate synthase 3.21e-03 3.91e-15 NA NA
5. P A8LPE0 Argininosuccinate synthase 5.36e-03 8.82e-12 NA NA
5. P A6VFI6 GMP synthase [glutamine-hydrolyzing] subunit B 8.17e-03 1.81e-02 NA NA
5. P Q9HKF1 Argininosuccinate synthase 5.09e-03 1.06e-08 NA NA
5. P Q0AEE4 Argininosuccinate synthase 4.60e-03 5.47e-13 NA NA
5. P Q2N9H9 Argininosuccinate synthase 6.06e-03 9.15e-12 NA NA
5. P A4VIU7 Argininosuccinate synthase 4.33e-03 2.31e-11 NA NA
5. P Q0AB32 Argininosuccinate synthase 5.32e-03 1.01e-12 NA NA
5. P A1AZB7 Argininosuccinate synthase 6.97e-03 4.42e-14 NA NA
5. P A7Z4J3 Methionyl-tRNA formyltransferase 3.72e-01 1.37e-02 NA NA
5. P Q01Y56 Argininosuccinate synthase 2.04e-02 9.06e-08 NA NA
5. P A3Q0T3 Argininosuccinate synthase 3.26e-03 4.38e-13 NA NA
5. P Q9JXC1 Argininosuccinate synthase 2.01e-02 6.82e-09 NA NA
5. P Q8XWC1 Argininosuccinate synthase 2.21e-02 7.73e-09 NA NA
5. P Q31SC8 Argininosuccinate synthase 6.47e-03 1.07e-13 NA NA
5. P P61526 Argininosuccinate synthase 6.40e-03 8.41e-13 NA NA
5. P F9UST4 Pyridinium-3,5-bisthiocarboxylic acid mononucleotide synthase 9.86e-04 4.24e-03 NA NA
5. P Q8Y074 tRNA(Ile)-lysidine synthase 2.14e-02 2.20e-07 NA NA
5. P A1SRI3 Argininosuccinate synthase 3.23e-03 7.21e-12 NA NA
5. P B1VH30 Argininosuccinate synthase 5.37e-03 5.45e-16 NA NA
5. P A3N4T7 Argininosuccinate synthase 2.00e-02 4.94e-07 NA NA
5. P Q8GDU2 Argininosuccinate synthase (Fragment) 4.28e-03 4.69e-12 NA NA
5. P Q8U9L7 tRNA(Ile)-lysidine synthase 1.19e-02 2.43e-09 NA NA
5. P Q046D9 tRNA(Ile)-lysidine synthase 1.72e-02 1.06e-08 NA NA
5. P P0A6E5 Argininosuccinate synthase 1.99e-02 1.49e-09 NA NA
5. P Q5HVA9 Argininosuccinate synthase 7.32e-03 8.28e-12 NA NA
5. P P50986 Argininosuccinate synthase 3.45e-03 9.98e-16 NA NA
5. P Q317T4 Argininosuccinate synthase 4.96e-03 1.63e-13 NA NA
5. P A5FQ73 Argininosuccinate synthase 6.12e-03 4.42e-10 NA NA
5. P C4Z9C9 Argininosuccinate synthase 5.09e-03 4.56e-13 NA NA
5. P B9LTX1 GMP synthase [glutamine-hydrolyzing] subunit B 8.85e-03 5.47e-03 NA NA
5. P B0JM14 Argininosuccinate synthase 7.18e-03 1.32e-15 NA NA
5. P Q9Z6R2 tRNA(Ile)-lysidine synthase 9.30e-03 3.54e-02 NA NA
5. P Q5N1Z2 Argininosuccinate synthase 6.40e-03 1.07e-13 NA NA
5. P Q9V0I7 GMP synthase [glutamine-hydrolyzing] subunit B 1.76e-03 6.28e-04 NA NA
5. P Q186Z6 Argininosuccinate synthase 7.92e-03 8.74e-13 NA NA
5. P Q30QT1 Argininosuccinate synthase 5.20e-03 6.27e-14 NA NA
5. P Q7VGU9 Argininosuccinate synthase 5.69e-03 3.88e-12 NA NA
5. P Q0TCT8 Argininosuccinate synthase 1.94e-02 1.49e-09 NA NA
5. P Q2J866 Argininosuccinate synthase 1.87e-03 2.92e-13 NA NA
5. P P67152 tRNA(Ile)-lysidine synthase 5.50e-02 4.23e-02 NA NA
5. P Q04MW7 Argininosuccinate synthase 3.67e-03 2.48e-11 NA NA
5. P Q5HBF2 Argininosuccinate synthase 5.06e-03 1.14e-14 NA NA
5. P Q9CNY2 tRNA(Ile)-lysidine synthase 6.57e-02 9.87e-07 NA NA
5. P Q601M6 tRNA(Ile)-lysidine synthase 5.20e-03 9.24e-04 NA NA
5. P P59846 Argininosuccinate synthase 4.87e-03 8.49e-12 NA NA
5. P A5UBF3 Argininosuccinate synthase 1.86e-02 1.38e-10 NA NA
5. P A3MNB7 Argininosuccinate synthase 2.23e-02 4.94e-07 NA NA
5. P A1A1W7 Argininosuccinate synthase 2.27e-03 8.28e-12 NA NA
5. P Q2NIN4 tRNA(Ile)-lysidine synthase 1.82e-02 1.26e-05 NA NA
5. P Q7MYD8 Argininosuccinate synthase 3.42e-03 1.13e-13 NA NA
5. P Q493B5 tRNA(Ile)-lysidine synthase 1.71e-02 1.96e-04 NA NA
5. P A6QFH2 Argininosuccinate synthase 5.64e-03 2.68e-12 NA NA
5. P Q8P7L3 tRNA(Ile)-lysidine synthase 1.34e-01 3.33e-07 NA NA
5. P A9MP33 Argininosuccinate synthase 1.90e-02 1.70e-10 NA NA
5. P B7NKP0 Argininosuccinate synthase 1.98e-02 1.49e-09 NA NA
5. P A1TAA6 Argininosuccinate synthase 2.71e-03 1.10e-13 NA NA
5. P Q8YMX6 Argininosuccinate synthase 7.22e-03 6.24e-15 NA NA
5. P A7FWU6 Argininosuccinate synthase 4.56e-03 8.99e-14 NA NA
5. P A2BTT9 Argininosuccinate synthase 1.05e-02 1.38e-13 NA NA
5. P P0C1A1 Argininosuccinate synthase 1.98e-02 1.52e-09 NA NA
5. P Q0T0B0 Argininosuccinate synthase 1.99e-02 2.60e-09 NA NA
5. P A5D510 Argininosuccinate synthase 4.52e-03 4.74e-13 NA NA
5. P Q117P0 Argininosuccinate synthase 8.17e-03 1.22e-14 NA NA
5. P Q970V0 Argininosuccinate synthase 3.40e-03 7.38e-13 NA NA
5. P Q97TZ8 GMP synthase [glutamine-hydrolyzing] subunit B 4.34e-03 1.19e-06 NA NA
5. P A9WQ90 Argininosuccinate synthase 2.34e-03 1.52e-12 NA NA
5. P C1ANT1 Argininosuccinate synthase 3.21e-03 3.91e-15 NA NA
5. P Q89AX3 tRNA(Ile)-lysidine synthase 8.80e-02 7.13e-04 NA NA
5. P A4WVX3 Argininosuccinate synthase 6.77e-03 1.48e-12 NA NA
5. P A1U3U4 Argininosuccinate synthase 4.43e-03 1.10e-12 NA NA
5. P Q5E2E7 Argininosuccinate synthase 4.91e-03 2.39e-11 NA NA
5. P Q30YB8 Argininosuccinate synthase 5.51e-03 9.71e-11 NA NA
5. P A3PNQ9 Argininosuccinate synthase 6.81e-03 2.34e-13 NA NA
5. P B2J6U2 Argininosuccinate synthase 6.56e-03 3.13e-15 NA NA
5. P Q9K4Y8 Argininosuccinate synthase 1.13e-02 4.18e-11 NA NA
5. P B7UJ66 Argininosuccinate synthase 1.98e-02 1.42e-09 NA NA
5. P Q5F8F6 tRNA(Ile)-lysidine synthase 9.23e-02 4.57e-09 NA NA
5. P P0DG00 tRNA(Ile)-lysidine synthase 1.24e-01 6.23e-05 NA NA
5. P A6TEJ0 Argininosuccinate synthase 2.00e-02 2.06e-10 NA NA
5. P A4XS43 Argininosuccinate synthase 4.20e-03 6.04e-12 NA NA
5. P Q5WAE0 tRNA(Ile)-lysidine synthase 3.25e-02 5.18e-08 NA NA
5. P Q6L1Q1 GMP synthase [glutamine-hydrolyzing] subunit B 4.44e-03 1.96e-03 NA NA
5. P Q056F0 Argininosuccinate synthase 5.97e-03 5.47e-13 NA NA
5. P Q4W568 tRNA(Ile)-lysidine synthase 6.76e-02 1.02e-09 NA NA
5. P O97069 Argininosuccinate synthase 6.01e-03 7.26e-14 NA NA
5. P Q8E7N1 Argininosuccinate synthase 3.42e-03 4.78e-11 NA NA
5. P Q7V3S9 Argininosuccinate synthase 7.00e-03 1.10e-13 NA NA
5. P Q6FYQ5 tRNA(Ile)-lysidine synthase 6.17e-02 3.04e-06 NA NA
5. P P57211 tRNA(Ile)-lysidine synthase 7.78e-02 1.86e-05 NA NA
5. P B0KUE7 Argininosuccinate synthase 4.36e-03 1.40e-11 NA NA
5. P A3CJX7 tRNA(Ile)-lysidine synthase 1.58e-01 2.04e-08 NA NA
5. P C5BC58 Argininosuccinate synthase 3.42e-03 5.86e-14 NA NA
5. P O51728 tRNA(Ile)-lysidine synthase 8.12e-03 2.92e-06 NA NA
5. P Q73N15 tRNA(Ile)-lysidine synthase 7.75e-03 9.57e-07 NA NA
5. P Q3AG78 Argininosuccinate synthase 7.20e-03 4.27e-13 NA NA
5. P B5FI16 Argininosuccinate synthase 1.92e-02 2.98e-10 NA NA
5. P A0LEB2 Argininosuccinate synthase 5.55e-03 3.12e-12 NA NA
5. P Q12ZP6 GMP synthase [glutamine-hydrolyzing] subunit B 6.79e-03 1.00e-03 NA NA
5. P A1VL71 Argininosuccinate synthase 1.97e-02 5.49e-09 NA NA
5. P Q3ZYG0 Argininosuccinate synthase 6.15e-03 4.42e-10 NA NA
5. P A3Q9C9 Argininosuccinate synthase 3.55e-03 8.64e-14 NA NA
5. P B4S9U5 Argininosuccinate synthase 5.76e-03 8.09e-13 NA NA
5. P C3KBZ2 Argininosuccinate synthase 4.19e-03 1.78e-11 NA NA
5. P Q57BI8 tRNA(Ile)-lysidine synthase 2.13e-02 4.85e-05 NA NA
5. P A2C5I6 Argininosuccinate synthase 4.63e-03 1.32e-13 NA NA
5. P Q8TYD7 GMP synthase [glutamine-hydrolyzing] subunit B 1.46e-03 4.27e-03 NA NA
5. P Q8EYP7 Argininosuccinate synthase 5.25e-03 8.19e-13 NA NA
5. P Q3A1V1 Argininosuccinate synthase 6.64e-03 4.13e-12 NA NA
5. P Q6NCS7 Argininosuccinate synthase 1.99e-02 4.37e-09 NA NA
5. P A7NPB0 Argininosuccinate synthase 6.27e-03 1.03e-13 NA NA
5. P Q46D96 GMP synthase [glutamine-hydrolyzing] subunit B 5.54e-03 8.49e-03 NA NA
5. P A5VZI0 Argininosuccinate synthase 4.19e-03 1.87e-11 NA NA
5. P B2HR32 Argininosuccinate synthase 3.27e-03 3.77e-16 NA NA
5. P Q0I061 Argininosuccinate synthase 3.41e-03 6.61e-14 NA NA
5. P Q88MG3 tRNA(Ile)-lysidine synthase 9.19e-02 3.32e-10 NA NA
5. P Q81J84 tRNA(Ile)-lysidine synthase 1.92e-02 2.82e-08 NA NA
5. P B5FJ36 tRNA(Ile)-lysidine synthase 2.34e-02 1.59e-07 NA NA
5. P Q4QJM0 Argininosuccinate synthase 1.85e-02 1.38e-10 NA NA
5. P Q6F0E4 tRNA(Ile)-lysidine synthase 9.95e-03 3.26e-08 NA NA
5. P C3N0R9 GMP synthase [glutamine-hydrolyzing] subunit B 4.96e-03 2.02e-06 NA NA
5. P A7MXZ8 tRNA(Ile)-lysidine synthase 5.58e-02 7.77e-08 NA NA
5. P P63643 Argininosuccinate synthase 3.28e-03 3.91e-15 NA NA
5. P A9KHL4 Argininosuccinate synthase 5.08e-03 3.71e-14 NA NA
6. F Q96ZD9 7-cyano-7-deazaguanine synthase 1 6.38e-05 NA NA 0.5916
6. F B2IUR7 7-cyano-7-deazaguanine synthase 1.89e-04 NA NA 0.477
6. F Q31NK6 7-cyano-7-deazaguanine synthase 1.63e-04 NA NA 0.4742
6. F A4VN94 7-cyano-7-deazaguanine synthase 1.53e-03 NA NA 0.4836
6. F Q24VU8 7-cyano-7-deazaguanine synthase 2 3.42e-04 NA NA 0.4448
6. F C1DRE9 7-cyano-7-deazaguanine synthase 1.60e-03 NA NA 0.4674
6. F Q981C9 7-cyano-7-deazaguanine synthase 8.41e-03 NA NA 0.5304
6. F B0JIA6 7-cyano-7-deazaguanine synthase 1.93e-04 NA NA 0.49
6. F Q55468 7-cyano-7-deazaguanine synthase 2.03e-04 NA NA 0.4977
6. F Q9WY40 tRNA-5-methyluridine(54) 2-sulfurtransferase 7.54e-04 NA NA 0.5236
6. F Q2LVL3 7-cyano-7-deazaguanine synthase 2.55e-04 NA NA 0.4741
6. F B8HQ99 7-cyano-7-deazaguanine synthase 4.15e-04 NA NA 0.4593
6. F Q74FW9 7-cyano-7-deazaguanine synthase 3.88e-04 NA NA 0.4558
6. F A1AWK9 7-cyano-7-deazaguanine synthase 3.02e-04 NA NA 0.477
6. F Q8EE85 7-cyano-7-deazaguanine synthase 7.52e-05 NA NA 0.42
6. F B1JD61 7-cyano-7-deazaguanine synthase 1.44e-03 NA NA 0.483
6. F A5VZV6 7-cyano-7-deazaguanine synthase 1.48e-03 NA NA 0.4895
6. F B2FRM5 7-cyano-7-deazaguanine synthase 2.98e-04 NA NA 0.438
6. F Q46I95 7-cyano-7-deazaguanine synthase 1.33e-03 NA NA 0.4973
6. F A4Y6J4 7-cyano-7-deazaguanine synthase 1.56e-04 NA NA 0.4326
6. F Q88CY4 tRNA sulfurtransferase 9.43e-03 NA NA 0.5137
6. F Q5ZRJ5 7-cyano-7-deazaguanine synthase 3.18e-04 NA NA 0.4714
6. F B9M0M7 7-cyano-7-deazaguanine synthase 1.62e-03 NA NA 0.4602
6. F B2I4Y4 7-cyano-7-deazaguanine synthase 6.22e-06 NA NA 0.5285
6. F B4ST23 7-cyano-7-deazaguanine synthase 3.07e-04 NA NA 0.467
6. F A2BZ78 7-cyano-7-deazaguanine synthase 1.23e-03 NA NA 0.4901
6. F B4RTX3 7-cyano-7-deazaguanine synthase 5.88e-05 NA NA 0.4976
6. F B2STI7 7-cyano-7-deazaguanine synthase 4.44e-06 NA NA 0.4805
6. F B3PC22 7-cyano-7-deazaguanine synthase 1.73e-03 NA NA 0.4626
6. F Q88NI3 7-cyano-7-deazaguanine synthase 1.61e-03 NA NA 0.4809
6. F A3CXN3 7-cyano-7-deazaguanine synthase 7.74e-04 NA NA 0.4723
6. F Q87CW1 7-cyano-7-deazaguanine synthase 6.98e-06 NA NA 0.5139
6. F A6Q342 7-cyano-7-deazaguanine synthase 4.17e-04 NA NA 0.5194
6. F Q8Y1F2 7-cyano-7-deazaguanine synthase 1.90e-03 NA NA 0.4798
6. F Q1GTF3 7-cyano-7-deazaguanine synthase 1 9.77e-04 NA NA 0.4809
6. F Q8P6F6 7-cyano-7-deazaguanine synthase 2.41e-04 NA NA 0.463
6. F Q24ZT5 7-cyano-7-deazaguanine synthase 1 6.28e-06 NA NA 0.5041
6. F A5G8S2 7-cyano-7-deazaguanine synthase 1.44e-03 NA NA 0.4888
6. F A3PFI0 7-cyano-7-deazaguanine synthase 1.24e-03 NA NA 0.509
6. F B0R9W5 7-cyano-7-deazaguanine synthase 6.63e-04 NA NA 0.4843
6. F Q9WWW8 7-cyano-7-deazaguanine synthase 1.49e-03 NA NA 0.4804
6. F Q8F964 7-cyano-7-deazaguanine synthase 3.37e-04 NA NA 0.4815
6. F Q9HJL6 7-cyano-7-deazaguanine synthase 1.83e-03 NA NA 0.4752
6. F Q48FD4 7-cyano-7-deazaguanine synthase 1.76e-03 NA NA 0.4868
6. F Q8ETE9 7-cyano-7-deazaguanine synthase 1.78e-04 NA NA 0.4789
6. F Q3K7W9 7-cyano-7-deazaguanine synthase 1.57e-03 NA NA 0.4704
6. F A2CDY7 7-cyano-7-deazaguanine synthase 1.16e-03 NA NA 0.4615
6. F A8EZR4 7-cyano-7-deazaguanine synthase 3.55e-04 NA NA 0.4708
6. F A1TWU4 7-cyano-7-deazaguanine synthase 7.36e-05 NA NA 0.4893
6. F A2C5G1 7-cyano-7-deazaguanine synthase 1.16e-03 NA NA 0.4989
6. F Q02ID8 7-cyano-7-deazaguanine synthase 1.57e-03 NA NA 0.4766
6. F A6Q9Q9 7-cyano-7-deazaguanine synthase 2.67e-03 NA NA 0.5293
6. F Q2N612 7-cyano-7-deazaguanine synthase 1.72e-04 NA NA 0.4721
6. F B2UTI7 7-cyano-7-deazaguanine synthase 6.92e-04 NA NA 0.4817
6. F Q474K5 7-cyano-7-deazaguanine synthase 1.62e-03 NA NA 0.4782
6. F Q7U3K1 7-cyano-7-deazaguanine synthase 8.06e-04 NA NA 0.4703
6. F Q4JBY3 7-cyano-7-deazaguanine synthase 1.92e-03 NA NA 0.5246
6. F Q4UXK8 7-cyano-7-deazaguanine synthase 1.40e-03 NA NA 0.4642
6. F Q0I671 7-cyano-7-deazaguanine synthase 1.23e-04 NA NA 0.4895
6. F A8FJH9 7-cyano-7-deazaguanine synthase 8.10e-04 NA NA 0.4398
6. F Q4ZWK2 7-cyano-7-deazaguanine synthase 1.53e-03 NA NA 0.4745
6. F Q1RJ87 7-cyano-7-deazaguanine synthase 6.79e-04 NA NA 0.4967
6. F B2U7H6 7-cyano-7-deazaguanine synthase 3.26e-04 NA NA 0.4775
6. F A5CWP9 7-cyano-7-deazaguanine synthase 2.79e-04 NA NA 0.451
6. F Q317V0 7-cyano-7-deazaguanine synthase 1.13e-03 NA NA 0.5008
6. F Q96Y49 7-cyano-7-deazaguanine synthase 2 1.63e-03 NA NA 0.5114
6. F C4XPJ3 7-cyano-7-deazaguanine synthase 4.29e-04 NA NA 0.5145
6. F B0RPZ6 7-cyano-7-deazaguanine synthase 2.44e-04 NA NA 0.4493
6. F B5EDQ7 7-cyano-7-deazaguanine synthase 1.73e-03 NA NA 0.5024
6. F Q5QUZ6 7-cyano-7-deazaguanine synthase 7.02e-05 NA NA 0.5361
6. F Q47ZY2 7-cyano-7-deazaguanine synthase 2 9.26e-04 NA NA 0.4654
6. F B0U2I4 7-cyano-7-deazaguanine synthase 3.54e-04 NA NA 0.458
6. F Q7V3W6 7-cyano-7-deazaguanine synthase 8.24e-04 NA NA 0.4619
6. F Q3A090 7-cyano-7-deazaguanine synthase 2.85e-04 NA NA 0.4922
6. F Q979P0 7-cyano-7-deazaguanine synthase 2.50e-03 NA NA 0.4755
6. F Q4UMZ0 7-cyano-7-deazaguanine synthase 2.95e-04 NA NA 0.4781
6. F Q9PQ71 Probable tRNA sulfurtransferase 2.48e-04 NA NA 0.5551
6. F Q5H288 7-cyano-7-deazaguanine synthase 2.84e-04 NA NA 0.4944
6. F B7UXV6 7-cyano-7-deazaguanine synthase 1.56e-03 NA NA 0.4827
6. F Q478G3 7-cyano-7-deazaguanine synthase 3.33e-04 NA NA 0.4846
6. F Q2Y5H4 7-cyano-7-deazaguanine synthase 3.54e-04 NA NA 0.4902
6. F Q3JER4 7-cyano-7-deazaguanine synthase 2.67e-04 NA NA 0.4956
6. F A1STX3 7-cyano-7-deazaguanine synthase 5.31e-04 NA NA 0.4756
6. F B1AJ58 Probable tRNA sulfurtransferase 2.50e-04 NA NA 0.5549
6. F O29807 7-cyano-7-deazaguanine synthase 7.84e-05 NA NA 0.4872
6. F Q3AUG1 7-cyano-7-deazaguanine synthase 1.06e-03 NA NA 0.4812
6. F Q15RL9 7-cyano-7-deazaguanine synthase 7.07e-05 NA NA 0.5051
6. F Q0K7W8 7-cyano-7-deazaguanine synthase 1.41e-03 NA NA 0.4768
6. F Q7V9H8 7-cyano-7-deazaguanine synthase 8.44e-04 NA NA 0.4891
6. F A8G7J6 7-cyano-7-deazaguanine synthase 1.05e-03 NA NA 0.531
6. F A6WGA4 7-cyano-7-deazaguanine synthase 2.43e-03 NA NA 0.4697
6. F C6E7E7 7-cyano-7-deazaguanine synthase 1.46e-03 NA NA 0.493
6. F Q9V2I3 7-cyano-7-deazaguanine synthase 2.87e-06 NA NA 0.4087
6. F B3R5T4 7-cyano-7-deazaguanine synthase 2.96e-04 NA NA 0.5171
6. F Q3IKE8 7-cyano-7-deazaguanine synthase 5.54e-05 NA NA 0.4907
6. F Q7UZH5 7-cyano-7-deazaguanine synthase 9.22e-04 NA NA 0.5238
6. F A2STX4 7-cyano-7-deazaguanine synthase 9.00e-04 NA NA 0.4782
6. F Q83A28 7-cyano-7-deazaguanine synthase 2.25e-03 NA NA 0.4855
6. F Q3AGF3 7-cyano-7-deazaguanine synthase 8.80e-04 NA NA 0.4878
6. F Q1LJY1 7-cyano-7-deazaguanine synthase 3.18e-04 NA NA 0.4737
6. F Q8DI59 7-cyano-7-deazaguanine synthase 2.75e-04 NA NA 0.4636
6. F A6VX48 7-cyano-7-deazaguanine synthase 7.00e-05 NA NA 0.5058
6. F Q2J7K8 7-cyano-7-deazaguanine synthase 1.81e-03 NA NA 0.5011
6. F Q04PP1 7-cyano-7-deazaguanine synthase 2.18e-03 NA NA 0.486
6. F Q4K7E8 7-cyano-7-deazaguanine synthase 1 1.61e-03 NA NA 0.4879
6. F Q480C9 7-cyano-7-deazaguanine synthase 1 9.10e-05 NA NA 0.4661
6. F Q39R35 7-cyano-7-deazaguanine synthase 3.49e-04 NA NA 0.4573
6. F B7K7J4 7-cyano-7-deazaguanine synthase 1.93e-04 NA NA 0.5019
6. F A2BTS3 7-cyano-7-deazaguanine synthase 1.12e-03 NA NA 0.4767
6. F Q3BQG4 7-cyano-7-deazaguanine synthase 2.37e-04 NA NA 0.4692
6. F A7HHA2 7-cyano-7-deazaguanine synthase 1.76e-03 NA NA 0.513
6. F A8EWF5 7-cyano-7-deazaguanine synthase 1.62e-04 NA NA 0.4902
6. F A5GWT8 7-cyano-7-deazaguanine synthase 1.40e-04 NA NA 0.49
6. F Q72VK9 7-cyano-7-deazaguanine synthase 3.27e-04 NA NA 0.4961
6. F Q2P553 7-cyano-7-deazaguanine synthase 2.90e-04 NA NA 0.4845
6. F Q2IUE0 7-cyano-7-deazaguanine synthase 2 2.43e-04 NA NA 0.5408
6. F A8GVR7 7-cyano-7-deazaguanine synthase 3.92e-04 NA NA 0.4823
6. F B0BUW5 7-cyano-7-deazaguanine synthase 3.74e-04 NA NA 0.4924
6. F A5GPN0 7-cyano-7-deazaguanine synthase 1.35e-04 NA NA 0.4559
6. F Q9HHN8 7-cyano-7-deazaguanine synthase 6.05e-04 NA NA 0.4845
7. B O67091 Glutamine-dependent NAD(+) synthetase 2.88e-03 NA 0.005 NA
7. B Q0VNF0 GMP synthase [glutamine-hydrolyzing] 4.56e-02 NA 0.016 NA
7. B Q4FMW8 GMP synthase [glutamine-hydrolyzing] 5.55e-02 NA 0.007 NA