Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54759.1

JCVISYN3A_0391

Elongation factor P.
M. mycoides homolog: Q6MTF7.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.

Statistics

Total GO Annotation: 16
Unique PROST Go: 0
Unique BLAST Go: 2
Unique Foldseek Go: 5

Total Homologs: 918
Unique PROST Homologs: 0
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 59

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: efp; Elongation factor P
Zhang et al. [4]: GO:0006414|translational elongation
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A1VMR1 (Elongation factor P) with a FATCAT P-Value: 0 and RMSD of 2.76 angstrom. The sequence alignment identity is 31.8%.
Structural alignment shown in left. Query protein AVX54759.1 colored as red in alignment, homolog A1VMR1 colored as blue. Query protein AVX54759.1 is also shown in right top, homolog A1VMR1 showed in right bottom. They are colored based on secondary structures.

  AVX54759.1 MSV-NDLRPGTTFLYDG-NIYLVLEQAFSKTGRQQGKVTVKAKNMRTGARVELTFTGGEKVDKAMIERKEMQYLY-NDGNDAYL-MNTETYEQVSIP--- 93
      A1VMR1 MKIAQEIRAG-NVIMNGKDPMVVLKTEYSRGGRNSATVRMKLKSLIANFNTEVVFKADDKIDQVILDKKECTYSYFAD--PMYICMDTE-YNQYEVEAEN 96

  AVX54759.1 M-TRLEWEKNFLVDGLMINMTEFENEVLGIDLPVKV--ELTVVEAEAAVKGDTTSG-AQKKAILETGLEIMVPLFVNQGTKIIVSSADGKYVGRA 184
      A1VMR1 MGDSL----NYLQDGMELEVVFYDGKAISVEVPTSVQREIT--WTEPAVKGD-TSGKVLKPAKLATGFEIGVPIFVAQGDVVEIDTRTGEYRKRV 184

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0003746	translation elongation factor activity
3. BF	GO:0043022	ribosome binding
3. BF	GO:0045905	positive regulation of translational termination
3. BF	GO:0045901	positive regulation of translational elongation
3. BF	GO:0003743	translation initiation factor activity
4. PB	GO:0005829	cytosol
4. PB	GO:0006414	translational elongation
4. PB	GO:2001125	negative regulation of translational frameshifting
6. F	GO:0051028	mRNA transport
6. F	GO:0090343	positive regulation of cell aging
6. F	GO:0008612	peptidyl-lysine modification to peptidyl-hypusine
6. F	GO:0005643	nuclear pore
6. F	GO:0060491	regulation of cell projection assembly
7. B	GO:0005886	plasma membrane
7. B	GO:0016021	integral component of membrane

Uniprot GO Annotations

GO	Description
GO:0006412	translation
GO:0006414	translational elongation
GO:0043043	peptide biosynthetic process
GO:0005737	cytoplasm
GO:0003746	translation elongation factor activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	A6UF66	Elongation factor P	0.00e+00	3.27e-45	1.66e-30	0.8978
1. PBF	A0Q415	Elongation factor P	0.00e+00	4.04e-43	9.37e-25	0.9066
1. PBF	A6V3N9	Elongation factor P	3.44e-15	9.75e-43	1.13e-18	0.769
1. PBF	A8EXY7	Elongation factor P	1.40e-14	3.61e-51	1.82e-30	0.664
1. PBF	Q28M91	Elongation factor P	0.00e+00	3.35e-45	5.65e-33	0.7716
1. PBF	Q7MZX9	Elongation factor P	0.00e+00	4.03e-40	1.04e-25	0.9415
1. PBF	Q8EWP5	Elongation factor P	0.00e+00	9.89e-54	3.50e-54	0.9569
1. PBF	B2G967	Elongation factor P	0.00e+00	7.25e-50	2.10e-37	0.8391
1. PBF	P57811	Elongation factor P	0.00e+00	5.47e-38	1.15e-23	0.9154
1. PBF	B2K9G9	Elongation factor P-like protein	7.43e-14	4.47e-42	7.73e-22	0.7227
1. PBF	A6KXS5	Elongation factor P	0.00e+00	2.77e-45	1.65e-31	0.9064
1. PBF	C0MEL3	Elongation factor P	0.00e+00	2.68e-50	2.02e-35	0.7
1. PBF	B5BE26	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7345
1. PBF	Q6G937	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9304
1. PBF	B7I499	Elongation factor P	0.00e+00	1.75e-43	2.84e-31	0.9368
1. PBF	B8DJK7	Elongation factor P	0.00e+00	8.73e-53	3.05e-32	0.9223
1. PBF	C4K7E2	Elongation factor P	0.00e+00	2.52e-35	3.64e-25	0.9332
1. PBF	Q2P1R7	Elongation factor P-like protein	0.00e+00	2.89e-50	4.09e-17	0.8587
1. PBF	P47272	Elongation factor P	0.00e+00	1.96e-49	4.04e-45	0.9202
1. PBF	A1WMV6	Elongation factor P	0.00e+00	1.92e-43	2.39e-22	0.8053
1. PBF	A6WN92	Elongation factor P	0.00e+00	1.23e-50	1.58e-13	0.7712
1. PBF	P0DA86	Elongation factor P	1.71e-14	2.90e-49	1.03e-39	0.7236
1. PBF	A1WYI1	Elongation factor P	0.00e+00	2.68e-44	1.48e-33	0.9454
1. PBF	B7V9K9	Elongation factor P	0.00e+00	9.75e-43	1.13e-18	0.7768
1. PBF	Q1JK85	Elongation factor P	0.00e+00	2.90e-49	1.03e-39	0.8734
1. PBF	B6ELB8	Elongation factor P-like protein	0.00e+00	6.91e-47	1.61e-16	0.6774
1. PBF	A8GMN6	Elongation factor P	1.11e-16	3.19e-51	8.58e-31	0.6957
1. PBF	B9K846	Elongation factor P	0.00e+00	1.05e-56	3.91e-46	0.7935
1. PBF	P0A6N7	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9334
1. PBF	C3LLQ5	Elongation factor P-like protein	0.00e+00	1.27e-48	1.17e-17	0.8598
1. PBF	Q3JQ86	Elongation factor P	0.00e+00	3.63e-52	6.11e-21	0.7962
1. PBF	C1CIT4	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.8755
1. PBF	Q9JUU2	Elongation factor P	0.00e+00	8.41e-46	5.16e-19	0.8731
1. PBF	Q2YRC4	Elongation factor P	0.00e+00	3.38e-46	2.42e-32	0.8638
1. PBF	P0A6N5	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9326
1. PBF	Q83KE6	Elongation factor P-like protein	0.00e+00	1.30e-40	2.45e-22	0.7382
1. PBF	P0C103	Elongation factor P	0.00e+00	3.38e-46	2.42e-32	0.8513
1. PBF	Q30ZZ6	Elongation factor P	0.00e+00	7.07e-50	1.05e-32	0.8927
1. PBF	C0Q0S9	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7358
1. PBF	Q6KH93	Elongation factor P	1.53e-14	3.64e-44	4.22e-60	0.7115
1. PBF	Q0SRY9	Elongation factor P	0.00e+00	7.98e-48	1.19e-38	0.8773
1. PBF	Q0SNU8	Elongation factor P	0.00e+00	3.04e-47	2.43e-30	0.9293
1. PBF	Q8YIW2	Elongation factor P	0.00e+00	3.38e-46	2.42e-32	0.8459
1. PBF	B7UPW7	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9327
1. PBF	A8AE51	Elongation factor P-like protein	0.00e+00	2.94e-44	1.47e-22	0.7621
1. PBF	A1VYR0	Elongation factor P	0.00e+00	4.67e-45	1.88e-33	0.9303
1. PBF	Q1GF47	Elongation factor P	0.00e+00	6.75e-47	4.51e-34	0.7821
1. PBF	A1JIP6	Elongation factor P	0.00e+00	3.59e-43	8.96e-31	0.9423
1. PBF	A8GRA8	Elongation factor P	1.55e-15	2.04e-50	6.11e-32	0.693
1. PBF	Q1R3B2	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9295
1. PBF	B5Z2F6	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9281
1. PBF	Q2KXA0	Elongation factor P	0.00e+00	3.16e-44	1.18e-20	0.7525
1. PBF	Q885R6	Elongation factor P	0.00e+00	1.73e-41	6.19e-19	0.6595
1. PBF	A1JLS4	Elongation factor P-like protein	0.00e+00	4.70e-41	3.74e-20	0.7614
1. PBF	A6VR54	Elongation factor P	0.00e+00	2.26e-39	6.76e-24	0.9301
1. PBF	B2GI94	Elongation factor P	0.00e+00	3.19e-51	2.27e-37	0.9305
1. PBF	Q5FHJ7	Elongation factor P	0.00e+00	5.79e-49	6.35e-27	0.8485
1. PBF	Q9Z711	Elongation factor P 2	0.00e+00	1.20e-46	2.16e-30	0.9394
1. PBF	Q9PHW3	Elongation factor P	0.00e+00	4.67e-45	1.88e-33	0.9354
1. PBF	Q6MTF7	Elongation factor P	0.00e+00	1.15e-114	1.70e-133	0.9994
1. PBF	A1VMR1	Elongation factor P	0.00e+00	3.16e-38	3.16e-22	0.8231
1. PBF	Q4UKM7	Elongation factor P	6.11e-15	1.57e-51	1.41e-32	0.6547
1. PBF	B3CQC7	Elongation factor P	1.84e-14	7.86e-45	7.15e-27	0.7123
1. PBF	Q7V3P5	Elongation factor P	0.00e+00	1.15e-45	1.21e-37	0.9399
1. PBF	A7X2Q9	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9393
1. PBF	A7IID0	Elongation factor P	0.00e+00	7.86e-45	9.87e-23	0.6757
1. PBF	B7N5D5	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7459
1. PBF	C5BNT8	Elongation factor P	0.00e+00	6.12e-47	6.11e-31	0.9405
1. PBF	Q8DCX6	Elongation factor P	0.00e+00	2.03e-41	9.65e-25	0.9478
1. PBF	Q7NL41	Elongation factor P	0.00e+00	1.13e-52	2.29e-40	0.9212
1. PBF	B2HVL6	Elongation factor P	0.00e+00	1.75e-43	2.84e-31	0.9365
1. PBF	Q0BT69	Elongation factor P	0.00e+00	8.59e-49	2.24e-31	0.6838
1. PBF	Q3IFP5	Elongation factor P	0.00e+00	1.13e-39	8.67e-25	0.9364
1. PBF	A5CDP1	Elongation factor P	1.11e-14	1.98e-45	1.47e-26	0.6757
1. PBF	Q74IL7	Elongation factor P 2	0.00e+00	6.50e-45	8.98e-50	0.958
1. PBF	Q1C9A5	Elongation factor P-like protein	0.00e+00	4.47e-42	7.73e-22	0.7422
1. PBF	Q45288	Elongation factor P	0.00e+00	1.02e-46	1.58e-29	0.9358
1. PBF	A8LY10	Elongation factor P	0.00e+00	3.11e-51	4.71e-34	0.9204
1. PBF	P43771	Elongation factor P	0.00e+00	9.66e-38	2.21e-23	0.9228
1. PBF	B8CPB0	Elongation factor P	0.00e+00	4.76e-51	1.35e-17	0.8692
1. PBF	Q8P9M3	Elongation factor P-like protein	0.00e+00	4.52e-50	1.19e-20	0.8355
1. PBF	Q8R5X5	Elongation factor P	2.22e-16	4.43e-43	1.31e-23	0.6969
1. PBF	B9DNQ4	Elongation factor P	0.00e+00	2.56e-47	1.16e-49	0.9039
1. PBF	B5F2L4	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9348
1. PBF	Q87NC0	Elongation factor P-like protein	0.00e+00	5.30e-52	1.65e-17	0.824
1. PBF	B1VDM5	Elongation factor P	0.00e+00	5.02e-48	6.41e-32	0.912
1. PBF	Q3SKH1	Elongation factor P	0.00e+00	1.56e-45	5.18e-18	0.6726
1. PBF	A9N6H3	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7349
1. PBF	Q5LU15	Elongation factor P	0.00e+00	2.25e-46	1.96e-33	0.8382
1. PBF	Q0BXH7	Elongation factor P	0.00e+00	2.66e-46	3.52e-32	0.6505
1. PBF	A8ZVH5	Elongation factor P	0.00e+00	9.31e-42	2.83e-35	0.931
1. PBF	B3QHV4	Elongation factor P	0.00e+00	4.33e-43	3.76e-25	0.6748
1. PBF	Q4L6M9	Elongation factor P	0.00e+00	9.31e-43	2.63e-47	0.9388
1. PBF	Q5FJG2	Elongation factor P 2	0.00e+00	2.06e-47	2.15e-46	0.9516
1. PBF	Q65HH4	Elongation factor P	0.00e+00	5.76e-54	3.03e-49	0.7387
1. PBF	A1V6B0	Elongation factor P	0.00e+00	3.63e-52	6.11e-21	0.8122
1. PBF	Q9KNS1	Elongation factor P	0.00e+00	1.20e-38	7.54e-25	0.9436
1. PBF	Q7MGX2	Elongation factor P	0.00e+00	2.03e-41	9.65e-25	0.9483
1. PBF	B0S053	Elongation factor P	0.00e+00	1.36e-50	3.30e-37	0.9054
1. PBF	A4JCR8	Elongation factor P	0.00e+00	3.28e-52	5.33e-22	0.8205
1. PBF	Q0IE51	Elongation factor P	0.00e+00	1.47e-50	1.35e-36	0.872
1. PBF	B8I3C7	Elongation factor P	0.00e+00	1.89e-45	1.94e-38	0.8514
1. PBF	Q98Q55	Elongation factor P	0.00e+00	6.12e-51	6.88e-63	0.8746
1. PBF	Q2NAZ6	Elongation factor P	0.00e+00	3.69e-47	7.81e-36	0.7566
1. PBF	B2VL81	Elongation factor P	0.00e+00	9.74e-44	7.15e-28	0.9426
1. PBF	Q49XX3	Elongation factor P	0.00e+00	3.83e-48	7.70e-54	0.9285
1. PBF	C3PMT5	Elongation factor P	3.33e-16	3.99e-51	1.46e-31	0.6923
1. PBF	Q65V95	Elongation factor P	0.00e+00	2.63e-35	3.56e-24	0.9077
1. PBF	B2S3B8	Elongation factor P	0.00e+00	4.78e-48	5.17e-29	0.7706
1. PBF	Q8EXB9	Elongation factor P	0.00e+00	5.77e-41	1.32e-24	0.9347
1. PBF	A5FFT9	Elongation factor P	0.00e+00	1.32e-49	1.05e-32	0.9091
1. PBF	Q0SXD0	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9318
1. PBF	A6TH65	Elongation factor P	0.00e+00	5.09e-43	4.10e-29	0.9294
1. PBF	P0A3B5	Elongation factor P	0.00e+00	2.57e-40	9.52e-29	0.9203
1. PBF	Q0S0M7	Elongation factor P	0.00e+00	8.08e-53	9.07e-39	0.8985
1. PBF	A4QEJ4	Elongation factor P	0.00e+00	1.02e-46	1.58e-29	0.9362
1. PBF	A9M4D6	Elongation factor P	0.00e+00	3.07e-46	8.77e-19	0.8675
1. PBF	A5UAF9	Elongation factor P	0.00e+00	9.66e-38	2.21e-23	0.9199
1. PBF	A1UFJ5	Elongation factor P	0.00e+00	3.31e-48	1.32e-37	0.9243
1. PBF	B4T2P5	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9345
1. PBF	A3DDQ3	Elongation factor P	0.00e+00	2.44e-44	1.23e-42	0.7999
1. PBF	B5RR32	Elongation factor P	0.00e+00	1.23e-44	1.04e-31	0.7105
1. PBF	B9K2E5	Elongation factor P	0.00e+00	8.04e-45	2.92e-29	0.6681
1. PBF	B7KT38	Elongation factor P	0.00e+00	1.15e-46	1.28e-28	0.6644
1. PBF	Q5HP20	Elongation factor P	0.00e+00	9.47e-46	4.13e-50	0.9521
1. PBF	A1SJD7	Elongation factor P	0.00e+00	1.17e-44	6.14e-39	0.9334
1. PBF	A7MMC3	Elongation factor P	0.00e+00	6.04e-41	6.87e-29	0.935
1. PBF	C5CI92	Elongation factor P	0.00e+00	1.63e-50	6.94e-38	0.8705
1. PBF	B0SII2	Elongation factor P	0.00e+00	4.73e-46	4.28e-25	0.6556
1. PBF	B8G711	Elongation factor P	0.00e+00	5.21e-46	6.82e-29	0.8552
1. PBF	A4SGK2	Elongation factor P	0.00e+00	5.21e-43	3.20e-28	0.828
1. PBF	B3E058	Elongation factor P	6.66e-16	4.79e-42	1.65e-31	0.7454
1. PBF	P64044	Elongation factor P	0.00e+00	6.57e-36	9.51e-24	0.9199
1. PBF	Q73P31	Elongation factor P	0.00e+00	2.30e-51	1.40e-33	0.9014
1. PBF	Q9JZQ8	Elongation factor P	0.00e+00	3.07e-46	8.77e-19	0.8773
1. PBF	A5IY97	Elongation factor P	4.44e-16	3.21e-49	4.92e-61	0.7047
1. PBF	B3R1Z3	Elongation factor P	0.00e+00	6.09e-49	1.41e-24	0.655
1. PBF	Q6N6V1	Elongation factor P	3.33e-16	1.35e-43	2.40e-25	0.6614
1. PBF	B3PIK9	Elongation factor P	0.00e+00	1.20e-41	1.33e-18	0.8033
1. PBF	B5BKF8	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.932
1. PBF	A3MM35	Elongation factor P	0.00e+00	3.63e-52	6.11e-21	0.8212
1. PBF	B1YLP7	Elongation factor P	0.00e+00	4.03e-48	5.77e-44	0.8085
1. PBF	P64045	Elongation factor P	0.00e+00	6.57e-36	9.51e-24	0.9157
1. PBF	B4ETA2	Elongation factor P-like protein	0.00e+00	5.77e-45	7.49e-19	0.7496
1. PBF	B2GES0	Elongation factor P	0.00e+00	2.66e-46	1.64e-38	0.8273
1. PBF	A9MFR5	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9304
1. PBF	C4XT92	Elongation factor P	0.00e+00	1.73e-49	1.74e-39	0.9026
1. PBF	Q3ATP1	Elongation factor P	1.21e-13	8.04e-45	1.75e-28	0.7435
1. PBF	Q1J163	Elongation factor P	0.00e+00	9.75e-43	1.06e-41	0.9579
1. PBF	B5R181	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7388
1. PBF	B5R009	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9348
1. PBF	Q1QUI0	Elongation factor P	0.00e+00	2.71e-38	3.20e-29	0.9329
1. PBF	C0QW93	Elongation factor P	0.00e+00	2.40e-45	1.94e-38	0.6635
1. PBF	Q07MG7	Elongation factor P	0.00e+00	4.04e-43	5.13e-25	0.7472
1. PBF	C5C680	Elongation factor P	0.00e+00	2.01e-47	5.39e-34	0.916
1. PBF	Q66CT6	Elongation factor P-like protein	5.68e-14	4.47e-42	7.73e-22	0.7346
1. PBF	Q9PLH1	Elongation factor P 2	0.00e+00	6.62e-46	4.09e-30	0.9133
1. PBF	A9WFA4	Elongation factor P	0.00e+00	1.85e-45	1.53e-28	0.8533
1. PBF	Q2NJ31	Elongation factor P	0.00e+00	2.10e-43	2.05e-38	0.881
1. PBF	B5EPM9	Elongation factor P	0.00e+00	1.74e-52	5.21e-38	0.8587
1. PBF	Q02P14	Elongation factor P	6.55e-15	9.75e-43	1.13e-18	0.7649
1. PBF	Q5HFN0	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.938
1. PBF	C1CPU3	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.8508
1. PBF	Q4A9R0	Elongation factor P	0.00e+00	2.87e-57	1.03e-61	0.6985
1. PBF	P75085	Elongation factor P	0.00e+00	9.26e-52	9.65e-44	0.9463
1. PBF	B7GPV9	Elongation factor P	0.00e+00	3.36e-52	5.56e-33	0.811
1. PBF	A3PZ56	Elongation factor P	0.00e+00	3.31e-48	1.32e-37	0.9245
1. PBF	B1XTM0	Elongation factor P	0.00e+00	2.58e-45	4.86e-22	0.8075
1. PBF	Q74HT9	Elongation factor P 1	2.54e-14	2.09e-46	2.69e-32	0.7354
1. PBF	Q62LS3	Elongation factor P	0.00e+00	3.63e-52	6.11e-21	0.806
1. PBF	A7ZNZ5	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7412
1. PBF	Q3BSF5	Elongation factor P	0.00e+00	3.69e-35	3.57e-21	0.9162
1. PBF	B2TY23	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9294
1. PBF	A0Q087	Elongation factor P	6.66e-16	1.74e-47	3.26e-39	0.7086
1. PBF	A1S699	Elongation factor P	2.23e-14	5.52e-50	5.67e-17	0.7596
1. PBF	Q0BGZ7	Elongation factor P	0.00e+00	4.21e-49	9.90e-22	0.8376
1. PBF	B2RZS4	Elongation factor P	0.00e+00	8.07e-51	5.97e-26	0.9301
1. PBF	Q1BXT4	Elongation factor P	0.00e+00	3.30e-53	1.73e-20	0.8209
1. PBF	C1L2R1	Elongation factor P	0.00e+00	1.59e-50	7.21e-50	0.7662
1. PBF	Q493W6	Elongation factor P	0.00e+00	8.68e-41	2.88e-11	0.9085
1. PBF	B1XKV1	Elongation factor P	0.00e+00	2.83e-53	1.15e-35	0.8844
1. PBF	A4WCK1	Elongation factor P-like protein	0.00e+00	6.10e-44	2.52e-21	0.7738
1. PBF	Q983M5	Elongation factor P 2	0.00e+00	1.53e-40	2.32e-27	0.6845
1. PBF	B7JVR7	Elongation factor P	0.00e+00	3.85e-53	1.92e-41	0.9264
1. PBF	Q21GV1	Elongation factor P-like protein	4.22e-15	1.80e-44	1.76e-19	0.6792
1. PBF	B9JDI1	Elongation factor P	0.00e+00	3.61e-50	3.28e-29	0.9166
1. PBF	A7MS04	Elongation factor P-like protein	0.00e+00	1.27e-48	4.86e-18	0.8061
1. PBF	A5N7H7	Elongation factor P	0.00e+00	2.25e-46	2.80e-39	0.8887
1. PBF	A2SA02	Elongation factor P	0.00e+00	3.63e-52	6.11e-21	0.8109
1. PBF	C5CUK1	Elongation factor P	0.00e+00	3.80e-42	1.59e-25	0.8036
1. PBF	C3P7X5	Elongation factor P	0.00e+00	1.47e-50	8.49e-48	0.8875
1. PBF	A1UR93	Elongation factor P	0.00e+00	7.98e-48	1.33e-31	0.8552
1. PBF	Q328H8	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9314
1. PBF	B7M521	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7423
1. PBF	Q83AR4	Elongation factor P	0.00e+00	2.14e-40	1.13e-34	0.948
1. PBF	Q3B0X4	Elongation factor P	0.00e+00	1.91e-49	5.13e-37	0.8684
1. PBF	Q2IVV2	Elongation factor P	0.00e+00	2.15e-43	1.89e-25	0.7716
1. PBF	B1JYC0	Elongation factor P	0.00e+00	3.30e-53	1.73e-20	0.8145
1. PBF	B0KUN5	Elongation factor P	2.52e-14	3.28e-43	3.58e-20	0.7191
1. PBF	A9IYN9	Elongation factor P	0.00e+00	4.16e-47	3.94e-32	0.8383
1. PBF	Q9CCS0	Elongation factor P	0.00e+00	3.91e-49	5.96e-36	0.8981
1. PBF	B4SQB1	Elongation factor P	0.00e+00	1.72e-34	3.86e-22	0.903
1. PBF	Q31T82	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9311
1. PBF	A9MK40	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7417
1. PBF	B2HND2	Elongation factor P	0.00e+00	6.73e-50	1.82e-37	0.9112
1. PBF	A4VMG3	Elongation factor P	1.68e-13	2.17e-44	2.47e-18	0.7147
1. PBF	B7MF86	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7843
1. PBF	Q2JP65	Elongation factor P	0.00e+00	1.86e-49	4.74e-42	0.9338
1. PBF	A8AZB9	Elongation factor P	0.00e+00	1.48e-48	5.69e-38	0.8832
1. PBF	Q92IU8	Elongation factor P	1.62e-14	3.35e-51	1.39e-31	0.6592
1. PBF	B2U987	Elongation factor P	0.00e+00	8.59e-49	6.96e-30	0.8416
1. PBF	B1IMQ0	Elongation factor P	0.00e+00	1.17e-44	1.58e-42	0.8894
1. PBF	O67376	Elongation factor P	0.00e+00	2.33e-44	6.04e-40	0.9241
1. PBF	Q137K5	Elongation factor P	0.00e+00	5.30e-44	3.60e-25	0.75
1. PBF	B9KIA2	Elongation factor P	0.00e+00	2.33e-54	1.44e-35	0.6305
1. PBF	A5CRY6	Elongation factor P	0.00e+00	5.53e-48	6.80e-35	0.9225
1. PBF	B2V4S9	Elongation factor P	0.00e+00	1.12e-42	1.10e-35	0.9221
1. PBF	Q3JZJ4	Elongation factor P	0.00e+00	4.66e-48	3.71e-37	0.7544
1. PBF	P64038	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.937
1. PBF	P68773	Elongation factor P	0.00e+00	2.90e-49	1.03e-39	0.9154
1. PBF	A1KTK6	Elongation factor P	0.00e+00	8.41e-46	5.16e-19	0.8817
1. PBF	Q8XJC5	Elongation factor P	0.00e+00	7.98e-48	1.19e-38	0.8694
1. PBF	A6U200	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9363
1. PBF	P64039	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9366
1. PBF	Q2A5M4	Elongation factor P	0.00e+00	1.09e-44	2.69e-23	0.9109
1. PBF	Q7MM44	Elongation factor P-like protein	0.00e+00	2.00e-49	3.25e-18	0.8307
1. PBF	Q82W02	Elongation factor P	0.00e+00	1.45e-49	6.94e-21	0.6923
1. PBF	A5CXM6	Elongation factor P	0.00e+00	3.20e-43	1.72e-25	0.8849
1. PBF	A5F1Y2	Elongation factor P-like protein	0.00e+00	1.27e-48	1.17e-17	0.8359
1. PBF	Q5HBL2	Elongation factor P	0.00e+00	5.79e-49	6.35e-27	0.8574
1. PBF	B6I254	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9297
1. PBF	Q2LRN9	Elongation factor P	0.00e+00	5.60e-46	1.23e-34	0.914
1. PBF	A8A234	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7436
1. PBF	B7NMY6	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7425
1. PBF	B0RSN5	Elongation factor P-like protein	0.00e+00	4.52e-50	1.19e-20	0.8086
1. PBF	Q2J829	Elongation factor P	0.00e+00	1.44e-42	6.38e-38	0.9228
1. PBF	B4U7D5	Elongation factor P	0.00e+00	2.19e-40	1.33e-32	0.8728
1. PBF	B0U3W3	Elongation factor P	0.00e+00	4.76e-36	2.03e-22	0.9137
1. PBF	P64036	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9316
1. PBF	A3CL43	Elongation factor P	0.00e+00	4.52e-50	5.27e-38	0.8636
1. PBF	P64033	Elongation factor P	0.00e+00	1.59e-50	7.21e-50	0.7682
1. PBF	C4Z8W1	Elongation factor P	0.00e+00	5.82e-44	6.36e-38	0.9243
1. PBF	Q1CED7	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.9429
1. PBF	Q6HDW8	Elongation factor P	0.00e+00	1.47e-50	8.49e-48	0.8775
1. PBF	Q14JL2	Elongation factor P	0.00e+00	1.09e-44	2.69e-23	0.9142
1. PBF	B8H1A0	Elongation factor P	0.00e+00	7.78e-48	2.38e-27	0.9022
1. PBF	Q6G1Z7	Elongation factor P	0.00e+00	1.33e-46	1.19e-32	0.8376
1. PBF	Q6FYN9	Elongation factor P	0.00e+00	1.04e-46	2.99e-30	0.8325
1. PBF	Q48RL6	Elongation factor P	0.00e+00	6.57e-50	8.59e-40	0.8771
1. PBF	Q600M5	Elongation factor P	3.77e-15	4.92e-55	3.32e-62	0.7369
1. PBF	A5EIT5	Elongation factor P	0.00e+00	8.46e-44	1.02e-24	0.6683
1. PBF	Q8A1F7	Elongation factor P	0.00e+00	1.61e-46	3.16e-30	0.8998
1. PBF	P49778	Elongation factor P	0.00e+00	2.94e-54	3.27e-51	0.7562
1. PBF	Q2FGJ3	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9409
1. PBF	C0MBK0	Elongation factor P	0.00e+00	2.90e-49	3.33e-35	0.7061
1. PBF	A3NBS1	Elongation factor P	0.00e+00	3.63e-52	6.11e-21	0.8078
1. PBF	B6YQT1	Elongation factor P	0.00e+00	1.18e-47	3.62e-29	0.9083
1. PBF	B7LC03	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9304
1. PBF	A4TNC5	Elongation factor P-like protein	0.00e+00	4.47e-42	7.73e-22	0.7397
1. PBF	Q13VN6	Elongation factor P	0.00e+00	3.63e-49	4.86e-24	0.8178
1. PBF	Q39I66	Elongation factor P	0.00e+00	4.27e-53	3.13e-22	0.8228
1. PBF	B2V9Q7	Elongation factor P	0.00e+00	4.93e-40	3.94e-33	0.7116
1. PBF	Q2Y9K0	Elongation factor P	0.00e+00	9.07e-50	1.36e-26	0.9461
1. PBF	Q7VX16	Elongation factor P	0.00e+00	1.07e-44	8.86e-21	0.7711
1. PBF	B1AIT6	Elongation factor P	0.00e+00	2.86e-48	7.86e-56	0.7433
1. PBF	B5FNL7	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7404
1. PBF	B2A549	Elongation factor P	0.00e+00	8.04e-45	1.42e-38	0.9615
1. PBF	Q5HVL5	Elongation factor P	0.00e+00	4.67e-45	1.88e-33	0.9365
1. PBF	B2FQ58	Elongation factor P-like protein	0.00e+00	5.79e-49	3.43e-18	0.8739
1. PBF	Q4ZQB2	Elongation factor P	0.00e+00	1.69e-41	6.42e-20	0.6626
1. PBF	C1C5H0	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.8757
1. PBF	C5D486	Elongation factor P	0.00e+00	7.30e-51	1.16e-52	0.7733
1. PBF	A7H4J1	Elongation factor P	0.00e+00	4.67e-45	1.88e-33	0.9357
1. PBF	Q89B31	Elongation factor P	0.00e+00	1.35e-42	5.81e-08	0.9098
1. PBF	Q2RVG7	Elongation factor P	0.00e+00	2.89e-52	6.68e-30	0.8245
1. PBF	Q1GTJ4	Elongation factor P	0.00e+00	1.52e-44	1.27e-35	0.8358
1. PBF	Q21W89	Elongation factor P	0.00e+00	4.10e-46	9.14e-21	0.826
1. PBF	B4SY47	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7329
1. PBF	C3MCN8	Elongation factor P	0.00e+00	3.01e-44	7.11e-28	0.8987
1. PBF	Q1B9G8	Elongation factor P	0.00e+00	3.31e-48	1.32e-37	0.93
1. PBF	Q5PE39	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7378
1. PBF	Q48FP6	Elongation factor P	0.00e+00	1.31e-41	9.81e-20	0.6592
1. PBF	P57133	Elongation factor P	0.00e+00	1.71e-40	1.26e-22	0.9246
1. PBF	Q47EF1	Elongation factor P	0.00e+00	2.08e-48	1.07e-21	0.8318
1. PBF	Q6APZ9	Elongation factor P	0.00e+00	2.53e-48	2.46e-34	0.9257
1. PBF	Q3J7W7	Elongation factor P	0.00e+00	1.54e-41	3.90e-30	0.9521
1. PBF	Q6F157	Elongation factor P	0.00e+00	1.44e-73	7.45e-109	0.9833
1. PBF	Q8CP34	Elongation factor P	0.00e+00	2.29e-45	8.30e-50	0.957
1. PBF	A5IAG1	Elongation factor P	0.00e+00	2.01e-43	4.53e-30	0.9503
1. PBF	A8G8T0	Elongation factor P	0.00e+00	1.29e-44	1.66e-28	0.9506
1. PBF	C5A1D9	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9319
1. PBF	Q66FD2	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.9428
1. PBF	A6VX18	Elongation factor P-like protein	0.00e+00	1.75e-44	2.82e-16	0.6826
1. PBF	Q5PL77	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.932
1. PBF	B0TEH1	Elongation factor P	1.19e-13	9.96e-49	5.80e-48	0.7453
1. PBF	Q822X6	Elongation factor P 1	0.00e+00	3.07e-46	5.79e-14	0.7565
1. PBF	P56004	Elongation factor P	0.00e+00	9.48e-49	3.59e-26	0.9122
1. PBF	Q9AA85	Elongation factor P	0.00e+00	7.78e-48	2.38e-27	0.914
1. PBF	A1T8F9	Elongation factor P	0.00e+00	1.49e-49	2.43e-38	0.9292
1. PBF	B5FE04	Elongation factor P-like protein	0.00e+00	1.86e-46	1.92e-17	0.6734
1. PBF	B8FLV5	Elongation factor P	0.00e+00	8.41e-46	3.65e-37	0.8564
1. PBF	Q8RAE2	Elongation factor P	0.00e+00	3.81e-49	4.43e-44	0.8094
1. PBF	B5RL39	Elongation factor P	0.00e+00	1.42e-45	2.01e-32	0.7135
1. PBF	B1W455	Elongation factor P	0.00e+00	2.32e-49	1.95e-38	0.9105
1. PBF	Q1LKN7	Elongation factor P	0.00e+00	3.64e-46	2.74e-24	0.8286
1. PBF	B1ITQ1	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.929
1. PBF	Q5GTF2	Elongation factor P	0.00e+00	5.64e-45	8.29e-33	0.8208
1. PBF	Q030U0	Elongation factor P	0.00e+00	3.65e-48	6.41e-32	0.7908
1. PBF	Q3ANM0	Elongation factor P	0.00e+00	1.38e-49	1.39e-37	0.8518
1. PBF	B1IY98	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7547
1. PBF	B8HV20	Elongation factor P	0.00e+00	6.66e-52	1.66e-35	0.9514
1. PBF	B1J4V1	Elongation factor P	5.20e-14	3.28e-43	3.58e-20	0.7122
1. PBF	B7VGT7	Elongation factor P-like protein	6.55e-15	7.81e-50	1.26e-14	0.6702
1. PBF	Q04M43	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.7559
1. PBF	B7IXI8	Elongation factor P	0.00e+00	4.23e-48	5.77e-47	0.8184
1. PBF	Q5X888	Elongation factor P	0.00e+00	2.01e-43	4.53e-30	0.9483
1. PBF	A0M298	Elongation factor P	0.00e+00	1.93e-53	1.03e-30	0.6896
1. PBF	Q0TPC2	Elongation factor P	0.00e+00	7.98e-48	1.19e-38	0.8809
1. PBF	A4J019	Elongation factor P	0.00e+00	1.09e-44	2.69e-23	0.9065
1. PBF	B3R0E7	Elongation factor P	0.00e+00	4.23e-48	5.34e-38	0.9376
1. PBF	C3PGM2	Elongation factor P	0.00e+00	7.89e-44	1.81e-31	0.9071
1. PBF	Q3Z035	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7522
1. PBF	A3N042	Elongation factor P	0.00e+00	1.11e-40	9.69e-29	0.9387
1. PBF	Q7NAX4	Elongation factor P	0.00e+00	7.98e-49	4.09e-49	0.9656
1. PBF	B0TW77	Elongation factor P	0.00e+00	2.40e-42	1.49e-25	0.9241
1. PBF	Q116D6	Elongation factor P	0.00e+00	3.72e-52	2.83e-39	0.9386
1. PBF	A1R701	Elongation factor P	0.00e+00	7.61e-47	1.58e-38	0.9146
1. PBF	Q741J3	Elongation factor P	0.00e+00	1.09e-50	9.22e-38	0.9037
1. PBF	Q634Y7	Elongation factor P	0.00e+00	1.47e-50	8.49e-48	0.8845
1. PBF	O84124	Elongation factor P 1	0.00e+00	6.01e-46	1.71e-15	0.9167
1. PBF	Q0T9P4	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9295
1. PBF	B7MSG8	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9303
1. PBF	A7HUY3	Elongation factor P	0.00e+00	2.04e-50	4.82e-31	0.8624
1. PBF	B6INP2	Elongation factor P	0.00e+00	4.01e-54	5.82e-34	0.7085
1. PBF	A8GW85	Elongation factor P	0.00e+00	3.63e-52	2.41e-30	0.7679
1. PBF	A1AVI4	Elongation factor P	0.00e+00	8.17e-48	1.56e-27	0.903
1. PBF	B2SE64	Elongation factor P	0.00e+00	1.09e-44	2.69e-23	0.912
1. PBF	Q7W7W9	Elongation factor P	0.00e+00	1.07e-44	8.86e-21	0.7611
1. PBF	C4LIU5	Elongation factor P	0.00e+00	6.82e-45	3.83e-33	0.9061
1. PBF	A5I321	Elongation factor P	0.00e+00	1.17e-44	1.58e-42	0.8823
1. PBF	P0DA87	Elongation factor P	1.45e-14	2.90e-49	1.03e-39	0.7282
1. PBF	Q6LM11	Elongation factor P	0.00e+00	7.75e-42	7.38e-25	0.9451
1. PBF	Q4A5X8	Elongation factor P	0.00e+00	5.27e-48	7.39e-58	0.9219
1. PBF	A2BZC9	Elongation factor P	0.00e+00	2.21e-49	6.38e-38	0.8672
1. PBF	A8H482	Elongation factor P	0.00e+00	2.97e-45	2.44e-15	0.8141
1. PBF	A4X611	Elongation factor P	0.00e+00	1.10e-48	3.91e-33	0.9242
1. PBF	P64042	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.7701
1. PBF	Q92ST6	Elongation factor P	0.00e+00	1.71e-44	9.94e-30	0.8982
1. PBF	P0A6N9	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7565
1. PBF	A6VTQ2	Elongation factor P	0.00e+00	8.23e-35	9.08e-24	0.9448
1. PBF	Q0T2V0	Elongation factor P-like protein	0.00e+00	1.30e-40	2.45e-22	0.7427
1. PBF	B2FMF6	Elongation factor P	0.00e+00	8.77e-35	1.77e-22	0.913
1. PBF	Q5PB21	Elongation factor P	0.00e+00	2.62e-53	4.06e-36	0.6256
1. PBF	B1I3C0	Elongation factor P	0.00e+00	1.72e-45	3.44e-50	0.8578
1. PBF	A2C5M7	Elongation factor P	0.00e+00	2.81e-52	7.20e-36	0.8372
1. PBF	Q1ID35	Elongation factor P	2.91e-14	5.05e-44	1.56e-19	0.7152
1. PBF	B5E1P5	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.8856
1. PBF	Q7NY96	Elongation factor P	0.00e+00	3.72e-49	5.34e-21	0.8825
1. PBF	B2I707	Elongation factor P	0.00e+00	6.57e-36	9.51e-24	0.9188
1. PBF	C1B4I4	Elongation factor P	0.00e+00	1.13e-51	3.98e-39	0.9116
1. PBF	Q63SA2	Elongation factor P	0.00e+00	3.63e-52	6.11e-21	0.7933
1. PBF	Q1RHW1	Elongation factor P	5.55e-16	3.63e-52	2.41e-30	0.7192
1. PBF	A7GEK9	Elongation factor P	0.00e+00	1.17e-44	1.58e-42	0.8775
1. PBF	Q4K8S7	Elongation factor P	0.00e+00	1.89e-41	2.13e-20	0.661
1. PBF	B7GZ38	Elongation factor P	0.00e+00	1.75e-43	2.84e-31	0.9367
1. PBF	A4W5P1	Elongation factor P	0.00e+00	1.67e-44	9.67e-28	0.9321
1. PBF	A5UGE0	Elongation factor P	0.00e+00	2.42e-38	2.07e-23	0.9199
1. PBF	A5GPX5	Elongation factor P	0.00e+00	6.66e-52	4.33e-36	0.8787
1. PBF	A7GSL5	Elongation factor P	0.00e+00	3.08e-48	3.79e-50	0.8963
1. PBF	Q5N1T5	Elongation factor P	0.00e+00	5.44e-52	1.15e-38	0.9493
1. PBF	B1YVN1	Elongation factor P	0.00e+00	4.21e-49	9.90e-22	0.8164
1. PBF	A6TBQ0	Elongation factor P-like protein	0.00e+00	5.30e-44	1.58e-21	0.7948
1. PBF	A9BEN2	Elongation factor P	0.00e+00	1.21e-48	2.39e-41	0.8869
1. PBF	Q57MC8	Elongation factor P-like protein	0.00e+00	2.23e-45	4.94e-22	0.7826
1. PBF	C0Q6A6	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9318
1. PBF	B3QQR8	Elongation factor P	0.00e+00	6.35e-45	2.80e-31	0.8762
1. PBF	B7UFI8	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7513
1. PBF	C1CCJ8	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.8619
1. PBF	Q7MWN4	Elongation factor P 1	0.00e+00	4.21e-49	4.14e-32	0.9102
1. PBF	P64035	Elongation factor P	0.00e+00	9.30e-50	7.26e-38	0.9148
1. PBF	B3ES99	Elongation factor P	0.00e+00	6.50e-45	2.60e-25	0.8044
1. PBF	P64046	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7339
1. PBF	B9E6R3	Elongation factor P	0.00e+00	3.06e-53	4.42e-48	0.8595
1. PBF	C1DD68	Elongation factor P	0.00e+00	2.07e-52	1.54e-18	0.672
1. PBF	Q2G6X5	Elongation factor P	0.00e+00	8.07e-51	5.77e-36	0.7976
1. PBF	Q2W7T6	Elongation factor P	0.00e+00	2.97e-45	1.60e-32	0.6052
1. PBF	A9HX42	Elongation factor P	0.00e+00	1.32e-45	4.41e-20	0.654
1. PBF	Q71ZW7	Elongation factor P	0.00e+00	1.59e-50	7.21e-50	0.7742
1. PBF	Q0HVC9	Elongation factor P	0.00e+00	1.69e-49	3.70e-15	0.8003
1. PBF	B8DFX3	Elongation factor P	0.00e+00	1.59e-50	7.21e-50	0.8603
1. PBF	A7HJ78	Elongation factor P	0.00e+00	1.25e-49	6.15e-41	0.6799
1. PBF	A8GGU5	Elongation factor P-like protein	0.00e+00	7.46e-46	5.45e-19	0.6712
1. PBF	Q5GYR2	Elongation factor P-like protein	0.00e+00	2.89e-50	4.09e-17	0.8545
1. PBF	Q8EEP9	Elongation factor P	1.05e-14	4.75e-50	1.11e-14	0.7491
1. PBF	C6DEK5	Elongation factor P-like protein	0.00e+00	5.46e-43	9.76e-19	0.7013
1. PBF	C5BG23	Elongation factor P-like protein	0.00e+00	4.24e-45	6.13e-19	0.7389
1. PBF	B8E240	Elongation factor P	0.00e+00	2.08e-53	1.86e-40	0.7899
1. PBF	B4RL51	Elongation factor P	0.00e+00	1.81e-46	9.44e-19	0.8591
1. PBF	Q11DG9	Elongation factor P	0.00e+00	2.16e-49	2.08e-31	0.8624
1. PBF	A2BNF2	Elongation factor P	0.00e+00	8.59e-47	2.25e-37	0.9281
1. PBF	A8LE05	Elongation factor P	0.00e+00	1.94e-45	6.43e-36	0.9257
1. PBF	C0ZBY1	Elongation factor P	0.00e+00	1.45e-55	1.95e-50	0.8454
1. PBF	Q169H6	Elongation factor P	0.00e+00	4.45e-45	3.19e-35	0.8085
1. PBF	A3M7E3	Elongation factor P	0.00e+00	1.75e-43	2.84e-31	0.9383
1. PBF	B7LJR2	Elongation factor P-like protein	0.00e+00	1.02e-41	6.32e-23	0.7905
1. PBF	A1KLN1	Elongation factor P	0.00e+00	9.30e-50	7.26e-38	0.9129
1. PBF	B1X869	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7805
1. PBF	C0R4Z2	Elongation factor P	0.00e+00	5.70e-47	9.15e-31	0.7863
1. PBF	Q8G818	Elongation factor P	0.00e+00	3.36e-52	5.56e-33	0.8205
1. PBF	Q5KX91	Elongation factor P	0.00e+00	8.01e-50	3.25e-53	0.8037
1. PBF	B0C899	Elongation factor P	0.00e+00	7.81e-50	6.49e-41	0.944
1. PBF	Q2YT00	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9453
1. PBF	A8FKX4	Elongation factor P	0.00e+00	4.67e-45	1.88e-33	0.9376
1. PBF	B7MXI6	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7379
1. PBF	B4SHS5	Elongation factor P-like protein	0.00e+00	3.48e-48	1.17e-17	0.8355
1. PBF	B3DQ29	Elongation factor P	0.00e+00	3.36e-52	5.56e-33	0.8778
1. PBF	A5UYR6	Elongation factor P	0.00e+00	5.34e-46	2.36e-34	0.7302
1. PBF	Q4FN36	Elongation factor P	3.93e-13	1.59e-48	9.26e-24	0.7504
1. PBF	Q082R1	Elongation factor P	0.00e+00	3.56e-48	2.41e-20	0.8323
1. PBF	Q2RI92	Elongation factor P	0.00e+00	8.43e-45	1.40e-52	0.8273
1. PBF	A9NGL1	Elongation factor P	0.00e+00	2.07e-52	3.71e-46	0.8709
1. PBF	P64040	Elongation factor P	3.33e-16	4.66e-48	3.71e-37	0.7207
1. PBF	A1AJ55	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9302
1. PBF	C1FPC4	Elongation factor P	0.00e+00	1.17e-44	1.58e-42	0.885
1. PBF	B7GHE5	Elongation factor P	0.00e+00	1.10e-48	2.84e-52	0.8837
1. PBF	A0AIF6	Elongation factor P	0.00e+00	8.92e-51	3.96e-50	0.761
1. PBF	Q88LS0	Elongation factor P	0.00e+00	1.32e-44	1.42e-20	0.665
1. PBF	B1JMQ7	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.9432
1. PBF	Q3YUJ2	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9349
1. PBF	Q6AF92	Elongation factor P	0.00e+00	6.78e-46	2.83e-34	0.9305
1. PBF	B2SZU7	Elongation factor P	0.00e+00	7.06e-49	1.91e-23	0.8145
1. PBF	B7LLS9	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9329
1. PBF	Q46Z24	Elongation factor P	0.00e+00	1.96e-47	2.23e-24	0.8239
1. PBF	B5XP41	Elongation factor P-like protein	0.00e+00	3.72e-44	4.26e-22	0.762
1. PBF	Q44247	Elongation factor P	0.00e+00	2.00e-54	3.04e-38	0.9368
1. PBF	C0QQC2	Elongation factor P	0.00e+00	6.66e-45	3.99e-34	0.7793
1. PBF	A1QZ08	Elongation factor P	0.00e+00	2.22e-47	1.04e-32	0.7008
1. PBF	Q1JA37	Elongation factor P	4.33e-14	2.90e-49	1.03e-39	0.7089
1. PBF	Q21LT5	Elongation factor P	0.00e+00	1.74e-42	1.16e-29	0.9399
1. PBF	Q4FR30	Elongation factor P	0.00e+00	1.75e-35	1.84e-32	0.9363
1. PBF	Q0AGI0	Elongation factor P	0.00e+00	2.72e-48	2.12e-20	0.8057
1. PBF	P70889	Elongation factor P	0.00e+00	3.27e-47	1.08e-30	0.894
1. PBF	Q8FYZ5	Elongation factor P	0.00e+00	5.65e-49	7.69e-33	0.8685
1. PBF	C0QBX7	Elongation factor P	0.00e+00	1.31e-36	2.63e-34	0.9335
1. PBF	Q9PQJ3	Elongation factor P	0.00e+00	2.86e-48	7.86e-56	0.8889
1. PBF	Q1Q9C6	Elongation factor P	0.00e+00	1.20e-33	3.84e-32	0.9275
1. PBF	A9B1H0	Elongation factor P	0.00e+00	6.77e-51	8.03e-37	0.9478
1. PBF	Q9K951	Elongation factor P	0.00e+00	3.31e-48	2.43e-48	0.921
1. PBF	Q8KG11	Elongation factor P	0.00e+00	3.20e-41	1.50e-31	0.7605
1. PBF	Q0K8N9	Elongation factor P	0.00e+00	6.09e-49	1.41e-24	0.6565
1. PBF	B7HNW0	Elongation factor P	0.00e+00	1.10e-51	3.92e-48	0.8752
1. PBF	Q5NQQ2	Elongation factor P	0.00e+00	7.41e-48	2.11e-35	0.8571
1. PBF	C3LKM5	Elongation factor P	0.00e+00	1.47e-50	8.49e-48	0.8877
1. PBF	B0BWQ9	Elongation factor P	2.22e-16	2.04e-50	6.11e-32	0.7199
1. PBF	A7FUV2	Elongation factor P	0.00e+00	1.17e-44	1.58e-42	0.8766
1. PBF	Q9Z900	Elongation factor P 1	0.00e+00	1.49e-44	4.67e-15	0.7327
1. PBF	P64043	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.8557
1. PBF	A6LF43	Elongation factor P	0.00e+00	5.68e-51	1.09e-29	0.925
1. PBF	Q7V9B9	Elongation factor P	0.00e+00	6.02e-52	2.47e-35	0.8188
1. PBF	A4YTY9	Elongation factor P	0.00e+00	6.78e-46	3.36e-27	0.916
1. PBF	Q7VQQ0	Elongation factor P	0.00e+00	6.30e-42	1.01e-18	0.9245
1. PBF	A8AMQ1	Elongation factor P	0.00e+00	1.47e-41	1.55e-28	0.9302
1. PBF	A9KMD6	Elongation factor P	0.00e+00	1.07e-46	1.91e-36	0.6612
1. PBF	Q8ZIY0	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.9431
1. PBF	Q0I4U4	Elongation factor P	0.00e+00	1.77e-36	3.20e-24	0.9153
1. PBF	Q31DF8	Elongation factor P	0.00e+00	5.98e-47	1.30e-36	0.9307
1. PBF	Q1R9P8	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7454
1. PBF	B1HS10	Elongation factor P	0.00e+00	2.48e-51	5.61e-50	0.8293
1. PBF	Q8P8G9	Elongation factor P	0.00e+00	5.92e-34	8.53e-21	0.9125
1. PBF	B8D2E5	Elongation factor P	0.00e+00	3.77e-43	8.13e-44	0.899
1. PBF	B7J1E4	Elongation factor P	0.00e+00	6.83e-52	1.17e-30	0.8655
1. PBF	B2TRQ5	Elongation factor P	0.00e+00	1.12e-42	1.10e-35	0.9418
1. PBF	B1I9M6	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.8639
1. PBF	B8F3G9	Elongation factor P	0.00e+00	3.44e-40	1.35e-29	0.935
1. PBF	A6SX19	Elongation factor P	0.00e+00	4.15e-34	3.79e-15	0.7511
1. PBF	A7Z6L3	Elongation factor P	0.00e+00	6.55e-54	6.32e-50	0.7767
1. PBF	Q5QVT8	Elongation factor P	0.00e+00	5.76e-37	2.34e-27	0.9423
1. PBF	B8ZUK6	Elongation factor P	0.00e+00	3.91e-49	5.96e-36	0.8899
1. PBF	B2SV69	Elongation factor P-like protein	0.00e+00	2.89e-50	4.09e-17	0.853
1. PBF	Q821R5	Elongation factor P 2	0.00e+00	2.56e-44	1.32e-32	0.9204
1. PBF	B3PMC6	Elongation factor P	2.22e-16	6.59e-56	1.57e-61	0.6947
1. PBF	A4TRQ7	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.941
1. PBF	Q5LI35	Elongation factor P	0.00e+00	3.27e-47	1.08e-30	0.9049
1. PBF	B4SG07	Elongation factor P	0.00e+00	4.34e-45	2.08e-30	0.8142
1. PBF	Q3AAZ2	Elongation factor P	0.00e+00	3.90e-44	1.90e-42	0.9092
1. PBF	Q3MAQ3	Elongation factor P	0.00e+00	3.10e-54	1.83e-38	0.9363
1. PBF	A0KX52	Elongation factor P	0.00e+00	1.69e-49	3.70e-15	0.7873
1. PBF	B7MKV2	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9288
1. PBF	A7FK85	Elongation factor P-like protein	6.93e-14	4.47e-42	7.73e-22	0.7316
1. PBF	Q5YTL1	Elongation factor P	0.00e+00	4.52e-50	7.71e-39	0.9287
1. PBF	Q72JL2	Elongation factor P	0.00e+00	2.01e-47	1.21e-43	0.9158
1. PBF	Q4A7U4	Elongation factor P	3.55e-15	2.14e-57	7.95e-62	0.7389
1. PBF	Q3YSG0	Elongation factor P	0.00e+00	3.52e-50	4.11e-29	0.7534
1. PBF	A5GHP3	Elongation factor P	0.00e+00	7.62e-50	2.45e-36	0.8615
1. PBF	Q485Q8	Elongation factor P-like protein	0.00e+00	9.69e-48	7.48e-16	0.6724
1. PBF	B1WNP3	Elongation factor P	0.00e+00	1.43e-54	1.97e-39	0.9217
1. PBF	B2S7E6	Elongation factor P	0.00e+00	3.38e-46	2.42e-32	0.8554
1. PBF	A8A7P4	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9307
1. PBF	Q5WF43	Elongation factor P	0.00e+00	1.67e-50	1.39e-49	0.9343
1. PBF	A8FVS5	Elongation factor P	0.00e+00	3.08e-48	2.10e-15	0.8435
1. PBF	A5W770	Elongation factor P	2.15e-14	1.32e-44	1.42e-20	0.7191
1. PBF	A0PPH6	Elongation factor P	0.00e+00	6.90e-50	2.58e-37	0.9017
1. PBF	A5D339	Elongation factor P	0.00e+00	3.47e-46	3.88e-45	0.782
1. PBF	Q1C0Y3	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.9432
1. PBF	Q9PKR6	Elongation factor P 1	0.00e+00	1.63e-48	5.50e-16	0.8149
1. PBF	A3PA73	Elongation factor P	0.00e+00	2.90e-45	4.01e-36	0.9352
1. PBF	B5YWW4	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7579
1. PBF	A8F0Z8	Elongation factor P	6.66e-15	1.06e-50	1.00e-31	0.6673
1. PBF	Q9HZZ2	Elongation factor P	0.00e+00	9.75e-43	1.13e-18	0.7871
1. PBF	A8FU94	Elongation factor P-like protein	2.78e-15	6.73e-43	3.59e-20	0.6769
1. PBF	B1LAR0	Elongation factor P	0.00e+00	7.30e-53	8.20e-46	0.76
1. PBF	P0C099	Elongation factor P	0.00e+00	5.77e-41	1.32e-24	0.9317
1. PBF	P0A3B6	Elongation factor P	0.00e+00	2.57e-40	9.52e-29	0.9189
1. PBF	B3CLX0	Elongation factor P	0.00e+00	1.53e-45	1.47e-32	0.8476
1. PBF	C4K0V3	Elongation factor P	2.35e-13	8.27e-51	1.15e-32	0.731
1. PBF	B6J307	Elongation factor P	0.00e+00	2.14e-40	1.13e-34	0.949
1. PBF	C0ZZC0	Elongation factor P	0.00e+00	1.57e-53	1.87e-40	0.9058
1. PBF	B0REX1	Elongation factor P	0.00e+00	5.53e-48	6.80e-35	0.9185
1. PBF	B4TAN5	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7392
1. PBF	A4FBF7	Elongation factor P	0.00e+00	5.05e-47	8.46e-39	0.8798
1. PBF	B7NG85	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9316
1. PBF	Q7VLM1	Elongation factor P	0.00e+00	3.37e-40	7.09e-29	0.9386
1. PBF	Q8PJZ7	Elongation factor P	0.00e+00	4.37e-36	1.17e-20	0.9088
1. PBF	C1AF02	Elongation factor P	0.00e+00	9.30e-50	7.26e-38	0.9102
1. PBF	B1KEH1	Elongation factor P	0.00e+00	4.31e-49	1.34e-17	0.8467
1. PBF	Q6YQU7	Elongation factor P	0.00e+00	1.18e-46	1.85e-39	0.9398
1. PBF	B1KT65	Elongation factor P	0.00e+00	1.17e-44	1.58e-42	0.8835
1. PBF	B5R995	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9285
1. PBF	Q5ZYS4	Elongation factor P	0.00e+00	8.27e-44	2.40e-30	0.9482
1. PBF	A7MZ47	Elongation factor P	0.00e+00	1.53e-40	3.77e-23	0.9457
1. PBF	B8J031	Elongation factor P	0.00e+00	1.45e-55	1.27e-36	0.9157
1. PBF	A7NJE1	Elongation factor P	0.00e+00	1.71e-44	1.68e-31	0.8751
1. PBF	A5FZ78	Elongation factor P	6.66e-15	4.00e-46	1.16e-30	0.6825
1. PBF	B1MCE5	Elongation factor P	0.00e+00	8.95e-53	1.98e-34	0.9264
1. PBF	A0L673	Elongation factor P	0.00e+00	8.80e-52	4.66e-34	0.9391
1. PBF	Q8EQ28	Elongation factor P	0.00e+00	2.29e-48	2.36e-51	0.9233
1. PBF	Q76G20	Elongation factor P	0.00e+00	2.01e-47	1.21e-43	0.9205
1. PBF	P99066	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9389
1. PBF	Q0AZH4	Elongation factor P	0.00e+00	6.94e-46	3.97e-45	0.9237
1. PBF	A7N9M0	Elongation factor P	0.00e+00	1.09e-44	2.69e-23	0.9119
1. PBF	B8IS61	Elongation factor P	0.00e+00	8.49e-42	7.09e-30	0.8333
1. PBF	Q3K918	Elongation factor P	0.00e+00	3.80e-42	3.05e-19	0.6565
1. PBF	Q6D025	Elongation factor P	0.00e+00	5.90e-41	7.30e-25	0.9499
1. PBF	B0JHV3	Elongation factor P	0.00e+00	1.93e-55	8.07e-42	0.9459
1. PBF	Q1H0G4	Elongation factor P	0.00e+00	2.93e-48	2.96e-21	0.8267
1. PBF	B8FQ76	Elongation factor P	0.00e+00	1.02e-47	5.83e-43	0.9396
1. PBF	Q128Q4	Elongation factor P	0.00e+00	3.63e-42	4.35e-22	0.812
1. PBF	B7J6R6	Elongation factor P	0.00e+00	1.74e-52	5.21e-38	0.8721
1. PBF	Q03IW4	Elongation factor P	0.00e+00	2.96e-50	1.57e-33	0.7872
1. PBF	E6MVW0	Elongation factor P	0.00e+00	3.07e-46	8.77e-19	0.867
1. PBF	B8E520	Elongation factor P	0.00e+00	1.23e-50	1.58e-13	0.816
1. PBF	A4SVW9	Elongation factor P	0.00e+00	8.84e-45	1.94e-23	0.7057
1. PBF	P68775	Elongation factor P	1.40e-14	2.90e-49	1.03e-39	0.7437
1. PBF	B5FRK6	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9325
1. PBF	Q1J530	Elongation factor P	0.00e+00	1.71e-50	6.53e-39	0.8843
1. PBF	Q72BH0	Elongation factor P	0.00e+00	1.07e-53	1.45e-35	0.9253
1. PBF	B7LAJ5	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7451
1. PBF	Q5P4G4	Elongation factor P	0.00e+00	7.07e-50	3.67e-21	0.8562
1. PBF	A1BD27	Elongation factor P	0.00e+00	1.26e-44	1.71e-29	0.7701
1. PBF	Q6MKB4	Elongation factor P	0.00e+00	1.07e-41	2.28e-31	0.856
1. PBF	Q0TFR8	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7501
1. PBF	B5XI32	Elongation factor P	0.00e+00	1.67e-48	7.07e-40	0.8862
1. PBF	A1RJW6	Elongation factor P	0.00e+00	7.67e-51	1.67e-13	0.7764
1. PBF	Q87C43	Elongation factor P-like protein	0.00e+00	7.32e-45	1.73e-12	0.8778
1. PBF	B9KKM5	Elongation factor P	0.00e+00	4.10e-51	1.47e-25	0.9134
1. PBF	Q1MAF5	Elongation factor P	0.00e+00	7.35e-44	1.30e-28	0.6629
1. PBF	B5ZBA7	Elongation factor P	0.00e+00	4.78e-48	4.13e-55	0.8802
1. PBF	B4U161	Elongation factor P	0.00e+00	2.68e-50	2.02e-35	0.7718
1. PBF	B4RHN9	Elongation factor P	0.00e+00	3.13e-49	1.59e-29	0.8836
1. PBF	B7KGU8	Elongation factor P	0.00e+00	9.15e-54	2.18e-39	0.9045
1. PBF	A6QH73	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9268
1. PBF	Q894F6	Elongation factor P	6.66e-16	1.69e-46	7.23e-36	0.6868
1. PBF	A5WCQ0	Elongation factor P	0.00e+00	1.47e-41	1.94e-32	0.9381
1. PBF	A8F7D2	Elongation factor P	0.00e+00	1.12e-47	2.92e-32	0.6804
1. PBF	A0JX80	Elongation factor P	0.00e+00	7.49e-45	4.94e-37	0.9114
1. PBF	Q8KA80	Elongation factor P	0.00e+00	1.65e-41	1.66e-22	0.9238
1. PBF	B7NTK6	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9275
1. PBF	Q1MSA2	Elongation factor P	0.00e+00	4.05e-53	1.58e-32	0.9181
1. PBF	C1DRK5	Elongation factor P	0.00e+00	1.39e-44	3.80e-17	0.773
1. PBF	Q83MW6	Elongation factor P	0.00e+00	3.55e-46	3.00e-31	0.9164
1. PBF	C6BUE7	Elongation factor P	0.00e+00	3.27e-51	7.79e-38	0.9184
1. PBF	A0QWR4	Elongation factor P	0.00e+00	6.40e-50	3.11e-36	0.9195
1. PBF	A4SJY6	Elongation factor P	0.00e+00	6.89e-48	1.59e-16	0.8782
1. PBF	O51834	Elongation factor P (Fragment)	0.00e+00	8.68e-41	9.82e-26	0.9265
1. PBF	B0UWM5	Elongation factor P	0.00e+00	1.77e-36	3.20e-24	0.9175
1. PBF	Q6MD56	Elongation factor P 1	0.00e+00	3.01e-44	2.29e-15	0.8358
1. PBF	A6TR25	Elongation factor P	0.00e+00	2.44e-49	1.67e-39	0.6803
1. PBF	B0K9C8	Elongation factor P	0.00e+00	3.04e-45	1.22e-42	0.879
1. PBF	B6JHH8	Elongation factor P	0.00e+00	2.97e-45	4.76e-26	0.6944
1. PBF	Q6KMS8	Elongation factor P	0.00e+00	1.47e-50	8.49e-48	0.9117
1. PBF	Q1LSP7	Elongation factor P	0.00e+00	2.26e-43	3.33e-23	0.94
1. PBF	Q83NK8	Elongation factor P	0.00e+00	3.55e-46	3.00e-31	0.9188
1. PBF	C1A9H6	Elongation factor P	0.00e+00	2.50e-47	9.88e-28	0.8506
1. PBF	A0RQC0	Elongation factor P	0.00e+00	9.03e-46	1.43e-33	0.9449
1. PBF	Q1AW08	Elongation factor P	0.00e+00	8.37e-52	2.14e-37	0.906
1. PBF	B8GQC3	Elongation factor P	0.00e+00	4.90e-42	1.09e-31	0.9526
1. PBF	Q1QL03	Elongation factor P	0.00e+00	3.20e-43	3.24e-25	0.8777
1. PBF	P64041	Elongation factor P	3.22e-15	4.66e-48	3.71e-37	0.7539
1. PBF	B0SU50	Elongation factor P	0.00e+00	4.73e-46	4.28e-25	0.6506
1. PBF	B2I5W7	Elongation factor P-like protein	0.00e+00	7.32e-45	1.73e-12	0.8899
1. PBF	A9BVZ6	Elongation factor P	0.00e+00	2.33e-44	4.57e-23	0.8242
1. PBF	A9WWI6	Elongation factor P	0.00e+00	5.65e-49	7.69e-33	0.8876
1. PBF	B0TUS6	Elongation factor P	0.00e+00	2.97e-45	2.44e-15	0.7893
1. PBF	A9KEY9	Elongation factor P	0.00e+00	2.14e-40	1.13e-34	0.9484
1. PBF	B5YDZ9	Elongation factor P	0.00e+00	9.15e-54	2.17e-42	0.802
1. PBF	Q9CHN6	Elongation factor P	2.22e-16	2.09e-46	9.77e-32	0.728
1. PBF	Q9ZMQ5	Elongation factor P	0.00e+00	2.02e-44	2.26e-26	0.9117
1. PBF	Q68XD1	Elongation factor P	1.28e-14	4.76e-51	1.33e-31	0.6489
1. PBF	C3KXD8	Elongation factor P	0.00e+00	1.17e-44	1.58e-42	0.876
1. PBF	B7JM48	Elongation factor P	0.00e+00	1.47e-50	8.49e-48	0.859
1. PBF	A4J3D4	Elongation factor P	0.00e+00	6.13e-43	6.71e-42	0.9072
1. PBF	A4XJ18	Elongation factor P	0.00e+00	4.10e-55	7.00e-41	0.7999
1. PBF	B3EER6	Elongation factor P	0.00e+00	2.14e-46	8.88e-30	0.775
1. PBF	A8G213	Elongation factor P	0.00e+00	7.11e-46	1.17e-36	0.9396
1. PBF	A2RMC2	Elongation factor P	0.00e+00	3.65e-48	6.41e-32	0.7619
1. PBF	Q2K302	Elongation factor P	0.00e+00	7.24e-42	7.11e-28	0.9225
1. PBF	B4TF84	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9286
1. PBF	B7VHR3	Elongation factor P	0.00e+00	7.58e-41	2.11e-26	0.9466
1. PBF	Q2SBA6	Elongation factor P	0.00e+00	6.04e-40	1.08e-27	0.9498
1. PBF	C1F3T7	Elongation factor P	0.00e+00	4.01e-54	3.87e-39	0.8201
1. PBF	O51232	Elongation factor P	0.00e+00	6.83e-52	1.17e-30	0.8159
1. PBF	B7HB68	Elongation factor P	0.00e+00	8.37e-48	4.03e-47	0.7783
1. PBF	B4S4A1	Elongation factor P	0.00e+00	1.67e-40	5.96e-26	0.927
1. PBF	Q8D2R7	Elongation factor P	0.00e+00	6.43e-34	1.29e-14	0.9028
1. PBF	C4L3G0	Elongation factor P	0.00e+00	1.84e-48	3.80e-46	0.7256
1. PBF	Q3IEF7	Elongation factor P-like protein	0.00e+00	2.52e-45	3.24e-17	0.8935
1. PBF	A8MFK4	Elongation factor P	0.00e+00	3.93e-48	1.81e-36	0.9032
1. PBF	A0K5W6	Elongation factor P	0.00e+00	3.30e-53	1.73e-20	0.8224
1. PBF	B9MLY0	Elongation factor P	0.00e+00	1.11e-55	2.21e-40	0.6673
1. PBF	Q04WK0	Elongation factor P	0.00e+00	2.60e-41	1.72e-25	0.9314
1. PBF	Q8PLF1	Elongation factor P-like protein	0.00e+00	4.79e-52	1.30e-18	0.8375
1. PBF	Q6FAA9	Elongation factor P	0.00e+00	1.56e-45	3.30e-27	0.9371
1. PBF	Q7UA67	Elongation factor P	0.00e+00	5.02e-48	2.22e-37	0.8646
1. PBF	Q87KX9	Elongation factor P	0.00e+00	1.30e-40	5.69e-24	0.9464
1. PBF	A3NXK9	Elongation factor P	0.00e+00	3.63e-52	6.11e-21	0.7957
1. PBF	B1VAJ8	Elongation factor P	0.00e+00	1.69e-49	2.23e-41	0.9191
1. PBF	P64037	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9322
1. PBF	Q838Z5	Elongation factor P	6.44e-14	3.27e-47	9.23e-36	0.7041
1. PBF	Q9KSP7	Elongation factor P-like protein	0.00e+00	1.27e-48	1.17e-17	0.6788
1. PBF	Q3BUD7	Elongation factor P-like protein	0.00e+00	1.57e-52	6.32e-19	0.8571
1. PBF	B3PRW7	Elongation factor P	0.00e+00	1.02e-40	5.65e-27	0.9179
1. PBF	Q2GKG2	Elongation factor P	0.00e+00	6.09e-50	1.28e-36	0.7758
1. PBF	B9MC94	Elongation factor P	0.00e+00	3.47e-44	1.16e-22	0.8334
1. PBF	B8DTW0	Elongation factor P	0.00e+00	1.50e-51	5.46e-32	0.8142
1. PBF	Q74FY7	Elongation factor P 1	0.00e+00	5.79e-49	2.65e-29	0.8236
1. PBF	Q2SQE7	Elongation factor P-like protein	0.00e+00	1.07e-43	2.13e-20	0.7755
1. PBF	Q4UVL7	Elongation factor P	0.00e+00	5.92e-34	8.53e-21	0.9025
1. PBF	Q9RY32	Elongation factor P	0.00e+00	7.60e-48	7.57e-38	0.9442
1. PBF	Q04NC1	Elongation factor P	0.00e+00	2.60e-41	1.72e-25	0.9314
1. PBF	Q0BNX7	Elongation factor P	0.00e+00	1.09e-44	2.69e-23	0.9073
1. PBF	Q5NI60	Elongation factor P	0.00e+00	1.09e-44	2.69e-23	0.9075
1. PBF	O83537	Elongation factor P	0.00e+00	4.78e-48	5.17e-29	0.8243
1. PBF	B0SUL4	Elongation factor P	0.00e+00	8.21e-46	8.22e-26	0.9031
1. PBF	B0RS24	Elongation factor P	0.00e+00	5.92e-34	8.53e-21	0.9103
1. PBF	A5VS65	Elongation factor P	0.00e+00	1.39e-46	2.19e-32	0.8498
1. PBF	A9B9I2	Elongation factor P	0.00e+00	1.10e-51	5.07e-39	0.8109
1. PBF	A8FF29	Elongation factor P	0.00e+00	9.39e-54	1.50e-50	0.9095
1. PBF	A6GY96	Elongation factor P	0.00e+00	1.46e-51	1.54e-31	0.898
1. PBF	Q12MQ1	Elongation factor P	0.00e+00	1.08e-49	9.76e-18	0.8189
1. PBF	Q7VJY4	Elongation factor P	0.00e+00	2.69e-37	5.25e-31	0.9557
1. PBF	Q6NH07	Elongation factor P	0.00e+00	2.33e-47	3.05e-29	0.9357
1. PBF	Q30S45	Elongation factor P	0.00e+00	2.20e-43	3.56e-24	0.8691
1. PBF	A4XU74	Elongation factor P	1.11e-15	6.18e-40	2.61e-23	0.7529
1. PBF	Q9X284	Elongation factor P	0.00e+00	7.72e-56	2.50e-46	0.7569
1. PBF	A0QI55	Elongation factor P	0.00e+00	1.09e-50	9.22e-38	0.9055
1. PBF	Q89M07	Elongation factor P	0.00e+00	2.77e-45	1.61e-25	0.9024
1. PBF	C0REX2	Elongation factor P	0.00e+00	3.38e-46	2.42e-32	0.8448
1. PBF	A1U4R4	Elongation factor P-like protein	0.00e+00	4.93e-47	4.09e-17	0.683
1. PBF	Q4JVG5	Elongation factor P	0.00e+00	1.50e-47	1.23e-30	0.9189
1. PBF	Q0ALG8	Elongation factor P	0.00e+00	5.30e-47	1.01e-29	0.8008
1. PBF	Q7UXN7	Elongation factor P	0.00e+00	7.90e-40	5.12e-27	0.9382
1. PBF	A3QE83	Elongation factor P	0.00e+00	2.44e-49	5.00e-16	0.6941
1. PBF	Q1JF80	Elongation factor P	0.00e+00	2.90e-49	1.03e-39	0.8907
1. PBF	B8ZLJ9	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.9035
1. PBF	Q827R5	Elongation factor P	0.00e+00	7.23e-49	5.93e-36	0.9001
1. PBF	A5U5N3	Elongation factor P	0.00e+00	9.30e-50	7.26e-38	0.9127
1. PBF	C1ERR9	Elongation factor P	0.00e+00	1.20e-50	7.53e-48	0.8747
1. PBF	Q32HX1	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7492
1. PBF	Q3SS37	Elongation factor P	0.00e+00	2.98e-41	1.07e-26	0.8833
1. PBF	Q730Z6	Elongation factor P	0.00e+00	1.10e-51	3.92e-48	0.866
1. PBF	B1LKS0	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.743
1. PBF	Q8DJD3	Elongation factor P	0.00e+00	3.57e-53	3.21e-41	0.8789
1. PBF	A5EX42	Elongation factor P	0.00e+00	1.90e-46	9.22e-35	0.9345
1. PBF	Q7M904	Elongation factor P	0.00e+00	8.30e-41	8.82e-31	0.949
1. PBF	Q662F0	Elongation factor P	0.00e+00	7.48e-51	1.58e-29	0.9306
1. PBF	A9H6E1	Elongation factor P	0.00e+00	2.20e-46	1.70e-31	0.6591
1. PBF	B5Y354	Elongation factor P	0.00e+00	5.09e-43	4.10e-29	0.9264
1. PBF	A1SUX2	Elongation factor P-like protein	0.00e+00	5.05e-47	4.81e-18	0.6847
1. PBF	B1M2B1	Elongation factor P	0.00e+00	4.51e-40	4.32e-28	0.8898
1. PBF	A5ILJ5	Elongation factor P	0.00e+00	7.30e-53	8.20e-46	0.7761
1. PBF	Q5E2B3	Elongation factor P	0.00e+00	5.27e-39	1.16e-25	0.9435
1. PBF	Q15SU8	Elongation factor P-like protein	0.00e+00	7.02e-44	1.10e-18	0.6646
1. PBF	A9L1B3	Elongation factor P	5.00e-15	1.23e-50	1.58e-13	0.7601
1. PBF	B1GZJ0	Elongation factor P	0.00e+00	5.14e-48	4.57e-39	0.9372
1. PBF	B5RC50	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7466
1. PBF	B9LAT1	Elongation factor P	0.00e+00	1.85e-45	1.53e-28	0.8321
1. PBF	B5Y8M4	Elongation factor P	0.00e+00	1.49e-49	6.87e-46	0.9352
1. PBF	B8H8V3	Elongation factor P	0.00e+00	7.15e-45	7.14e-37	0.9125
1. PBF	A1VDC3	Elongation factor P	0.00e+00	1.07e-53	1.45e-35	0.9321
1. PBF	Q5FUC7	Elongation factor P	4.44e-16	1.17e-44	1.40e-29	0.7397
1. PBF	Q24UX6	Elongation factor P	0.00e+00	1.58e-47	1.58e-42	0.9168
1. PBF	B2ILX6	Elongation factor P	0.00e+00	1.81e-46	1.13e-37	0.8247
1. PBF	A7ZV18	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9298
1. PBF	Q1CG58	Elongation factor P-like protein	6.56e-14	4.47e-42	7.73e-22	0.7334
1. PBF	B2JFL0	Elongation factor P	0.00e+00	1.36e-46	1.14e-23	0.8041
1. PBF	Q6D3L2	Elongation factor P-like protein	0.00e+00	1.49e-44	4.06e-19	0.6592
1. PBF	Q812U1	Elongation factor P	0.00e+00	8.37e-48	4.03e-47	0.7926
1. PBF	Q17YT0	Elongation factor P	0.00e+00	2.16e-49	6.04e-27	0.9137
1. PBF	A1TMP7	Elongation factor P	0.00e+00	3.55e-46	1.61e-24	0.8039
1. PBF	Q0HIK6	Elongation factor P	2.45e-14	1.69e-49	3.70e-15	0.735
1. PBF	P0A6N6	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9299
1. PBF	B2K1Y7	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.9434
1. PBF	A1K1J9	Elongation factor P	0.00e+00	2.74e-52	1.11e-21	0.8175
1. PBF	B5ZU68	Elongation factor P	0.00e+00	2.12e-44	1.00e-27	0.9188
1. PBF	A5VLU9	Elongation factor P	0.00e+00	7.25e-50	2.10e-37	0.8491
1. PBF	Q5M2R5	Elongation factor P	3.00e-15	3.37e-49	2.56e-34	0.69
1. PBF	Q2P2C1	Elongation factor P	0.00e+00	1.95e-35	3.11e-21	0.92
1. PBF	B2TVS0	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7454
1. PBF	B0K0T5	Elongation factor P	0.00e+00	3.04e-45	1.22e-42	0.8848
1. PBF	B4EXC9	Elongation factor P	0.00e+00	1.85e-39	4.81e-25	0.925
1. PBF	A5VAL5	Elongation factor P	0.00e+00	2.13e-51	2.65e-35	0.8221
1. PBF	Q5XA92	Elongation factor P	1.58e-14	2.90e-49	1.03e-39	0.7285
1. PBF	A9VGY0	Elongation factor P	0.00e+00	2.32e-49	3.73e-49	0.8752
1. PBF	Q74CC2	Elongation factor P 2	0.00e+00	9.01e-47	3.44e-34	0.8671
1. PBF	Q2S413	Elongation factor P	0.00e+00	2.48e-43	8.25e-32	0.9017
1. PBF	A5F4X8	Elongation factor P	0.00e+00	1.20e-38	7.54e-25	0.9451
1. PBF	B1LQG8	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9323
1. PBF	Q8D8C2	Elongation factor P-like protein	0.00e+00	2.00e-49	3.25e-18	0.8401
1. PBF	B7IH59	Elongation factor P	0.00e+00	5.97e-51	3.89e-44	0.7549
1. PBF	Q2JUZ8	Elongation factor P	0.00e+00	5.14e-48	1.72e-39	0.937
1. PBF	B3H1A1	Elongation factor P	0.00e+00	1.11e-40	9.69e-29	0.9383
1. PBF	Q5F856	Elongation factor P	0.00e+00	3.07e-46	8.77e-19	0.878
1. PBF	Q6MAZ6	Elongation factor P 2	0.00e+00	8.49e-41	6.55e-28	0.8794
1. PBF	O84757	Elongation factor P 2	0.00e+00	6.10e-48	2.05e-30	0.9218
1. PBF	B7M8R0	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9331
1. PBF	Q6LQV7	Elongation factor P-like protein	0.00e+00	6.04e-41	2.32e-15	0.693
1. PBF	Q46I36	Elongation factor P	0.00e+00	1.37e-48	3.33e-38	0.8551
1. PBF	Q2SXS7	Elongation factor P	0.00e+00	3.19e-50	2.27e-22	0.8196
1. PBF	Q54760	Elongation factor P	0.00e+00	5.44e-52	1.15e-38	0.9481
1. PBF	A4TBX4	Elongation factor P	0.00e+00	5.70e-47	2.68e-36	0.9236
1. PBF	A8Z468	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.936
1. PBF	A5IT57	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9385
1. PBF	Q5LY60	Elongation factor P	3.51e-12	2.96e-50	1.57e-33	0.7091
1. PBF	Q7N360	Elongation factor P-like protein	0.00e+00	8.24e-45	2.15e-19	0.7435
1. PBF	Q7WLA9	Elongation factor P	0.00e+00	1.07e-44	8.86e-21	0.6564
1. PBF	Q4UU61	Elongation factor P-like protein	0.00e+00	4.52e-50	1.19e-20	0.871
1. PBF	B1ZHM8	Elongation factor P	0.00e+00	6.30e-42	1.69e-29	0.6735
1. PBF	A0LUG7	Elongation factor P	0.00e+00	9.03e-46	4.58e-39	0.9207
1. PBF	A6Q7Q7	Elongation factor P	0.00e+00	4.10e-46	1.38e-29	0.9416
1. PBF	Q5WZP1	Elongation factor P	0.00e+00	2.02e-44	2.82e-30	0.9535
1. PBF	Q0VLQ4	Elongation factor P	0.00e+00	4.29e-38	7.74e-28	0.9457
1. PBF	Q609B5	Elongation factor P	0.00e+00	3.23e-38	2.02e-33	0.9445
1. PBF	B6I8M3	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7482
1. PBF	A6LLA5	Elongation factor P	0.00e+00	1.07e-48	7.31e-44	0.6799
1. PBF	B2KCP2	Elongation factor P	0.00e+00	7.64e-46	6.90e-33	0.8437
1. PBF	C1CZB4	Elongation factor P	0.00e+00	1.35e-44	3.88e-39	0.9601
1. PBF	C6DFP1	Elongation factor P	0.00e+00	6.46e-40	8.10e-27	0.9524
1. PBF	Q8FT34	Elongation factor P	0.00e+00	1.04e-43	4.61e-34	0.9465
1. PBF	Q88WN1	Elongation factor P	0.00e+00	6.90e-54	5.23e-47	0.9676
1. PBF	Q5FIJ4	Elongation factor P 1	0.00e+00	1.04e-45	3.56e-34	0.9241
1. PBF	Q2GG58	Elongation factor P	0.00e+00	1.06e-50	1.03e-29	0.7487
1. PBF	A7FMZ8	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.9431
1. PBF	C3LS89	Elongation factor P	0.00e+00	1.20e-38	7.54e-25	0.9446
1. PBF	Q487P4	Elongation factor P	0.00e+00	1.69e-41	2.97e-26	0.9467
1. PBF	B6J9B6	Elongation factor P	0.00e+00	1.71e-40	9.36e-34	0.949
1. PBF	Q2NW91	Elongation factor P	0.00e+00	2.31e-39	2.18e-25	0.9515
1. PBF	B4TSD0	Elongation factor P	0.00e+00	1.65e-41	6.65e-29	0.9306
1. PBF	Q18BA9	Elongation factor P	0.00e+00	1.53e-46	7.08e-36	0.9032
1. PBF	A1W9U1	Elongation factor P	0.00e+00	3.47e-44	1.16e-22	0.8033
1. PBF	A9QYP8	Elongation factor P	0.00e+00	7.32e-45	8.39e-31	0.943
1. PBF	Q0VRR6	Elongation factor P-like protein	0.00e+00	1.02e-46	6.71e-17	0.6727
1. PBF	C3K6L0	Elongation factor P	0.00e+00	9.97e-42	1.73e-18	0.6573
1. PBF	Q98F60	Elongation factor P 1	0.00e+00	1.65e-51	4.05e-30	0.8758
1. PBF	A2BTX3	Elongation factor P	0.00e+00	5.51e-45	5.39e-38	0.9352
1. PBF	B2J711	Elongation factor P	0.00e+00	3.48e-53	2.34e-41	0.9372
1. PBF	C4Z157	Elongation factor P	0.00e+00	3.61e-50	3.90e-41	0.9193
1. PBF	A0KN67	Elongation factor P	0.00e+00	6.50e-45	6.03e-15	0.8812
1. PBF	Q8DSE7	Elongation factor P	5.55e-16	3.36e-52	1.44e-38	0.7101
1. PBF	A2RCS2	Elongation factor P	0.00e+00	2.90e-49	1.03e-39	0.8655
1. PBF	A0RII7	Elongation factor P	0.00e+00	1.47e-50	8.49e-48	0.8719
1. PBF	B4TPB4	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7387
1. PBF	Q7MV32	Elongation factor P 2	0.00e+00	1.45e-49	4.19e-32	0.9183
1. PBF	C4LDX4	Elongation factor P	0.00e+00	1.20e-46	2.84e-18	0.8671
1. PBF	B2VIG6	Elongation factor P-like protein	3.85e-14	4.06e-47	8.87e-19	0.719
1. PBF	Q8Y0H5	Elongation factor P	0.00e+00	1.49e-52	6.20e-24	0.8578
1. PBF	Q73FP5	Elongation factor P	0.00e+00	2.06e-47	1.87e-29	0.7888
1. PBF	Q55119	Elongation factor P	0.00e+00	2.46e-54	3.05e-43	0.9554
1. PBF	B0U399	Elongation factor P-like protein	0.00e+00	1.42e-44	8.64e-13	0.8724
1. PBF	B1XDQ0	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	0.9322
1. PBF	Q9ZDT7	Elongation factor P	3.00e-15	4.20e-50	1.01e-31	0.6496
1. PBF	Q6GGH0	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	0.9362
1. PBF	P0A6P0	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7425
1. PBF	B1JS27	Elongation factor P-like protein	5.97e-14	4.47e-42	7.73e-22	0.7329
1. PBF	B5Z9V0	Elongation factor P	0.00e+00	9.48e-49	3.59e-26	0.9103
1. PBF	Q9PBE1	Elongation factor P-like protein	0.00e+00	2.17e-44	1.20e-12	0.8697
1. PBF	B1Y0U3	Elongation factor P	0.00e+00	9.50e-41	4.93e-21	0.7493
1. PBF	P9WNM2	Elongation factor P	0.00e+00	9.30e-50	7.26e-38	0.9097
1. PBF	Q5E5C9	Elongation factor P-like protein	0.00e+00	1.81e-46	1.14e-17	0.6741
1. PBF	P64047	Elongation factor P-like protein	0.00e+00	1.09e-44	1.22e-22	0.7379
1. PBF	Q1CUY2	Elongation factor P	0.00e+00	1.61e-46	3.36e-26	0.9054
1. PBF	Q67N94	Elongation factor P	0.00e+00	6.76e-53	4.41e-46	0.7795
1. PBF	B2US06	Elongation factor P	0.00e+00	9.48e-49	3.59e-26	0.9022
1. PBF	B9IXJ1	Elongation factor P	0.00e+00	1.10e-51	3.92e-48	0.906
1. PBF	A9M7K7	Elongation factor P	0.00e+00	5.65e-49	7.69e-33	0.8576
1. PBF	Q9KXQ9	Elongation factor P	0.00e+00	3.61e-50	1.93e-36	0.8896
1. PBF	B0UJ99	Elongation factor P	0.00e+00	1.09e-46	1.37e-31	0.9144
1. PBF	P0DUK0	Elongation factor P	0.00e+00	8.41e-46	5.16e-19	0.8641
1. PBF	Q7VEI7	Elongation factor P	0.00e+00	5.54e-51	1.21e-36	0.824
1. PBF	Q8ZGK7	Elongation factor P-like protein	5.58e-14	4.47e-42	7.73e-22	0.7361
1. PBF	Q0AAU9	Elongation factor P	0.00e+00	2.27e-41	1.81e-37	0.9437
1. PBF	Q4QNL2	Elongation factor P	0.00e+00	9.66e-38	2.21e-23	0.9219
1. PBF	B9DVJ6	Elongation factor P	0.00e+00	1.89e-45	2.02e-35	0.7762
1. PBF	A9ADD1	Elongation factor P	0.00e+00	1.93e-53	2.53e-22	0.8224
1. PBF	B5YJ32	Elongation factor P	0.00e+00	6.77e-51	1.86e-34	0.8042
1. PBF	A4IQT4	Elongation factor P	0.00e+00	9.14e-51	3.55e-53	0.7485
1. PBF	B9KD70	Elongation factor P	0.00e+00	1.72e-45	2.85e-32	0.9202
1. PBF	P64032	Elongation factor P	0.00e+00	1.59e-50	7.21e-50	0.7578
1. PBF	A1AD29	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	0.7448
1. PBF	A7MLL9	Elongation factor P-like protein	0.00e+00	2.88e-44	2.40e-22	0.7367
1. PBF	Q31YX9	Elongation factor P-like protein	0.00e+00	1.30e-40	2.45e-22	0.7533
1. PBF	Q97HB8	Elongation factor P	0.00e+00	5.64e-45	1.37e-40	0.8063
1. PBF	B3QW61	Elongation factor P	0.00e+00	5.81e-48	8.51e-30	0.8944
1. PBF	B6JPS3	Elongation factor P	0.00e+00	1.61e-46	3.36e-26	0.9104
1. PBF	A4Y6L5	Elongation factor P	0.00e+00	7.67e-51	1.67e-13	0.8158
1. PBF	A9NAR1	Elongation factor P	0.00e+00	2.14e-40	1.13e-34	0.9488
3. BF	A4YHK9	Translation initiation factor 5A	8.88e-12	NA	8.34e-05	0.8238
3. BF	Q9YA53	Translation initiation factor 5A	2.12e-10	NA	0.005	0.7579
3. BF	A3DNK3	Translation initiation factor 5A	1.17e-11	NA	0.001	0.7659
3. BF	A1RS27	Translation initiation factor 5A	3.25e-12	NA	6.49e-04	0.808
3. BF	A4WLN5	Translation initiation factor 5A	5.61e-12	NA	6.05e-04	0.7822
3. BF	B1L7A5	Translation initiation factor 5A	4.32e-13	NA	2.62e-07	0.8519
3. BF	P56635	Translation initiation factor 5A	1.61e-11	NA	0.006	0.792
3. BF	Q97ZE8	Translation initiation factor 5A	9.90e-12	NA	0.003	0.7603
3. BF	C3MPN5	Translation initiation factor 5A	1.17e-11	NA	0.047	0.7624
3. BF	A4FXY5	Translation initiation factor 5A	1.19e-10	NA	0.001	0.791
3. BF	Q9HJB1	Translation initiation factor 5A	3.07e-13	NA	0.009	0.7873
3. BF	Q6LYN8	Translation initiation factor 5A	1.09e-10	NA	3.48e-04	0.7782
3. BF	B1Y9U5	Translation initiation factor 5A	5.16e-12	NA	0.002	0.8061
3. BF	C3NDW5	Translation initiation factor 5A	1.09e-11	NA	0.004	0.7615
3. BF	Q8TXD5	Translation initiation factor 5A	3.76e-11	NA	0.003	0.715
3. BF	Q6L150	Translation initiation factor 5A	6.21e-14	NA	0.025	0.8096
3. BF	P28461	Translation initiation factor 5A	4.23e-12	NA	2.88e-04	0.7687
3. BF	A2BNB6	Translation initiation factor 5A	2.64e-11	NA	0.017	0.8237
3. BF	C3NHT8	Translation initiation factor 5A	1.13e-11	NA	0.004	0.7628
3. BF	A9AAZ2	Translation initiation factor 5A	3.48e-11	NA	2.88e-04	0.8109
3. BF	Q97BB9	Translation initiation factor 5A	1.46e-13	NA	0.007	0.7912
3. BF	A6VFP3	Translation initiation factor 5A	5.44e-11	NA	0.001	0.8025
3. BF	C4KGX7	Translation initiation factor 5A	1.08e-11	NA	0.004	0.7618
3. BF	A3MTA0	Translation initiation factor 5A	2.70e-12	NA	2.90e-04	0.8094
3. BF	C3MYM9	Translation initiation factor 5A	1.12e-11	NA	0.004	0.7628
3. BF	Q971T0	Translation initiation factor 5A	1.20e-11	NA	0.002	0.7791
3. BF	A8ABK3	Translation initiation factor 5A	7.48e-12	NA	2.20e-04	0.824
3. BF	A6UNS4	Translation initiation factor 5A	5.03e-11	NA	4.13e-04	0.7996
3. BF	C3N5B1	Translation initiation factor 5A	1.03e-11	NA	0.004	0.7696
4. PB	Q2FY41	Elongation factor P	0.00e+00	6.27e-47	2.10e-49	NA
4. PB	P0A6N4	Elongation factor P	0.00e+00	1.17e-42	8.70e-29	NA
4. PB	P9WNM3	Elongation factor P	0.00e+00	9.30e-50	7.26e-38	NA
4. PB	P0A6N8	Elongation factor P-like protein	0.00e+00	2.79e-41	6.88e-23	NA
6. F	Q5JI42	Translation initiation factor 5A	1.26e-11	NA	NA	0.7721
6. F	A4GVE9	Eukaryotic translation initiation factor 5A	1.73e-09	NA	NA	0.6585
6. F	Q07460	Eukaryotic translation initiation factor 5A-2	1.26e-09	NA	NA	0.7222
6. F	A8MD73	Translation initiation factor 5A	1.40e-12	NA	NA	0.7655
6. F	B8GEC0	Translation initiation factor 5A	3.49e-12	NA	NA	0.7901
6. F	P62924	Eukaryotic translation initiation factor 5A	3.23e-10	NA	NA	0.686
6. F	Q6EWQ7	Eukaryotic translation initiation factor 5A-1	1.68e-09	NA	NA	0.6939
6. F	Q0W941	Translation initiation factor 5A	8.53e-13	NA	NA	0.756
6. F	Q9AXJ4	Eukaryotic translation initiation factor 5A	3.68e-09	NA	NA	0.675
6. F	O29612	Translation initiation factor 5A	1.85e-13	NA	NA	0.7907
6. F	Q74N24	Translation initiation factor 5A	1.07e-10	NA	NA	0.6454
6. F	B0R6B4	Translation initiation factor 5A	3.47e-13	NA	NA	0.8139
6. F	P24922	Eukaryotic translation initiation factor 5A-2	1.33e-09	NA	NA	0.7319
6. F	P38672	Eukaryotic translation initiation factor 5A	5.00e-11	NA	NA	0.6964
6. F	Q8TJ03	Translation initiation factor 5A	6.93e-13	NA	NA	0.8219
6. F	Q945F4	Eukaryotic translation initiation factor 5A-2	1.47e-09	NA	NA	0.7222
6. F	Q9AXQ3	Eukaryotic translation initiation factor 5A-4	8.50e-10	NA	NA	0.6812
6. F	A7I807	Translation initiation factor 5A	3.42e-12	NA	NA	0.7615
6. F	O26955	Translation initiation factor 5A	6.95e-12	NA	NA	0.7745
6. F	Q387H6	Eukaryotic translation initiation factor 5A	4.87e-10	NA	NA	0.6643
6. F	C6A117	Translation initiation factor 5A	9.65e-12	NA	NA	0.78
6. F	P69039	Eukaryotic translation initiation factor 5A-1	1.27e-09	NA	NA	0.7058
6. F	Q9AXQ4	Eukaryotic translation initiation factor 5A-3	9.17e-10	NA	NA	0.7174
6. F	A1RX88	Translation initiation factor 5A	4.95e-12	NA	NA	0.7846
6. F	P26564	Eukaryotic translation initiation factor 5A-1	2.19e-09	NA	NA	0.7195
6. F	B8D4W8	Translation initiation factor 5A	3.68e-13	NA	NA	0.8063
6. F	O50089	Translation initiation factor 5A	1.04e-11	NA	NA	0.7764
6. F	P62925	Eukaryotic translation initiation factor 5A	2.86e-10	NA	NA	0.6808
6. F	A5ULK4	Translation initiation factor 5A	9.18e-13	NA	NA	0.7952
6. F	P56335	Eukaryotic translation initiation factor 5A-3	1.17e-09	NA	NA	0.7323
6. F	Q9SC12	Eukaryotic translation initiation factor 5A	1.17e-09	NA	NA	0.6761
6. F	C5A5M5	Translation initiation factor 5A	7.65e-12	NA	NA	0.7835
6. F	A6UVH4	Translation initiation factor 5A	4.80e-11	NA	NA	0.8036
6. F	P56333	Eukaryotic translation initiation factor 5A-1/2	2.94e-09	NA	NA	0.6883
6. F	Q2FQ93	Translation initiation factor 5A	5.68e-13	NA	NA	0.7887
6. F	P56337	Eukaryotic translation initiation factor 5A-5	1.08e-10	NA	NA	0.6862
6. F	Q2NEM4	Translation initiation factor 5A	2.64e-12	NA	NA	0.8017
6. F	B6YTM4	Translation initiation factor 5A	4.35e-12	NA	NA	0.7387
6. F	A3CU49	Translation initiation factor 5A	5.75e-13	NA	NA	0.7449
6. F	Q5R898	Eukaryotic translation initiation factor 5A-2	1.44e-09	NA	NA	0.7243
6. F	Q9AXQ7	Eukaryotic translation initiation factor 5A	1.86e-10	NA	NA	0.6998
6. F	Q3IN38	Translation initiation factor 5A	1.98e-13	NA	NA	0.8327
6. F	Q8U1E4	Translation initiation factor 5A	1.22e-11	NA	NA	0.7762
6. F	P56336	Eukaryotic translation initiation factor 5A-4	7.38e-10	NA	NA	0.73
6. F	P69040	Eukaryotic translation initiation factor 5A-1	1.11e-09	NA	NA	0.7071
6. F	Q18F19	Translation initiation factor 5A	2.35e-12	NA	NA	0.8094
6. F	E9AXF0	Eukaryotic translation initiation factor 5A	1.55e-09	NA	NA	0.6571
6. F	Q9AXQ6	Eukaryotic translation initiation factor 5A-1	7.88e-10	NA	NA	0.7089
6. F	Q9HP78	Translation initiation factor 5A	3.50e-13	NA	NA	0.8143
6. F	Q09121	Eukaryotic translation initiation factor 5A-1	2.08e-10	NA	NA	0.7717
6. F	B9LP76	Translation initiation factor 5A	2.23e-12	NA	NA	0.778
6. F	Q9AXQ5	Eukaryotic translation initiation factor 5A-2	8.19e-10	NA	NA	0.7332
6. F	Q5V103	Translation initiation factor 5A	5.08e-13	NA	NA	0.8218
6. F	P10160	Eukaryotic translation initiation factor 5A-1	1.72e-09	NA	NA	0.698
6. F	Q46EL9	Translation initiation factor 5A	8.54e-14	NA	NA	0.8052
6. F	A0B9S8	Translation initiation factor 5A	5.86e-13	NA	NA	0.7893
6. F	Q9V0M2	Translation initiation factor 5A	1.22e-11	NA	NA	0.7813
6. F	Q12UU7	Translation initiation factor 5A	2.29e-12	NA	NA	0.803
6. F	Q8PYE0	Translation initiation factor 5A	2.89e-13	NA	NA	0.8081
7. B	Q6NYN7	Solute carrier family 22 member 6	9.96e-01	NA	0.018	NA