Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54761.1
JCVISYN3A_0394
Endopeptidase La.
M. mycoides homolog: Q6MTF4.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.
Statistics
Total GO Annotation: 161
Unique PROST Go: 24
Unique BLAST Go: 64
Unique Foldseek Go: 17
Total Homologs: 581
Unique PROST Homologs: 124
Unique BLAST Homologs: 240
Unique Foldseek Homologs: 12
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q2IIK1
(Lon protease) with a FATCAT P-Value: 0 and RMSD of 3.29 angstrom. The sequence alignment identity is 38.6%.
Structural alignment shown in left. Query protein AVX54761.1 colored as red in alignment, homolog Q2IIK1 colored as blue.
Query protein AVX54761.1 is also shown in right top, homolog Q2IIK1 showed in right bottom. They are colored based on secondary structures.
AVX54761.1 -------------------------------------MKTIKLPVV-VTRGIF----ILPSTSKTIEFGRVKS----KNALNASADLYNNQIV-VVSQES 53 Q2IIK1 MRERKETAMSDKEKKGAGAGAQVAPAMGPPVLINKEDIPAV-LPILPLRNSVFFPGGVLP-----LAVGRQKTIALIKDAVR---D---EQVIGVVTQRR 88 AVX54761.1 PLEEEPNLEHLFYLGTVADLSVKKVWKDGTISVELNYN---Q---KIKIDEFVEEDNIIYA-IGSVFEDKLPKTDAQKTKIKEALE-ELQEKHSFNTSEL 145 Q2IIK1 AEEEDPGAADLYTVGTVA--RVVKLLKMG----EDNYSLVVQGLARFKVLELVQESPYLKARIEAV-EDR-SVVD--DVEV-EALAINLK-KLAREVIEL 176 AVX54761.1 L--LAFNENDFNKLNSLIY--QIIDKMPLVSLNTKLLLIQSTSILEKLDL---LK---ELIINRPKSTVKLNNNLNNNSTVDSEINKKLKDKMDKQQKEY 235 Q2IIK1 MPELPAAATEL--VESITHPGHLAD---LIAANVDVPIEEKQQVLETVELKARMKLVLEL-LNRKREILKLSNK------IDSA----VKGEMSKTQREY 260 AVX54761.1 YLREKMRIIKEELDDENSDASQLDKYKKRLEEEPFP---ESVKEKILSSIKRIETMQPGSAEVNVERNYVDWMMSIPWWEQSEDIDDLKYAQEILEKHHF 332 Q2IIK1 YLRQQLKAIKEELGELGEEEEELDELQERLKKAGLPPEVEKVAQKELNRLKSIPT---ASSEYTVARTYLDWIADLPWTKRTDDNLDIENARQILDTDHY 357 AVX54761.1 GLKKVKERIIEYLAVKQKTK-SLKGPIITFVGPPGVGKTSLARSIAEALGKKFVKVSLGGVKDESEIRGHRKTYVGSMPGRIIQALKRAKVKNPLFLLDE 431 Q2IIK1 GLDKIKKRILEYLAVR-KLKNDMRGPILCFVGPPGVGKTSLGQSIARATGRKFVRLSLGGVRDEAEIRGHRRTYVGALPGRIIQSMKKAATVNPVMMLDE 456 AVX54761.1 IDKMASDNRGDPASAMLEVLDPEQNKEFSDHYIEEPYDLSTVMFIATANYIENIPEALYDRMEIINLSSYT-EIEKMHIAKDYLTKKILEEDQLTEDELR 530 Q2IIK1 IDKLGADFRGDPSAALLEVLDPEQNHAFSDHYLDLSYDLSKVMFIGTANLLDPIPGPLKDRMEILELPGYTFE-EKVHIAQNHLIPKQLREHGLSADAIA 555 AVX54761.1 FTDEAYDEIIKYYTREAGVRQLERHLATIARKFIVKLLNGKITNLVVTREV----VVQYLG--KHIFEHTSKEEESQV-GVVTGLAYTQFGGDILPIEVS 623 Q2IIK1 ISEKALIKIIMAYTREAGVRNLERRIADVCRAIAVEVASGKI-GASAKRSIEEADVLEILGPEK-FYNETA--ERTEIAGVATGLAWTAAGGDILFIEAT 651 AVX54761.1 TYNGKGNLTLTGKLGEVMKESATIALTYVKANHEKFGISKDKFDDIDIHIHVPEGAVPKDGPSAGITLTTALISALSKQPVSKDFGMTGEITLRGNVLPI 723 Q2IIK1 KMPGKGALTLTGQLGDVMKESAQAALSYLRSKSDSLGIPVNFLEKTDLHIHFPAGAIPKDGPSAGVTILTALVSLLTGIRVRSDVAMTGEVTLRGLVLPV 751 AVX54761.1 GGLREKSISAARSGLKHILIPSKNVKDIEDVPQEVQDVLKITPVSKYEDVYEIIFKNNNQQTI------------------------------------- 786 Q2IIK1 GGIKEKVLAAHRAGIKRIIIPARNEKDLLDVPEQARKELEFV-FAAHMD--EVL-----QAALEENPVGRKPPAAPEPEGEKKPGATPTPPAKKPDEIRV 843 AVX54761.1 786 Q2IIK1 843
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0034605 | cellular response to heat |
| 1. PBF | GO:0016558 | protein import into peroxisome matrix |
| 1. PBF | GO:0070407 | oxidation-dependent protein catabolic process |
| 1. PBF | GO:0003697 | single-stranded DNA binding |
| 1. PBF | GO:0004176 | ATP-dependent peptidase activity |
| 1. PBF | GO:0000502 | proteasome complex |
| 1. PBF | GO:0006625 | protein targeting to peroxisome |
| 1. PBF | GO:0000262 | mitochondrial chromosome |
| 1. PBF | GO:1901858 | regulation of mitochondrial DNA metabolic process |
| 1. PBF | GO:0016560 | protein import into peroxisome matrix, docking |
| 1. PBF | GO:0005759 | mitochondrial matrix |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0016485 | protein processing |
| 1. PBF | GO:0004252 | serine-type endopeptidase activity |
| 1. PBF | GO:0046872 | metal ion binding |
| 1. PBF | GO:0034599 | cellular response to oxidative stress |
| 1. PBF | GO:0006515 | protein quality control for misfolded or incompletely synthesized proteins |
| 1. PBF | GO:0035694 | mitochondrial protein catabolic process |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0031998 | regulation of fatty acid beta-oxidation |
| 1. PBF | GO:0043565 | sequence-specific DNA binding |
| 1. PBF | GO:0007005 | mitochondrion organization |
| 1. PBF | GO:0051131 | chaperone-mediated protein complex assembly |
| 1. PBF | GO:0005782 | peroxisomal matrix |
| 1. PBF | GO:0030163 | protein catabolic process |
| 2. PF | GO:0010498 | proteasomal protein catabolic process |
| 2. PF | GO:0019941 | modification-dependent protein catabolic process |
| 3. BF | GO:0008568 | microtubule-severing ATPase activity |
| 3. BF | GO:0005819 | spindle |
| 3. BF | GO:0051013 | microtubule severing |
| 3. BF | GO:0016853 | isomerase activity |
| 3. BF | GO:0034214 | protein hexamerization |
| 3. BF | GO:0031122 | cytoplasmic microtubule organization |
| 4. PB | GO:0002020 | protease binding |
| 4. PB | GO:0048527 | lateral root development |
| 4. PB | GO:0032042 | mitochondrial DNA metabolic process |
| 4. PB | GO:0004222 | metalloendopeptidase activity |
| 4. PB | GO:0010044 | response to aluminum ion |
| 4. PB | GO:0005777 | peroxisome |
| 4. PB | GO:0022623 | proteasome-activating nucleotidase complex |
| 4. PB | GO:0045899 | positive regulation of RNA polymerase II transcription preinitiation complex assembly |
| 4. PB | GO:0042645 | mitochondrial nucleoid |
| 4. PB | GO:0043335 | protein unfolding |
| 4. PB | GO:0036402 | proteasome-activating activity |
| 4. PB | GO:0003727 | single-stranded RNA binding |
| 4. PB | GO:0031597 | cytosolic proteasome complex |
| 4. PB | GO:0009725 | response to hormone |
| 4. PB | GO:0008540 | proteasome regulatory particle, base subcomplex |
| 4. PB | GO:0070182 | DNA polymerase binding |
| 4. PB | GO:0016887 | ATP hydrolysis activity |
| 4. PB | GO:0005576 | extracellular region |
| 4. PB | GO:0070013 | intracellular organelle lumen |
| 4. PB | GO:0001018 | mitochondrial promoter sequence-specific DNA binding |
| 4. PB | GO:0051880 | G-quadruplex DNA binding |
| 4. PB | GO:0034622 | |
| 4. PB | GO:0006508 | proteolysis |
| 5. P | GO:0003677 | DNA binding |
| 5. P | GO:0001556 | oocyte maturation |
| 5. P | GO:0048477 | oogenesis |
| 5. P | GO:0051082 | unfolded protein binding |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0007283 | spermatogenesis |
| 5. P | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 5. P | GO:0007286 | spermatid development |
| 5. P | GO:0007130 | synaptonemal complex assembly |
| 5. P | GO:0031595 | nuclear proteasome complex |
| 5. P | GO:0007131 | reciprocal meiotic recombination |
| 5. P | GO:0030682 | mitigation of host defenses by symbiont |
| 5. P | GO:0051598 | meiotic recombination checkpoint signaling |
| 5. P | GO:0046983 | protein dimerization activity |
| 5. P | GO:0014070 | response to organic cyclic compound |
| 5. P | GO:0007141 | male meiosis I |
| 5. P | GO:0006302 | double-strand break repair |
| 5. P | GO:0005694 | chromosome |
| 5. P | GO:0006457 | protein folding |
| 5. P | GO:0001673 | male germ cell nucleus |
| 5. P | GO:0007144 | female meiosis I |
| 5. P | GO:0140035 | ubiquitination-like modification-dependent protein binding |
| 5. P | GO:0017025 | TBP-class protein binding |
| 5. P | GO:0043273 | CTPase activity |
| 6. F | GO:1902607 | negative regulation of large conductance calcium-activated potassium channel activity |
| 6. F | GO:0031468 | nuclear membrane reassembly |
| 6. F | GO:0019896 | axonal transport of mitochondrion |
| 6. F | GO:0010458 | exit from mitosis |
| 6. F | GO:0048487 | beta-tubulin binding |
| 6. F | GO:0001578 | microtubule bundle formation |
| 6. F | GO:0021955 | central nervous system neuron axonogenesis |
| 6. F | GO:0032506 | cytokinetic process |
| 6. F | GO:0051228 | mitotic spindle disassembly |
| 6. F | GO:1904115 | axon cytoplasm |
| 6. F | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 6. F | GO:0005737 | cytoplasm |
| 6. F | GO:0043014 | alpha-tubulin binding |
| 6. F | GO:0008089 | anterograde axonal transport |
| 6. F | GO:0090148 | membrane fission |
| 6. F | GO:0031464 | Cul4A-RING E3 ubiquitin ligase complex |
| 6. F | GO:0031117 | positive regulation of microtubule depolymerization |
| 7. B | GO:0031969 | chloroplast membrane |
| 7. B | GO:1903741 | negative regulation of phosphatidate phosphatase activity |
| 7. B | GO:0009378 | four-way junction helicase activity |
| 7. B | GO:0009535 | chloroplast thylakoid membrane |
| 7. B | GO:0010304 | PSII associated light-harvesting complex II catabolic process |
| 7. B | GO:0140374 | antiviral innate immune response |
| 7. B | GO:0005778 | peroxisomal membrane |
| 7. B | GO:0010205 | photoinhibition |
| 7. B | GO:0010206 | photosystem II repair |
| 7. B | GO:0007504 | larval fat body development |
| 7. B | GO:0009408 | response to heat |
| 7. B | GO:0022624 | proteasome accessory complex |
| 7. B | GO:0009534 | chloroplast thylakoid |
| 7. B | GO:0098796 | membrane protein complex |
| 7. B | GO:0033687 | osteoblast proliferation |
| 7. B | GO:2001243 | negative regulation of intrinsic apoptotic signaling pathway |
| 7. B | GO:0031977 | thylakoid lumen |
| 7. B | GO:0048564 | photosystem I assembly |
| 7. B | GO:0008053 | mitochondrial fusion |
| 7. B | GO:0043572 | plastid fission |
| 7. B | GO:0031942 | i-AAA complex |
| 7. B | GO:0140603 | obsolete ATP hydrolysis activity |
| 7. B | GO:0008233 | peptidase activity |
| 7. B | GO:0140591 | nuclear envelope budding |
| 7. B | GO:0065003 | protein-containing complex assembly |
| 7. B | GO:0030433 | ubiquitin-dependent ERAD pathway |
| 7. B | GO:0005739 | mitochondrion |
| 7. B | GO:0097431 | mitotic spindle pole |
| 7. B | GO:0043934 | sporulation |
| 7. B | GO:0031935 | obsolete regulation of chromatin silencing |
| 7. B | GO:0039529 | RIG-I signaling pathway |
| 7. B | GO:0042407 | cristae formation |
| 7. B | GO:0016562 | protein import into peroxisome matrix, receptor recycling |
| 7. B | GO:0005663 | DNA replication factor C complex |
| 7. B | GO:0010569 | regulation of double-strand break repair via homologous recombination |
| 7. B | GO:0000922 | spindle pole |
| 7. B | GO:0005874 | microtubule |
| 7. B | GO:0045037 | protein import into chloroplast stroma |
| 7. B | GO:0034982 | mitochondrial protein processing |
| 7. B | GO:0008270 | zinc ion binding |
| 7. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 7. B | GO:0016234 | inclusion body |
| 7. B | GO:0008017 | microtubule binding |
| 7. B | GO:0043104 | positive regulation of GTP cyclohydrolase I activity |
| 7. B | GO:0062091 | Ycf2/FtsHi complex |
| 7. B | GO:0000287 | magnesium ion binding |
| 7. B | GO:0007031 | peroxisome organization |
| 7. B | GO:0003689 | DNA clamp loader activity |
| 7. B | GO:0009376 | HslUV protease complex |
| 7. B | GO:0009941 | chloroplast envelope |
| 7. B | GO:0005813 | centrosome |
| 7. B | GO:0006314 | intron homing |
| 7. B | GO:0000725 | recombinational repair |
| 7. B | GO:0042026 | protein refolding |
| 7. B | GO:0016464 | chloroplast protein-transporting ATPase activity |
| 7. B | GO:0031463 | Cul3-RING ubiquitin ligase complex |
| 7. B | GO:0030496 | midbody |
| 7. B | GO:0090261 | positive regulation of inclusion body assembly |
| 7. B | GO:0009579 | thylakoid |
| 7. B | GO:0071426 | obsolete ribonucleoprotein complex export from nucleus |
| 7. B | GO:0048085 | adult chitin-containing cuticle pigmentation |
| 7. B | GO:0099050 | vesicle scission |
| 7. B | GO:0015630 | microtubule cytoskeleton |
| 7. B | GO:0070682 | proteasome regulatory particle assembly |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0034605 | cellular response to heat |
| GO:0004176 | ATP-dependent peptidase activity |
| GO:0008233 | peptidase activity |
| GO:0006515 | protein quality control for misfolded or incompletely synthesized proteins |
| GO:0008236 | serine-type peptidase activity |
| GO:0016887 | ATP hydrolysis activity |
| GO:0006508 | proteolysis |
| GO:0005737 | cytoplasm |
| GO:0005524 | ATP binding |
| GO:0030163 | protein catabolic process |
| GO:0004252 | serine-type endopeptidase activity |
| GO:0043565 | sequence-specific DNA binding |
| GO:0016787 | hydrolase activity |
| GO:0000166 | nucleotide binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q2NEP8 | Lon protease | 0.00e+00 | 3.49e-72 | 5.48e-169 | 0.6673 |
| 1. PBF | A7ZEJ3 | Lon protease | 0.00e+00 | 5.84e-82 | 1.09e-155 | 0.6822 |
| 1. PBF | Q755E4 | Lon protease homolog 2, peroxisomal | 2.00e-15 | 3.23e-42 | 2.26e-106 | 0.6577 |
| 1. PBF | Q1RID6 | Lon protease | 0.00e+00 | 1.29e-79 | 0.0 | 0.6461 |
| 1. PBF | Q6BJJ8 | Lon protease homolog 2, peroxisomal | 7.02e-13 | 1.79e-06 | 3.68e-105 | 0.6174 |
| 1. PBF | A5EWF3 | Lon protease | 0.00e+00 | 1.98e-62 | 0.0 | 0.6653 |
| 1. PBF | Q72KS4 | Lon protease 1 | 0.00e+00 | 1.65e-76 | 0.0 | 0.6604 |
| 1. PBF | Q6MTF4 | Lon protease | 0.00e+00 | 1.32e-105 | 0.0 | 0.9027 |
| 1. PBF | A0RJ87 | Lon protease | 0.00e+00 | 9.75e-68 | 0.0 | 0.681 |
| 1. PBF | B5RL78 | Lon protease | 0.00e+00 | 5.61e-48 | 6.94e-155 | 0.6775 |
| 1. PBF | A4S6Y4 | Lon protease homolog, mitochondrial | 0.00e+00 | 3.67e-14 | 1.72e-163 | 0.6594 |
| 1. PBF | A4J7L6 | Lon protease | 0.00e+00 | 6.10e-57 | 0.0 | 0.7032 |
| 1. PBF | Q6CWS4 | Lon protease homolog 2, peroxisomal | 4.00e-15 | 1.33e-44 | 2.81e-116 | 0.639 |
| 1. PBF | P57549 | Lon protease | 0.00e+00 | 7.54e-74 | 0.0 | 0.6858 |
| 1. PBF | B8EMF2 | Lon protease | 0.00e+00 | 3.96e-72 | 0.0 | 0.7025 |
| 1. PBF | A9F8L0 | Lon protease 4 | 0.00e+00 | 3.10e-71 | 0.0 | 0.6998 |
| 1. PBF | Q89A99 | Lon protease | 0.00e+00 | 4.09e-72 | 0.0 | 0.6602 |
| 1. PBF | B8BDV1 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 1.43e-53 | 6.22e-166 | 0.6711 |
| 1. PBF | Q8EV77 | Lon protease | 0.00e+00 | 1.68e-79 | 0.0 | 0.6909 |
| 1. PBF | Q5BH58 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 1.84e-35 | 2.84e-146 | 0.6676 |
| 1. PBF | Q9RXG4 | Lon protease | 0.00e+00 | 1.43e-64 | 0.0 | 0.6795 |
| 1. PBF | B1GZQ6 | Lon protease | 0.00e+00 | 9.14e-74 | 0.0 | 0.684 |
| 1. PBF | Q4ULN0 | Lon protease | 0.00e+00 | 2.82e-77 | 0.0 | 0.6846 |
| 1. PBF | Q6FPE6 | Lon protease homolog, mitochondrial | 1.11e-16 | 2.30e-26 | 5.87e-97 | 0.6614 |
| 1. PBF | Q6MGP8 | Lon protease 2 | 0.00e+00 | 1.43e-68 | 0.0 | 0.6773 |
| 1. PBF | A8Y3E2 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 1.13e-57 | 7.18e-137 | 0.6758 |
| 1. PBF | Q39QP7 | Lon protease | 0.00e+00 | 2.59e-62 | 0.0 | 0.6862 |
| 1. PBF | A8XFM8 | Lon protease homolog, mitochondrial | 0.00e+00 | 7.86e-20 | 4.18e-148 | 0.6827 |
| 1. PBF | B8J198 | Lon protease | 0.00e+00 | 2.37e-54 | 0.0 | 0.7077 |
| 1. PBF | Q2NJE3 | Lon protease | 0.00e+00 | 3.64e-75 | 0.0 | 0.6634 |
| 1. PBF | P74956 | Lon protease | 0.00e+00 | 1.70e-71 | 0.0 | 0.6724 |
| 1. PBF | Q4WVD9 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 4.89e-39 | 6.62e-151 | 0.6816 |
| 1. PBF | Q1MS21 | Lon protease | 0.00e+00 | 1.47e-65 | 0.0 | 0.6746 |
| 1. PBF | Q9PK50 | Lon protease | 0.00e+00 | 9.75e-56 | 1.02e-171 | 0.6688 |
| 1. PBF | P37945 | Lon protease 1 | 0.00e+00 | 2.55e-78 | 0.0 | 0.6771 |
| 1. PBF | B3QSJ7 | Lon protease | 0.00e+00 | 3.31e-68 | 0.0 | 0.709 |
| 1. PBF | Q68WS8 | Lon protease | 0.00e+00 | 4.77e-77 | 0.0 | 0.6724 |
| 1. PBF | B2TFQ5 | Lon protease | 0.00e+00 | 1.91e-72 | 5.93e-175 | 0.7209 |
| 1. PBF | A9B5N1 | Lon protease 1 | 0.00e+00 | 3.73e-70 | 0.0 | 0.6773 |
| 1. PBF | Q59HJ6 | Lon protease homolog, mitochondrial | 0.00e+00 | 7.61e-14 | 7.62e-159 | 0.6876 |
| 1. PBF | A9GIS9 | Lon protease 3 | 0.00e+00 | 3.56e-52 | 0.0 | 0.7307 |
| 1. PBF | Q3JBB6 | Lon protease | 0.00e+00 | 5.94e-79 | 0.0 | 0.7252 |
| 1. PBF | B3ERM8 | Lon protease | 0.00e+00 | 3.69e-61 | 5.92e-176 | 0.6646 |
| 1. PBF | Q59185 | Lon protease 1 | 0.00e+00 | 1.45e-55 | 1.26e-158 | 0.6719 |
| 1. PBF | B2RII6 | Lon protease | 0.00e+00 | 3.42e-60 | 9.95e-175 | 0.6495 |
| 1. PBF | A6LSV5 | Lon protease | 0.00e+00 | 6.50e-76 | 0.0 | 0.6702 |
| 1. PBF | Q6ME13 | Lon protease | 0.00e+00 | 1.51e-57 | 2.75e-166 | 0.6698 |
| 1. PBF | B4RI01 | Lon protease | 0.00e+00 | 6.79e-79 | 2.52e-175 | 0.7182 |
| 1. PBF | Q2V573 | Lon protease homolog 2, peroxisomal | 2.22e-15 | 4.88e-43 | 6.22e-120 | 0.6152 |
| 1. PBF | Q72JM6 | Lon protease 2 | 0.00e+00 | 6.38e-72 | 0.0 | 0.706 |
| 1. PBF | P36774 | Lon protease 2 | 0.00e+00 | 9.19e-64 | 0.0 | 0.6443 |
| 1. PBF | Q31FD3 | Lon protease 2 | 0.00e+00 | 7.27e-43 | 2.25e-161 | 0.6711 |
| 1. PBF | A6LD45 | Lon protease | 0.00e+00 | 3.30e-54 | 2.08e-177 | 0.6631 |
| 1. PBF | P36772 | Lon protease | 0.00e+00 | 2.16e-78 | 0.0 | 0.6829 |
| 1. PBF | Q9ZJL3 | Lon protease | 0.00e+00 | 2.60e-66 | 5.69e-150 | 0.6749 |
| 1. PBF | Q5AZT7 | Lon protease homolog, mitochondrial | 1.11e-16 | 8.78e-04 | 6.48e-149 | 0.7001 |
| 1. PBF | Q6AK61 | Lon protease 2 | 0.00e+00 | 1.32e-71 | 0.0 | 0.6554 |
| 1. PBF | P0A9M1 | Lon protease | 0.00e+00 | 3.88e-69 | 0.0 | 0.6907 |
| 1. PBF | Q8YHC6 | Lon protease | 0.00e+00 | 5.10e-65 | 0.0 | 0.6505 |
| 1. PBF | A9KH99 | Lon protease | 0.00e+00 | 3.41e-71 | 0.0 | 0.6698 |
| 1. PBF | Q6KI22 | Lon protease | 0.00e+00 | 5.83e-71 | 0.0 | 0.6672 |
| 1. PBF | Q5R6M5 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 1.56e-54 | 8.46e-159 | 0.6709 |
| 1. PBF | Q8RHK0 | Lon protease | 0.00e+00 | 1.47e-75 | 0.0 | 0.6612 |
| 1. PBF | Q7S8C4 | Lon protease homolog, mitochondrial | 2.22e-16 | 2.52e-09 | 4.47e-100 | 0.7112 |
| 1. PBF | A8HYF7 | Lon protease | 0.00e+00 | 6.23e-48 | 0.0 | 0.6621 |
| 1. PBF | A8M1E8 | Lon protease | 0.00e+00 | 1.16e-71 | 1.04e-175 | 0.6428 |
| 1. PBF | Q31GE9 | Lon protease 1 | 0.00e+00 | 9.73e-48 | 0.0 | 0.6924 |
| 1. PBF | P43864 | Lon protease | 0.00e+00 | 3.97e-64 | 0.0 | 0.7038 |
| 1. PBF | A0L516 | Lon protease | 0.00e+00 | 7.82e-58 | 2.30e-173 | 0.726 |
| 1. PBF | Q0RPW3 | Lon protease | 0.00e+00 | 1.09e-60 | 5.58e-158 | 0.7272 |
| 1. PBF | Q5H432 | Lon protease | 0.00e+00 | 4.31e-56 | 0.0 | 0.6698 |
| 1. PBF | Q6AS16 | Lon protease 1 | 0.00e+00 | 7.81e-54 | 3.03e-148 | 0.6593 |
| 1. PBF | A8ZX50 | Lon protease | 0.00e+00 | 6.08e-61 | 0.0 | 0.6863 |
| 1. PBF | B8G736 | Lon protease | 0.00e+00 | 1.57e-68 | 0.0 | 0.6832 |
| 1. PBF | Q11QT1 | Lon protease | 0.00e+00 | 4.23e-70 | 0.0 | 0.677 |
| 1. PBF | Q72UP9 | Lon protease | 0.00e+00 | 3.07e-47 | 2.01e-157 | 0.6733 |
| 1. PBF | B7FSL4 | Lon protease homolog, mitochondrial | 0.00e+00 | 9.87e-34 | 2.20e-155 | 0.6797 |
| 1. PBF | O83536 | Lon protease | 0.00e+00 | 6.78e-42 | 3.65e-165 | 0.6469 |
| 1. PBF | A0LEE9 | Lon protease 1 | 0.00e+00 | 6.68e-66 | 0.0 | 0.7029 |
| 1. PBF | P0CAW0 | Lon protease | 0.00e+00 | 1.44e-63 | 0.0 | 0.6672 |
| 1. PBF | Q754Q9 | Lon protease homolog, mitochondrial | 0.00e+00 | 1.36e-10 | 1.68e-141 | 0.667 |
| 1. PBF | Q97FT9 | Lon protease | 0.00e+00 | 7.25e-79 | 0.0 | 0.7031 |
| 1. PBF | Q1IPZ8 | Lon protease | 0.00e+00 | 5.98e-72 | 0.0 | 0.6613 |
| 1. PBF | P36773 | Lon protease 1 | 0.00e+00 | 1.65e-60 | 0.0 | 0.6655 |
| 1. PBF | B8F9K1 | Lon protease | 0.00e+00 | 1.40e-61 | 0.0 | 0.7111 |
| 1. PBF | A9GBF1 | Lon protease 2 | 0.00e+00 | 9.61e-76 | 0.0 | 0.6766 |
| 1. PBF | Q180E4 | Lon protease | 0.00e+00 | 3.11e-77 | 0.0 | 0.7395 |
| 1. PBF | O51558 | Lon protease 2 | 0.00e+00 | 3.87e-73 | 1.23e-152 | 0.6463 |
| 1. PBF | A2RAF6 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 2.72e-37 | 6.49e-154 | 0.676 |
| 1. PBF | B5EDX8 | Lon protease | 0.00e+00 | 2.41e-71 | 0.0 | 0.6584 |
| 1. PBF | P55995 | Lon protease | 0.00e+00 | 2.45e-64 | 5.57e-151 | 0.6726 |
| 1. PBF | O31147 | Lon protease | 0.00e+00 | 1.35e-65 | 7.27e-170 | 0.6645 |
| 1. PBF | A2QCJ2 | Lon protease homolog, mitochondrial | 3.22e-15 | 4.94e-03 | 1.40e-144 | 0.6626 |
| 1. PBF | O04979 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 1.60e-60 | 1.16e-167 | 0.6719 |
| 1. PBF | Q9ZD92 | Lon protease | 0.00e+00 | 4.61e-77 | 0.0 | 0.6752 |
| 1. PBF | B8GX12 | Lon protease | 0.00e+00 | 1.44e-63 | 0.0 | 0.6651 |
| 1. PBF | B0TZA7 | Lon protease | 0.00e+00 | 1.95e-74 | 0.0 | 0.6792 |
| 1. PBF | Q2YPX3 | Lon protease | 0.00e+00 | 1.82e-65 | 0.0 | 0.6494 |
| 1. PBF | Q600B5 | Lon protease | 0.00e+00 | 2.86e-46 | 0.0 | 0.6714 |
| 1. PBF | B9WLN5 | Lon protease homolog, mitochondrial | 0.00e+00 | 2.35e-11 | 1.76e-72 | 0.6507 |
| 1. PBF | B0TFI9 | Lon protease | 0.00e+00 | 1.65e-60 | 0.0 | 0.6698 |
| 1. PBF | Q3A701 | Lon protease 1 | 0.00e+00 | 6.25e-54 | 2.97e-175 | 0.6872 |
| 1. PBF | A0LG61 | Lon protease 2 | 0.00e+00 | 1.36e-78 | 0.0 | 0.7228 |
| 1. PBF | Q7SA85 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 2.99e-37 | 1.76e-136 | 0.6755 |
| 1. PBF | P78025 | Lon protease | 0.00e+00 | 2.94e-81 | 0.0 | 0.6832 |
| 1. PBF | Q8G0I7 | Lon protease | 0.00e+00 | 7.79e-65 | 0.0 | 0.652 |
| 1. PBF | B3E7K2 | Lon protease | 0.00e+00 | 2.32e-63 | 0.0 | 0.6773 |
| 1. PBF | A9WGB5 | Lon protease | 0.00e+00 | 8.13e-67 | 0.0 | 0.6418 |
| 1. PBF | Q2TAF8 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 5.60e-57 | 4.26e-154 | 0.6703 |
| 1. PBF | Q4X0Z7 | Lon protease homolog, mitochondrial | 3.11e-15 | 1.66e-06 | 3.56e-119 | 0.6649 |
| 1. PBF | A9ETZ9 | Lon protease 1 | 0.00e+00 | 2.61e-74 | 2.19e-177 | 0.7083 |
| 1. PBF | Q2LVS9 | Lon protease | 0.00e+00 | 3.84e-72 | 0.0 | 0.6964 |
| 1. PBF | Q9Z9F4 | Lon protease | 0.00e+00 | 2.80e-54 | 4.00e-169 | 0.6677 |
| 1. PBF | B1AIY7 | Lon protease | 0.00e+00 | 1.32e-82 | 0.0 | 0.6654 |
| 1. PBF | Q2GE60 | Lon protease | 0.00e+00 | 7.46e-69 | 0.0 | 0.6681 |
| 1. PBF | Q2IIK1 | Lon protease | 0.00e+00 | 4.48e-63 | 0.0 | 0.6645 |
| 1. PBF | Q3A334 | Lon protease 2 | 0.00e+00 | 1.07e-66 | 0.0 | 0.6447 |
| 1. PBF | B8CY71 | Lon protease | 0.00e+00 | 6.22e-74 | 0.0 | 0.6752 |
| 1. PBF | P77810 | Lon protease | 0.00e+00 | 5.71e-59 | 0.0 | 0.6654 |
| 1. PBF | Q92HZ1 | Lon protease | 0.00e+00 | 9.85e-78 | 0.0 | 0.6804 |
| 1. PBF | A9B3R2 | Lon protease 2 | 0.00e+00 | 1.12e-64 | 0.0 | 0.6546 |
| 1. PBF | B5Y8Q8 | Lon protease | 0.00e+00 | 8.86e-74 | 0.0 | 0.6717 |
| 1. PBF | B5YFG2 | Lon protease | 0.00e+00 | 1.56e-77 | 0.0 | 0.6778 |
| 1. PBF | P0C113 | Lon protease | 0.00e+00 | 1.82e-65 | 0.0 | 0.6457 |
| 1. PBF | Q72CE6 | Lon protease | 0.00e+00 | 1.20e-62 | 0.0 | 0.664 |
| 1. PBF | A8Z5Z0 | Lon protease | 0.00e+00 | 5.29e-32 | 1.59e-165 | 0.6645 |
| 1. PBF | P46067 | Lon protease | 0.00e+00 | 1.48e-68 | 0.0 | 0.6747 |
| 1. PBF | O66605 | Lon protease | 0.00e+00 | 7.06e-77 | 0.0 | 0.7691 |
| 1. PBF | A2YQ56 | Lon protease homolog, mitochondrial | 0.00e+00 | 9.94e-21 | 2.24e-104 | 0.6807 |
| 1. PBF | Q4A696 | Lon protease | 2.11e-15 | 7.37e-49 | 0.0 | 0.6454 |
| 1. PBF | Q00WL5 | Lon protease homolog, mitochondrial | 0.00e+00 | 4.93e-19 | 2.11e-170 | 0.6726 |
| 1. PBF | Q469F5 | Lon protease | 0.00e+00 | 3.73e-79 | 0.0 | 0.6813 |
| 1. PBF | A7NM80 | Lon protease | 0.00e+00 | 2.03e-72 | 0.0 | 0.7003 |
| 1. PBF | Q6C0L7 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 9.57e-42 | 1.51e-153 | 0.6722 |
| 1. PBF | B7GXS7 | Lon protease | 0.00e+00 | 1.14e-67 | 0.0 | 0.6655 |
| 1. PBF | A5IYF2 | Lon protease | 1.11e-16 | 8.99e-25 | 0.0 | 0.6678 |
| 1. PBF | P0CQ17 | Lon protease homolog, mitochondrial | 0.00e+00 | 2.68e-11 | 7.97e-98 | 0.6979 |
| 1. PBF | Q3SX23 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 2.96e-54 | 1.66e-161 | 0.6767 |
| 1. PBF | Q026Q2 | Lon protease | 0.00e+00 | 1.15e-64 | 0.0 | 0.6833 |
| 1. PBF | Q6ML73 | Lon protease 1 | 0.00e+00 | 1.93e-70 | 0.0 | 0.6861 |
| 1. PBF | O84348 | Lon protease | 0.00e+00 | 3.75e-55 | 2.62e-171 | 0.6719 |
| 1. PBF | B0S2N4 | Lon protease | 0.00e+00 | 5.07e-80 | 0.0 | 0.6846 |
| 1. PBF | A8F811 | Lon protease | 0.00e+00 | 6.17e-67 | 0.0 | 0.6517 |
| 1. PBF | B2V6N0 | Lon protease | 0.00e+00 | 2.56e-77 | 0.0 | 0.6755 |
| 1. PBF | B3CLB3 | Lon protease | 0.00e+00 | 1.28e-58 | 0.0 | 0.6611 |
| 1. PBF | A4XJL4 | Lon protease | 0.00e+00 | 2.01e-76 | 0.0 | 0.6751 |
| 1. PBF | B2KCC0 | Lon protease | 0.00e+00 | 4.50e-50 | 0.0 | 0.6625 |
| 1. PBF | Q6CNR9 | Lon protease homolog, mitochondrial | 7.75e-11 | 2.24e-05 | 4.76e-93 | 0.6706 |
| 1. PBF | P0CQ16 | Lon protease homolog, mitochondrial | 0.00e+00 | 1.62e-11 | 9.86e-98 | 0.6852 |
| 1. PBF | B3PN08 | Lon protease | 0.00e+00 | 2.24e-67 | 0.0 | 0.6547 |
| 1. PBF | A3M072 | Lon protease homolog, mitochondrial (Fragment) | 0.00e+00 | 1.07e-07 | 2.70e-79 | 0.6492 |
| 1. PBF | Q8K988 | Lon protease | 0.00e+00 | 1.13e-71 | 0.0 | 0.6787 |
| 1. PBF | A7HK39 | Lon protease | 0.00e+00 | 5.32e-73 | 0.0 | 0.6541 |
| 1. PBF | O69300 | Lon protease | 0.00e+00 | 3.86e-76 | 1.67e-157 | 0.6824 |
| 1. PBF | O69177 | Lon protease | 0.00e+00 | 8.90e-61 | 0.0 | 0.6611 |
| 1. PBF | P47481 | Lon protease | 0.00e+00 | 2.31e-78 | 0.0 | 0.6953 |
| 1. PBF | Q0AWF3 | Lon protease | 0.00e+00 | 4.27e-61 | 0.0 | 0.6722 |
| 1. PBF | Q32JJ5 | Lon protease | 0.00e+00 | 4.92e-48 | 0.0 | 0.6923 |
| 1. PBF | A5FG89 | Lon protease | 0.00e+00 | 1.19e-64 | 0.0 | 0.668 |
| 1. PBF | Q6C0B5 | Lon protease homolog, mitochondrial | 3.77e-14 | 6.00e-05 | 2.20e-97 | 0.6865 |
| 1. PBF | Q6BKJ4 | Lon protease homolog, mitochondrial | 0.00e+00 | 2.93e-08 | 1.83e-83 | 0.6854 |
| 1. PBF | B3CUN9 | Lon protease | 0.00e+00 | 3.40e-73 | 1.90e-179 | 0.6661 |
| 2. PF | Q25544 | 26S proteasome regulatory subunit 8 homolog | 2.73e-03 | 1.64e-02 | NA | 0.3888 |
| 2. PF | A4FBX6 | Proteasome-associated ATPase | 2.80e-03 | 3.67e-03 | NA | 0.3926 |
| 2. PF | A1R6Q4 | Proteasome-associated ATPase | 1.78e-02 | 3.89e-02 | NA | 0.3944 |
| 2. PF | C7MWW2 | Proteasome-associated ATPase | 5.19e-03 | 7.73e-05 | NA | 0.398 |
| 2. PF | Q8FTE3 | AAA ATPase forming ring-shaped complexes | 1.26e-02 | 5.22e-06 | NA | 0.4373 |
| 4. PB | Q9DBN5 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 7.18e-54 | 3.59e-159 | NA |
| 4. PB | Q5A6N1 | Lon protease homolog, mitochondrial | 0.00e+00 | 3.71e-09 | 6.32e-73 | NA |
| 4. PB | D2QZ34 | ATP-dependent zinc metalloprotease FtsH | 8.46e-04 | 4.86e-02 | 0.010 | NA |
| 4. PB | P93648 | Lon protease homolog, mitochondrial | 0.00e+00 | 4.35e-25 | 1.42e-104 | NA |
| 4. PB | P36775 | Lon protease homolog, mitochondrial | 1.11e-15 | 2.27e-06 | 1.14e-95 | NA |
| 4. PB | Q924S5 | Lon protease homolog, mitochondrial | 0.00e+00 | 9.62e-16 | 7.63e-162 | NA |
| 4. PB | A3LUF7 | Lon protease homolog 2, peroxisomal | 1.10e-11 | 2.81e-10 | 1.20e-102 | NA |
| 4. PB | Q69UZ3 | Lon protease homolog, mitochondrial | 0.00e+00 | 2.94e-20 | 2.06e-104 | NA |
| 4. PB | B3R057 | ATP-dependent zinc metalloprotease FtsH 1 | 8.15e-04 | 3.61e-02 | 3.78e-04 | NA |
| 4. PB | Q86WA8 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 2.72e-54 | 1.33e-160 | NA |
| 4. PB | O44952 | Lon protease homolog, mitochondrial | 0.00e+00 | 7.72e-20 | 6.82e-148 | NA |
| 4. PB | O64948 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 1.79e-57 | 2.87e-173 | NA |
| 4. PB | Q09769 | Lon protease homolog, mitochondrial | 1.11e-16 | 1.29e-06 | 6.42e-148 | NA |
| 4. PB | Q3MIB4 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 1.28e-53 | 2.06e-161 | NA |
| 4. PB | Q9M9L7 | Lon protease homolog 4, chloroplastic/mitochondrial | 2.22e-16 | 2.43e-27 | 8.23e-94 | NA |
| 4. PB | Q8CGK3 | Lon protease homolog, mitochondrial | 0.00e+00 | 3.78e-15 | 3.86e-163 | NA |
| 4. PB | Q0J032 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 2.65e-54 | 1.12e-165 | NA |
| 4. PB | A6VHR1 | Proteasome-activating nucleotidase | 1.01e-03 | 2.61e-02 | 0.047 | NA |
| 4. PB | A6UQT3 | Proteasome-activating nucleotidase | 1.61e-03 | 3.49e-03 | 0.031 | NA |
| 4. PB | O17071 | Probable 26S proteasome regulatory subunit 10B | 7.68e-04 | 4.27e-02 | 0.016 | NA |
| 4. PB | Q5UPT0 | Lon protease homolog | NA | 5.10e-06 | 1.91e-56 | NA |
| 4. PB | Q9XW87 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 4.44e-60 | 9.79e-141 | NA |
| 4. PB | Q5Z974 | ATP-dependent zinc metalloprotease FTSH 1, chloroplastic | 6.34e-03 | 1.87e-02 | 0.028 | NA |
| 4. PB | P0A9M0 | Lon protease | 0.00e+00 | 3.88e-69 | 0.0 | NA |
| 4. PB | Q7URM7 | ATP-dependent zinc metalloprotease FtsH 2 | 2.94e-03 | 6.25e-03 | 8.41e-04 | NA |
| 4. PB | D1C8C0 | ATP-dependent zinc metalloprotease FtsH 4 | 3.61e-03 | 3.82e-02 | 0.006 | NA |
| 4. PB | Q550C8 | Lon protease homolog, mitochondrial 2 | 2.00e-15 | 9.56e-44 | 1.53e-143 | NA |
| 4. PB | B9WEC4 | Lon protease homolog 2, peroxisomal | 2.63e-07 | 8.98e-18 | 1.29e-94 | NA |
| 4. PB | Q59YV0 | Lon protease homolog 2, peroxisomal | 2.59e-07 | 2.48e-08 | 4.18e-94 | NA |
| 4. PB | P36776 | Lon protease homolog, mitochondrial | 0.00e+00 | 2.73e-12 | 4.11e-160 | NA |
| 4. PB | Q5PQY6 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 1.51e-57 | 1.04e-158 | NA |
| 4. PB | Q54YV4 | Lon protease homolog, mitochondrial 1 | 0.00e+00 | 3.07e-12 | 1.84e-156 | NA |
| 4. PB | P93647 | Lon protease homolog 2, peroxisomal | 0.00e+00 | 2.87e-58 | 1.03e-164 | NA |
| 4. PB | P93655 | Lon protease homolog 1, mitochondrial | 0.00e+00 | 8.71e-23 | 1.06e-153 | NA |
| 4. PB | Q9HSC3 | Archaeal Lon protease | 1.63e-04 | 1.58e-03 | 1.34e-18 | NA |
| 4. PB | Q9M9L8 | Lon protease homolog 3, mitochondrial | 0.00e+00 | 9.01e-22 | 2.86e-131 | NA |
| 4. PB | P73179 | ATP-dependent zinc metalloprotease FtsH 1 | 1.83e-03 | 4.39e-02 | 0.026 | NA |
| 4. PB | Q7KUT2 | Lon protease homolog, mitochondrial | 0.00e+00 | 2.76e-09 | 1.13e-162 | NA |
| 5. P | A0PQT9 | Proteasome-associated ATPase | 1.01e-02 | 3.49e-03 | NA | NA |
| 5. P | Q3UA06 | Pachytene checkpoint protein 2 homolog | 1.13e-02 | 1.52e-02 | NA | NA |
| 5. P | B3DRN4 | AAA ATPase forming ring-shaped complexes | 3.81e-03 | 1.41e-05 | NA | NA |
| 5. P | P63346 | Proteasome-associated ATPase | 1.09e-02 | 8.79e-03 | NA | NA |
| 5. P | P9WQN4 | Proteasome-associated ATPase | 8.73e-03 | 8.79e-03 | NA | NA |
| 5. P | P0DKJ9 | 26S proteasome regulatory subunit 7A | 6.31e-03 | 1.95e-02 | NA | NA |
| 5. P | A3Q196 | Proteasome-associated ATPase | 9.15e-03 | 5.04e-03 | NA | NA |
| 5. P | D2S6D9 | Proteasome-associated ATPase | 1.87e-02 | 1.17e-02 | NA | NA |
| 5. P | C6AHX0 | AAA ATPase forming ring-shaped complexes | 5.30e-03 | 2.92e-03 | NA | NA |
| 5. P | P42811 | Putative 26S proteasome regulatory subunit homolog MTBMA_c13930 | 5.60e-03 | 4.95e-02 | NA | NA |
| 5. P | Q3B0U2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.19e-04 | 2.40e-02 | NA | NA |
| 5. P | Q7UA37 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.55e-04 | 1.93e-02 | NA | NA |
| 5. P | A5GHS5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.40e-05 | 1.28e-02 | NA | NA |
| 5. P | P78578 | 26S proteasome regulatory subunit 6B homolog | 2.82e-03 | 3.39e-02 | NA | NA |
| 5. P | Q9ZJL8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.74e-03 | 7.29e-04 | NA | NA |
| 5. P | C6DPU6 | Proteasome-associated ATPase | 9.59e-03 | 8.79e-03 | NA | NA |
| 5. P | B0B970 | ATP-dependent zinc metalloprotease FtsH | 2.79e-03 | 3.35e-02 | NA | NA |
| 5. P | Q7NDN9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.19e-05 | 2.22e-02 | NA | NA |
| 5. P | A4QE83 | AAA ATPase forming ring-shaped complexes | 6.45e-03 | 1.02e-05 | NA | NA |
| 5. P | C0ZZV2 | Proteasome-associated ATPase | 1.41e-02 | 2.92e-03 | NA | NA |
| 5. P | C1AQ31 | Proteasome-associated ATPase | 9.60e-03 | 8.79e-03 | NA | NA |
| 5. P | Q03F27 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.57e-05 | 4.39e-02 | NA | NA |
| 5. P | D1A2S5 | Proteasome-associated ATPase | 1.02e-02 | 1.75e-02 | NA | NA |
| 5. P | O64982 | 26S proteasome regulatory subunit 7 | 1.31e-02 | 5.40e-03 | NA | NA |
| 5. P | Q9HNP9 | Proteasome-activating nucleotidase 2 | 4.26e-03 | 2.71e-02 | NA | NA |
| 5. P | Q5T2N8 | ATPase family AAA domain-containing protein 3C | 1.88e-03 | 4.86e-02 | NA | NA |
| 5. P | D3Q568 | Proteasome-associated ATPase | 8.01e-03 | 5.56e-03 | NA | NA |
| 5. P | C6A7B2 | AAA ATPase forming ring-shaped complexes | 5.97e-03 | 2.92e-03 | NA | NA |
| 5. P | B2IT91 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.74e-05 | 3.35e-02 | NA | NA |
| 5. P | D2Q4G5 | Proteasome-associated ATPase | 4.57e-03 | 1.07e-02 | NA | NA |
| 5. P | Q94BQ2 | 26S proteasome regulatory subunit 8 homolog B | 8.09e-04 | 2.66e-02 | NA | NA |
| 5. P | D0LDS6 | Proteasome-associated ATPase | 1.67e-02 | 3.76e-06 | NA | NA |
| 5. P | Q9LET7 | Calmodulin-interacting protein 111 | 3.01e-02 | 1.79e-02 | NA | NA |
| 5. P | Q1B795 | Proteasome-associated ATPase | 7.94e-03 | 5.04e-03 | NA | NA |
| 5. P | Q9SSB5 | 26S proteasome regulatory subunit 7 homolog A | 6.24e-03 | 1.32e-02 | NA | NA |
| 5. P | A5GQ09 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.27e-04 | 2.06e-02 | NA | NA |
| 5. P | Q2J9Q0 | Proteasome-associated ATPase | 1.88e-02 | 4.75e-03 | NA | NA |
| 5. P | A1TAQ3 | Proteasome-associated ATPase | 8.95e-03 | 9.78e-03 | NA | NA |
| 5. P | B8ZRF0 | Proteasome-associated ATPase | 9.61e-03 | 3.22e-03 | NA | NA |
| 5. P | C7MCZ0 | AAA ATPase forming ring-shaped complexes | 7.54e-03 | 8.53e-05 | NA | NA |
| 5. P | C8XAR0 | Proteasome-associated ATPase | 1.11e-02 | 1.45e-03 | NA | NA |
| 5. P | C4LIL2 | AAA ATPase forming ring-shaped complexes | 2.36e-02 | 2.16e-03 | NA | NA |
| 5. P | A1UHT0 | Proteasome-associated ATPase | 8.48e-03 | 5.04e-03 | NA | NA |
| 5. P | Q5YUW4 | Proteasome-associated ATPase | 1.00e-02 | 2.68e-04 | NA | NA |
| 5. P | B1XN45 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.86e-05 | 4.11e-02 | NA | NA |
| 5. P | Q8NQD8 | AAA ATPase forming ring-shaped complexes | 6.59e-03 | 1.02e-05 | NA | NA |
| 5. P | B8H8L3 | Proteasome-associated ATPase | 7.29e-03 | 1.72e-02 | NA | NA |
| 5. P | Q4JVP5 | AAA ATPase forming ring-shaped complexes | 2.22e-02 | 3.01e-06 | NA | NA |
| 5. P | O42931 | 26S proteasome regulatory subunit 7 homolog | 8.23e-03 | 2.37e-02 | NA | NA |
| 5. P | C7LYP4 | Proteasome-associated ATPase | 9.14e-03 | 2.26e-04 | NA | NA |
| 5. P | Q6P4W8 | Pachytene checkpoint protein 2 homolog | 1.38e-02 | 2.16e-02 | NA | NA |
| 5. P | A1KKF8 | Proteasome-associated ATPase | 1.02e-02 | 8.79e-03 | NA | NA |
| 5. P | A4TB65 | Proteasome-associated ATPase | 1.01e-02 | 5.14e-03 | NA | NA |
| 5. P | A1A0U4 | AAA ATPase forming ring-shaped complexes | 1.99e-03 | 1.29e-07 | NA | NA |
| 5. P | O04019 | 26S proteasome regulatory subunit 6A homolog B | 5.46e-03 | 3.45e-02 | NA | NA |
| 5. P | Q8SRH0 | 26S proteasome regulatory subunit 4 homolog | 1.53e-03 | 4.23e-02 | NA | NA |
| 5. P | A9BDA1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.50e-04 | 3.46e-03 | NA | NA |
| 5. P | C1ASQ2 | Proteasome-associated ATPase | 5.29e-03 | 6.37e-04 | NA | NA |
| 5. P | Q47NX7 | Proteasome-associated ATPase | 7.62e-03 | 1.93e-03 | NA | NA |
| 5. P | B1VDV2 | AAA ATPase forming ring-shaped complexes | 1.72e-02 | 1.28e-06 | NA | NA |
| 5. P | C6WIC8 | Proteasome-associated ATPase | 4.94e-03 | 3.36e-03 | NA | NA |
| 5. P | E2R222 | Pachytene checkpoint protein 2 homolog | 1.47e-02 | 4.35e-02 | NA | NA |
| 5. P | C5CBU4 | AAA ATPase forming ring-shaped complexes | 1.16e-02 | 3.89e-02 | NA | NA |
| 5. P | Q41365 | 26S proteasome regulatory subunit 7 | 5.20e-03 | 3.01e-03 | NA | NA |
| 5. P | B3QZS3 | ATP-dependent zinc metalloprotease FtsH 2 | 7.27e-03 | 4.30e-03 | NA | NA |
| 5. P | D2ATX1 | Proteasome-associated ATPase | 1.67e-02 | 2.29e-02 | NA | NA |
| 5. P | B2HFW2 | Proteasome-associated ATPase | 1.22e-02 | 4.61e-03 | NA | NA |
| 5. P | Q975U2 | Proteasome-activating nucleotidase | 8.75e-04 | 7.83e-03 | NA | NA |
| 5. P | Q5XHZ9 | Pachytene checkpoint protein 2 homolog | 1.58e-02 | 1.13e-02 | NA | NA |
| 5. P | O34126 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.73e-05 | 4.81e-02 | NA | NA |
| 5. P | P0DKK0 | 26S proteasome regulatory subunit 7B | 8.66e-03 | 1.95e-02 | NA | NA |
| 5. P | Q01939 | 26S proteasome regulatory subunit 8 homolog | 2.36e-03 | 8.71e-03 | NA | NA |
| 5. P | A4G0S4 | Proteasome-activating nucleotidase | 9.79e-04 | 8.71e-03 | NA | NA |
| 5. P | Q0RLU1 | Proteasome-associated ATPase | 1.12e-02 | 3.56e-03 | NA | NA |
| 5. P | P54776 | 26S proteasome regulatory subunit 6A homolog | 4.29e-03 | 4.86e-02 | NA | NA |
| 5. P | A6W963 | Proteasome-associated ATPase | 6.49e-03 | 6.99e-04 | NA | NA |
| 5. P | A8LH57 | Proteasome-associated ATPase | 7.30e-03 | 2.32e-03 | NA | NA |
| 5. P | Q6NH92 | AAA ATPase forming ring-shaped complexes | 6.29e-03 | 7.73e-05 | NA | NA |
| 5. P | A2C5R5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.48e-04 | 2.12e-02 | NA | NA |
| 5. P | A8M2A0 | Proteasome-associated ATPase | 1.89e-02 | 3.86e-02 | NA | NA |
| 5. P | Q6LWR0 | Proteasome-activating nucleotidase | 1.01e-03 | 9.41e-03 | NA | NA |
| 5. P | Q9XTT9 | 26S proteasome regulatory subunit 8 | 1.05e-03 | 4.22e-03 | NA | NA |
| 5. P | B2GIP2 | AAA ATPase forming ring-shaped complexes | 1.52e-02 | 2.28e-04 | NA | NA |
| 5. P | A0QZ54 | Proteasome-associated ATPase | 7.16e-03 | 1.04e-02 | NA | NA |
| 5. P | C0QHJ8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.81e-05 | 3.42e-02 | NA | NA |
| 5. P | A9A916 | Proteasome-activating nucleotidase | 1.01e-03 | 1.98e-02 | NA | NA |
| 5. P | B1ZMG6 | ATP-dependent zinc metalloprotease FtsH | 8.10e-03 | 4.35e-02 | NA | NA |
| 5. P | D1BHU2 | Proteasome-associated ATPase | 1.20e-02 | 7.07e-05 | NA | NA |
| 5. P | A9WSI4 | Proteasome-associated ATPase | 4.62e-03 | 4.86e-02 | NA | NA |
| 5. P | D2NT89 | AAA ATPase forming ring-shaped complexes | 2.71e-02 | 2.29e-03 | NA | NA |
| 5. P | Q0IE20 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.93e-03 | 2.31e-02 | NA | NA |
| 5. P | A0QFB2 | Proteasome-associated ATPase | 1.30e-02 | 2.92e-02 | NA | NA |
| 5. P | B7GUP3 | AAA ATPase forming ring-shaped complexes | 3.34e-03 | 5.87e-05 | NA | NA |
| 5. P | Q8SQI9 | 26S proteasome regulatory subunit 6B homolog | 3.28e-03 | 4.05e-03 | NA | NA |
| 5. P | P9WQN5 | Proteasome-associated ATPase | 1.31e-02 | 8.79e-03 | NA | NA |
| 5. P | E1C6Q1 | Pachytene checkpoint protein 2 homolog | 7.19e-03 | 2.00e-02 | NA | NA |
| 5. P | Q8G3G6 | AAA ATPase forming ring-shaped complexes | 6.56e-03 | 9.21e-06 | NA | NA |
| 5. P | B1MAH2 | Proteasome-associated ATPase | 1.00e-02 | 2.40e-02 | NA | NA |
| 5. P | Q9C5U3 | 26S proteasome regulatory subunit 8 homolog A | 3.22e-03 | 3.96e-02 | NA | NA |
| 5. P | C3PGA0 | AAA ATPase forming ring-shaped complexes | 5.14e-03 | 5.10e-06 | NA | NA |
| 5. P | C5BVA6 | Proteasome-associated ATPase | 1.17e-02 | 4.74e-07 | NA | NA |
| 5. P | P46509 | Proteasome-associated ATPase | 1.03e-02 | 3.22e-03 | NA | NA |
| 5. P | D3R4I7 | AAA ATPase forming ring-shaped complexes | 2.99e-03 | 1.87e-03 | NA | NA |
| 5. P | Q8H1F9 | Pachytene checkpoint protein 2 homolog | 3.80e-02 | 2.40e-02 | NA | NA |
| 5. P | B8GGN4 | Proteasome-activating nucleotidase | 1.09e-03 | 4.43e-03 | NA | NA |
| 5. P | Q15645 | Pachytene checkpoint protein 2 homolog | 1.20e-02 | 2.20e-02 | NA | NA |
| 5. P | D1BS23 | Proteasome-associated ATPase | 9.81e-03 | 1.49e-05 | NA | NA |
| 5. P | Q6PH52 | Pachytene checkpoint protein 2 homolog | 1.44e-02 | 2.63e-02 | NA | NA |
| 5. P | C7R400 | Proteasome-associated ATPase | 1.41e-02 | 3.01e-05 | NA | NA |
| 5. P | P46502 | Probable 26S proteasome regulatory subunit 6B | 3.18e-03 | 3.96e-02 | NA | NA |
| 5. P | D2Q9C6 | AAA ATPase forming ring-shaped complexes | 8.79e-03 | 4.20e-05 | NA | NA |
| 5. P | O25926 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.37e-04 | 3.29e-02 | NA | NA |
| 5. P | B4SCV5 | ATP-dependent zinc metalloprotease FtsH | 4.74e-03 | 3.45e-02 | NA | NA |
| 5. P | O50202 | Proteasome-associated ATPase | 9.55e-03 | 2.92e-03 | NA | NA |
| 5. P | A0LU46 | Proteasome-associated ATPase | 1.63e-02 | 1.53e-03 | NA | NA |
| 5. P | Q7V993 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.07e-04 | 1.84e-02 | NA | NA |
| 5. P | Q5N1P7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.60e-05 | 4.81e-02 | NA | NA |
| 5. P | Q58889 | Putative 26S proteasome regulatory subunit homolog MJ1494 | 1.64e-03 | 3.45e-02 | NA | NA |
| 5. P | A5U4E1 | Proteasome-associated ATPase | 9.81e-03 | 8.79e-03 | NA | NA |
| 5. P | B8DTX4 | AAA ATPase forming ring-shaped complexes | 5.47e-03 | 2.92e-03 | NA | NA |
| 5. P | A5WP89 | Proteasome-associated ATPase | 1.35e-02 | 8.79e-03 | NA | NA |
| 5. P | Q86JA1 | 26S proteasome regulatory subunit 7 | 1.06e-02 | 7.90e-03 | NA | NA |
| 5. P | Q7V9L5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.41e-04 | 1.81e-02 | NA | NA |
| 5. P | Q0SIF4 | Proteasome-associated ATPase | 9.01e-03 | 6.99e-04 | NA | NA |
| 6. F | P0CF65 | Protein cereblon | 2.10e-02 | NA | NA | 0.5093 |
| 6. F | C9Z319 | Proteasome-associated ATPase | 5.81e-03 | NA | NA | 0.3357 |
| 6. F | B7PXE3 | Spastin | 5.07e-02 | NA | NA | 0.4487 |
| 6. F | Q9RJ58 | Proteasome-associated ATPase | 5.06e-03 | NA | NA | 0.3389 |
| 6. F | Q05AS3 | Spastin | 9.12e-03 | NA | NA | 0.2901 |
| 6. F | Q6AZT2 | Spastin | 8.43e-03 | NA | NA | 0.2927 |
| 6. F | Q5R6Y2 | Protein cereblon | 2.00e-02 | NA | NA | 0.4832 |
| 6. F | Q828J2 | Proteasome-associated ATPase | 9.82e-03 | NA | NA | 0.3354 |
| 6. F | Q0P564 | Protein cereblon | 2.19e-02 | NA | NA | 0.5153 |
| 6. F | Q8HXH0 | LON peptidase N-terminal domain and RING finger protein 3 | 2.98e-01 | NA | NA | 0.6613 |
| 6. F | B1W303 | Proteasome-associated ATPase | 3.52e-02 | NA | NA | 0.382 |
| 6. F | Q640S2 | Protein cereblon | 2.31e-02 | NA | NA | 0.5092 |
| 7. B | Q9MAK9 | 26S proteasome regulatory subunit S10B homolog B | 2.09e-03 | NA | 0.030 | NA |
| 7. B | Q67WJ2 | ATP-dependent zinc metalloprotease FTSH 6, chloroplastic | 4.37e-03 | NA | 0.025 | NA |
| 7. B | D1J722 | ATP-dependent zinc metalloprotease FtsH | 3.24e-03 | NA | 0.019 | NA |
| 7. B | P0AAI4 | ATP-dependent zinc metalloprotease FtsH | 3.81e-03 | NA | 0.048 | NA |
| 7. B | Q8VZI8 | ATP-dependent zinc metalloprotease FTSH 10, mitochondrial | 4.71e-03 | NA | 0.046 | NA |
| 7. B | D3F124 | ATP-dependent zinc metalloprotease FtsH 1 | 2.00e-03 | NA | 0.025 | NA |
| 7. B | Q72DA1 | Cytidylate kinase | 7.89e-01 | NA | 0.006 | NA |
| 7. B | Q54PJ1 | 26S proteasome regulatory subunit 10B | 3.29e-03 | NA | 0.005 | NA |
| 7. B | A3MS28 | Replication factor C small subunit | 2.53e-04 | NA | 0.014 | NA |
| 7. B | Q9TLY2 | Protein CfxQ homolog | 1.42e-03 | NA | 0.005 | NA |
| 7. B | Q9P7J5 | Uncharacterized AAA domain-containing protein C24B10.10c | 1.07e-02 | NA | 0.037 | NA |
| 7. B | Q58294 | Replication factor C large subunit | 6.96e-03 | NA | 0.005 | NA |
| 7. B | D5D8E3 | ATP-dependent zinc metalloprotease FtsH | 2.03e-03 | NA | 5.59e-04 | NA |
| 7. B | Q99338 | Insertion sequence IS232 putative ATP-binding protein | 1.35e-01 | NA | 0.049 | NA |
| 7. B | O83985 | DNA repair protein RadA | 1.80e-03 | NA | 0.016 | NA |
| 7. B | Q8S2A7 | ATP-dependent zinc metalloprotease FTSH 3, mitochondrial | 1.67e-02 | NA | 0.009 | NA |
| 7. B | O33089 | ESX-1 secretion system protein EccA1 | 3.76e-03 | NA | 0.003 | NA |
| 7. B | P36966 | Peroxisomal biogenesis factor 6 | 4.03e-02 | NA | 0.048 | NA |
| 7. B | Q58714 | Uncharacterized protein MJ1318 | 2.90e-01 | NA | 3.01e-05 | NA |
| 7. B | Q58556 | Cell division cycle protein 48 homolog MJ1156 | 1.68e-02 | NA | 0.003 | NA |
| 7. B | P9WPH9 | ESX-1 secretion system protein EccA1 | 5.45e-03 | NA | 0.009 | NA |
| 7. B | Q9M895 | Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic | 1.21e-02 | NA | 0.038 | NA |
| 7. B | A4WLY0 | Replication factor C small subunit 2 | 2.05e-03 | NA | 0.041 | NA |
| 7. B | Q254B4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.14e-03 | NA | 0.012 | NA |
| 7. B | Q5UQE0 | Putative AAA family ATPase R476 | NA | NA | 0.016 | NA |
| 7. B | Q823K4 | Holliday junction ATP-dependent DNA helicase RuvB | 1.15e-03 | NA | 0.006 | NA |
| 7. B | D3FFN2 | ATP-dependent zinc metalloprotease FtsH | 8.77e-03 | NA | 0.009 | NA |
| 7. B | B2UE66 | ATP-dependent zinc metalloprotease FtsH | 4.09e-03 | NA | 0.015 | NA |
| 7. B | A1URA3 | ATP-dependent zinc metalloprotease FtsH | 3.54e-03 | NA | 0.002 | NA |
| 7. B | Q6E0V2 | Katanin p60 ATPase-containing subunit A1 | 6.31e-03 | NA | 0.017 | NA |
| 7. B | A9RA82 | Katanin p60 ATPase-containing subunit A-like 1 | 1.21e-02 | NA | 5.68e-05 | NA |
| 7. B | A0QNI9 | ESX-1 secretion system protein EccA1 | 3.69e-03 | NA | 0.004 | NA |
| 7. B | Q5RII9 | Katanin p60 ATPase-containing subunit A1 | 4.46e-03 | NA | 7.26e-04 | NA |
| 7. B | D0LWB8 | ATP-dependent zinc metalloprotease FtsH | 3.27e-03 | NA | 0.015 | NA |
| 7. B | P62334 | 26S proteasome regulatory subunit 10B | 1.80e-03 | NA | 0.021 | NA |
| 7. B | P75867 | Putative Lon protease homolog | 3.86e-06 | NA | 5.57e-05 | NA |
| 7. B | Q8SQK0 | 26S proteasome regulatory subunit 8 homolog | 5.50e-04 | NA | 0.001 | NA |
| 7. B | Q9SEX2 | Katanin p60 ATPase-containing subunit A1 | 1.10e-02 | NA | 1.01e-06 | NA |
| 7. B | Q73K92 | Chaperone protein ClpB | 9.58e-04 | NA | 0.003 | NA |
| 7. B | Q8K9G8 | ATP-dependent zinc metalloprotease FtsH | 1.86e-03 | NA | 0.010 | NA |
| 7. B | Q5HQI5 | Chaperone protein ClpB | 4.16e-04 | NA | 0.004 | NA |
| 7. B | P62333 | 26S proteasome regulatory subunit 10B | 1.95e-03 | NA | 0.021 | NA |
| 7. B | B0K657 | ATP-dependent zinc metalloprotease FtsH 2 | 3.04e-04 | NA | 0.004 | NA |
| 7. B | O84044 | Holliday junction ATP-dependent DNA helicase RuvB | 2.52e-03 | NA | 0.006 | NA |
| 7. B | F3YDF1 | ATP-dependent zinc metalloprotease YME1L | 9.01e-04 | NA | 0.003 | NA |
| 7. B | Q1PDW5 | ATP-dependent zinc metalloprotease FTSH 6, chloroplastic | 3.59e-03 | NA | 0.007 | NA |
| 7. B | Q8DTC7 | Chaperone protein ClpB | 1.44e-03 | NA | 0.012 | NA |
| 7. B | B2UMY1 | ATP-dependent zinc metalloprotease FtsH | 5.58e-03 | NA | 0.005 | NA |
| 7. B | B7T1V0 | ATP-dependent zinc metalloprotease FtsH | 6.43e-04 | NA | 0.020 | NA |
| 7. B | Q8NKS6 | Archaeal Lon protease | 1.15e-04 | NA | 1.25e-19 | NA |
| 7. B | Q6GAV1 | Chaperone protein ClpB | 3.32e-04 | NA | 0.013 | NA |
| 7. B | Q4JAB1 | Replication factor C large subunit | 3.92e-03 | NA | 0.015 | NA |
| 7. B | A1RV38 | Replication factor C small subunit 2 | 8.60e-03 | NA | 0.012 | NA |
| 7. B | A7YSY2 | Spermatogenesis-associated protein 5-like protein 1 | 1.12e-02 | NA | 0.022 | NA |
| 7. B | Q2R2B4 | Replication factor C subunit 1 | 1.29e-01 | NA | 0.015 | NA |
| 7. B | Q0IIR9 | Katanin p60 ATPase-containing subunit A1 | 6.65e-03 | NA | 5.90e-04 | NA |
| 7. B | Q5U3S1 | Katanin p60 ATPase-containing subunit A-like 1 | 1.18e-02 | NA | 1.37e-04 | NA |
| 7. B | Q8ZWS2 | Replication factor C small subunit 2 | 1.98e-03 | NA | 0.029 | NA |
| 7. B | Q8LQJ9 | ATP-dependent zinc metalloprotease FTSH 4, mitochondrial | 1.67e-03 | NA | 0.002 | NA |
| 7. B | Q8X9L0 | ATP-dependent zinc metalloprotease FtsH | 3.90e-03 | NA | 0.049 | NA |
| 7. B | B1AI94 | ATP-dependent zinc metalloprotease FtsH | 4.72e-03 | NA | 3.23e-05 | NA |
| 7. B | D1C2C6 | ATP-dependent zinc metalloprotease FtsH 2 | 3.45e-03 | NA | 0.020 | NA |
| 7. B | Q3B6R3 | ATP-dependent zinc metalloprotease FtsH | 8.33e-03 | NA | 0.016 | NA |
| 7. B | Q46C63 | Replication factor C small subunit | 1.30e-03 | NA | 0.009 | NA |
| 7. B | P33760 | Peroxisomal ATPase PEX6 | 2.17e-02 | NA | 0.025 | NA |
| 7. B | B8H454 | Holliday junction ATP-dependent DNA helicase RuvB | 5.62e-03 | NA | 0.018 | NA |
| 7. B | P71377 | ATP-dependent zinc metalloprotease FtsH | 3.30e-03 | NA | 0.004 | NA |
| 7. B | Q5BKJ7 | Torsin-4A | 1.78e-02 | NA | 0.002 | NA |
| 7. B | B9KXV3 | ATP-dependent zinc metalloprotease FtsH 1 | 3.17e-03 | NA | 4.40e-05 | NA |
| 7. B | P0ABI0 | ATP-dependent Clp protease ATP-binding subunit ClpA | 1.49e-03 | NA | 0.037 | NA |
| 7. B | Q9FGM0 | ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial | 6.15e-03 | NA | 0.026 | NA |
| 7. B | B1ZL59 | ATP-dependent protease ATPase subunit HslU | 2.99e-02 | NA | 0.040 | NA |
| 7. B | Q9BVQ7 | Spermatogenesis-associated protein 5-like protein 1 | 7.51e-03 | NA | 0.043 | NA |
| 7. B | D5H7Z5 | ATP-dependent zinc metalloprotease FtsH 1 | 9.96e-03 | NA | 8.39e-04 | NA |
| 7. B | B8J992 | ATP-dependent zinc metalloprotease FtsH | 2.61e-02 | NA | 0.004 | NA |
| 7. B | A9EXK6 | ATP-dependent zinc metalloprotease FtsH 4 | 6.50e-03 | NA | 0.008 | NA |
| 7. B | C8WEG0 | ATP-dependent zinc metalloprotease FtsH | 3.44e-03 | NA | 0.016 | NA |
| 7. B | B7NZ88 | Katanin p60 ATPase-containing subunit A-like 1 | 4.57e-03 | NA | 6.87e-05 | NA |
| 7. B | A6LD25 | ATP-dependent zinc metalloprotease FtsH | 1.36e-03 | NA | 0.003 | NA |
| 7. B | Q0IHC5 | Torsin-4A-A | 2.73e-02 | NA | 1.97e-04 | NA |
| 7. B | P24554 | DNA repair protein RadA | 3.08e-03 | NA | 1.78e-04 | NA |
| 7. B | C6V4R9 | ATP-dependent zinc metalloprotease FtsH | 2.13e-03 | NA | 0.039 | NA |
| 7. B | A1RSA2 | Replication factor C small subunit 1 | 2.12e-04 | NA | 0.025 | NA |
| 7. B | P0ABI1 | ATP-dependent Clp protease ATP-binding subunit ClpA | 1.41e-03 | NA | 0.037 | NA |
| 7. B | Q9BAE0 | ATP-dependent zinc metalloprotease FTSH, chloroplastic | 6.13e-03 | NA | 0.016 | NA |
| 7. B | O77277 | Torsin-like protein | 2.72e-03 | NA | 0.021 | NA |
| 7. B | Q1LLA9 | ATP-dependent zinc metalloprotease FtsH | 3.08e-03 | NA | 0.002 | NA |
| 7. B | Q55700 | ATP-dependent zinc metalloprotease FtsH 2 | 2.24e-03 | NA | 0.019 | NA |
| 7. B | Q8EW28 | Chaperone protein ClpB | 4.94e-04 | NA | 2.71e-04 | NA |
| 7. B | Q9UVU5 | Peroxisomal biogenesis factor 6 | 3.81e-02 | NA | 0.010 | NA |
| 7. B | B0B9E8 | Holliday junction ATP-dependent DNA helicase RuvB | 9.21e-04 | NA | 0.006 | NA |
| 7. B | Q6BS73 | Peroxisomal biogenesis factor 6 | 6.79e-02 | NA | 0.003 | NA |
| 7. B | Q2KIW6 | 26S proteasome regulatory subunit 10B | 1.83e-03 | NA | 0.023 | NA |
| 7. B | Q9HG03 | Peroxisomal biogenesis factor 6 | 8.08e-02 | NA | 0.028 | NA |
| 7. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 4.38e-03 | NA | 0.030 | NA |
| 7. B | D0MGU8 | ATP-dependent zinc metalloprotease FtsH | 2.46e-03 | NA | 2.18e-04 | NA |
| 7. B | Q74Z13 | Peroxisomal biogenesis factor 6 | 3.79e-02 | NA | 0.007 | NA |
| 7. B | Q8CPT5 | Chaperone protein ClpB | 4.00e-04 | NA | 0.004 | NA |
| 7. B | P47695 | ATP-dependent zinc metalloprotease FtsH | 8.82e-03 | NA | 6.77e-04 | NA |
| 7. B | Q9SAJ3 | ATP-dependent zinc metalloprotease FTSH 12, chloroplastic | 9.25e-03 | NA | 0.019 | NA |
| 7. B | O68185 | Chaperone protein ClpB | 1.39e-04 | NA | 0.030 | NA |
| 7. B | P54815 | Mitochondrial sorting homolog | 6.22e-04 | NA | 0.025 | NA |
| 7. B | Q8K0T4 | Katanin p60 ATPase-containing subunit A-like 1 | 2.33e-03 | NA | 4.81e-05 | NA |
| 7. B | O58221 | Archaeal Lon protease | 7.70e-03 | NA | 3.00e-20 | NA |
| 7. B | B8G4Q6 | ATP-dependent zinc metalloprotease FtsH | 4.29e-03 | NA | 0.002 | NA |
| 7. B | Q9SEI3 | 26S proteasome regulatory subunit 10B homolog A | 1.86e-03 | NA | 0.026 | NA |
| 7. B | P58274 | Archaeal Lon protease | 1.66e-04 | NA | 8.86e-20 | NA |
| 7. B | Q925S8 | ATP-dependent zinc metalloprotease YME1L1 | 5.21e-03 | NA | 0.003 | NA |
| 7. B | O80983 | ATP-dependent zinc metalloprotease FTSH 4, mitochondrial | 3.12e-03 | NA | 0.004 | NA |
| 7. B | Q2SF13 | ATP-dependent zinc metalloprotease FtsH | 4.04e-03 | NA | 0.034 | NA |
| 7. B | Q9TJ83 | ATP-dependent zinc metalloprotease FtsH | 3.25e-03 | NA | 0.024 | NA |
| 7. B | Q9UYC6 | Archaeal Lon protease | 7.78e-04 | NA | 9.08e-20 | NA |
| 7. B | P43865 | Putative Lon protease homolog | 7.38e-05 | NA | 0.040 | NA |
| 7. B | O19922 | ATP-dependent zinc metalloprotease FtsH | 3.25e-03 | NA | 0.003 | NA |
| 7. B | P57462 | ATP-dependent zinc metalloprotease FtsH | 1.79e-03 | NA | 0.018 | NA |
| 7. B | Q1AV13 | ATP-dependent zinc metalloprotease FtsH | 8.42e-03 | NA | 0.027 | NA |
| 7. B | Q7UUZ7 | ATP-dependent zinc metalloprotease FtsH 1 | 2.75e-03 | NA | 0.009 | NA |
| 7. B | Q84WU8 | ATP-dependent zinc metalloprotease FTSH 3, mitochondrial | 4.54e-03 | NA | 0.011 | NA |
| 7. B | Q6CPV1 | Peroxisomal biogenesis factor 6 | 3.25e-02 | NA | 0.015 | NA |
| 7. B | Q6GIB2 | Chaperone protein ClpB | 2.84e-04 | NA | 0.013 | NA |
| 7. B | P63344 | ATP-dependent zinc metalloprotease FtsH | 3.82e-03 | NA | 0.039 | NA |
| 7. B | B9L3S8 | ATP-dependent zinc metalloprotease FtsH 2 | 1.42e-03 | NA | 0.001 | NA |
| 7. B | Q2NIN5 | ATP-dependent zinc metalloprotease FtsH | 3.37e-03 | NA | 0.020 | NA |
| 7. B | Q6G0P9 | ATP-dependent protease ATPase subunit HslU | 2.38e-02 | NA | 0.044 | NA |
| 7. B | P96963 | DNA repair protein RadA | 1.66e-03 | NA | 0.005 | NA |
| 7. B | P42425 | Lon protease 2 | 8.76e-09 | NA | 8.62e-21 | NA |
| 7. B | B0BB27 | Holliday junction ATP-dependent DNA helicase RuvB | 9.04e-04 | NA | 0.006 | NA |
| 7. B | A4WGV3 | Replication factor C large subunit | 9.35e-03 | NA | 0.008 | NA |
| 7. B | P0DUG1 | Lon-like protease BrxL | 5.78e-05 | NA | 2.48e-08 | NA |
| 7. B | Q1HGK7 | Katanin p60 ATPase-containing subunit A1 | 5.40e-03 | NA | 0.004 | NA |
| 7. B | Q869L3 | Midasin | NA | NA | 0.016 | NA |
| 7. B | L8FMA1 | ESX-1 secretion system protein EccA1 | 2.80e-03 | NA | 0.004 | NA |
| 7. B | A0PXM8 | ATP-dependent zinc metalloprotease FtsH | 9.91e-03 | NA | 0.022 | NA |
| 7. B | P53549 | 26S proteasome subunit RPT4 | 4.04e-03 | NA | 0.023 | NA |
| 7. B | O14126 | 26S proteasome regulatory subunit 6A | 4.22e-03 | NA | 0.017 | NA |
| 7. B | Q9FH02 | ATP-dependent zinc metalloprotease FTSH 5, chloroplastic | 6.42e-03 | NA | 0.028 | NA |
| 7. B | P46468 | Putative cell division cycle ATPase | 5.33e-02 | NA | 0.031 | NA |
| 7. B | P0DTF4 | CD-NTase-associated protein 6 | 7.23e-03 | NA | 2.95e-04 | NA |
| 7. B | B0K5A3 | ATP-dependent zinc metalloprotease FtsH 1 | 3.13e-03 | NA | 0.039 | NA |
| 7. B | Q8PVY4 | Replication factor C small subunit | 2.17e-03 | NA | 0.001 | NA |
| 7. B | O61577 | Katanin p60 ATPase-containing subunit A1 | 5.08e-03 | NA | 4.07e-04 | NA |
| 7. B | Q0DHL4 | ATP-dependent zinc metalloprotease FTSH 8, mitochondrial | 1.56e-02 | NA | 0.011 | NA |
| 7. B | A1VEW5 | Cytidylate kinase | 7.94e-01 | NA | 0.026 | NA |
| 7. B | Q655S1 | ATP-dependent zinc metalloprotease FTSH 2, chloroplastic | 5.43e-03 | NA | 0.025 | NA |
| 7. B | C1F8X6 | ATP-dependent zinc metalloprotease FtsH | 2.10e-03 | NA | 0.003 | NA |
| 7. B | Q6G5G0 | ATP-dependent protease ATPase subunit HslU | 4.09e-02 | NA | 0.044 | NA |
| 7. B | P9WPH8 | ESX-1 secretion system protein EccA1 | 7.16e-03 | NA | 0.009 | NA |
| 7. B | B4USW8 | Katanin p60 ATPase-containing subunit A-like 1 | 7.25e-03 | NA | 5.04e-05 | NA |
| 7. B | Q975D4 | Replication factor C large subunit | 4.77e-03 | NA | 0.006 | NA |
| 7. B | Q73NE3 | ATP-dependent protease ATPase subunit HslU | 3.00e-02 | NA | 0.039 | NA |
| 7. B | B3R0J0 | Holliday junction ATP-dependent DNA helicase RuvB | 7.46e-04 | NA | 0.003 | NA |
| 7. B | O67588 | Chaperone protein ClpB | 1.33e-03 | NA | 0.036 | NA |
| 7. B | D1C1U7 | ATP-dependent zinc metalloprotease FtsH 1 | 4.05e-03 | NA | 0.002 | NA |
| 7. B | A9KP49 | Holliday junction ATP-dependent DNA helicase RuvB | 4.10e-03 | NA | 0.022 | NA |
| 7. B | Q96TA2 | ATP-dependent zinc metalloprotease YME1L1 | 5.32e-03 | NA | 0.003 | NA |
| 7. B | Q8NXE7 | Chaperone protein ClpB | 3.50e-04 | NA | 0.013 | NA |
| 7. B | O29883 | Archaeal Lon protease | 3.02e-06 | NA | 1.08e-16 | NA |
| 7. B | Q7P112 | ATP-dependent protease ATPase subunit HslU | 2.07e-02 | NA | 0.023 | NA |
| 7. B | P37476 | ATP-dependent zinc metalloprotease FtsH | 1.79e-03 | NA | 0.046 | NA |
| 7. B | Q6FW67 | Peroxisomal biogenesis factor 6 | 1.76e-02 | NA | 5.05e-04 | NA |
| 7. B | Q10ZF7 | ATP-dependent zinc metalloprotease FtsH | 3.41e-03 | NA | 0.027 | NA |
| 7. B | Q3KQ18 | Torsin-4A-B | 3.00e-03 | NA | 0.005 | NA |
| 7. B | Q3KMY1 | Holliday junction ATP-dependent DNA helicase RuvB | 1.12e-03 | NA | 0.006 | NA |
| 7. B | Q6PIW4 | Fidgetin-like protein 1 | 2.81e-02 | NA | 0.038 | NA |
| 7. B | P72991 | ATP-dependent zinc metalloprotease FtsH 3 | 5.75e-03 | NA | 0.041 | NA |
| 7. B | Q5XIK7 | Katanin p60 ATPase-containing subunit A-like 1 | 8.43e-03 | NA | 5.25e-05 | NA |
| 7. B | Q2JNP0 | ATP-dependent zinc metalloprotease FtsH | 3.86e-03 | NA | 0.026 | NA |
| 7. B | P40327 | 26S proteasome regulatory subunit 4 homolog | 4.49e-03 | NA | 0.014 | NA |
| 7. B | D5HA94 | ATP-dependent zinc metalloprotease FtsH 2 | 3.75e-03 | NA | 0.011 | NA |
| 7. B | B3R0R7 | ATP-dependent zinc metalloprotease FtsH 3 | 4.37e-04 | NA | 0.016 | NA |
| 7. B | O34470 | Uncharacterized protein YlbL | 2.52e-01 | NA | 2.11e-04 | NA |
| 7. B | P46508 | ATP-dependent zinc metalloprotease YME1 homolog | 2.75e-03 | NA | 0.032 | NA |
| 7. B | Q9Z8F3 | Holliday junction ATP-dependent DNA helicase RuvB | 9.19e-04 | NA | 0.003 | NA |
| 7. B | P33289 | Peroxisomal biogenesis factor 6 | 4.67e-02 | NA | 0.002 | NA |
| 7. B | Q9CFF3 | Chaperone protein ClpB | 6.43e-04 | NA | 0.027 | NA |
| 7. B | Q5AAW3 | ATP-dependent RNA helicase DHH1 | 3.12e-01 | NA | 0.028 | NA |
| 7. B | O66827 | DNA repair protein RadA | 9.32e-04 | NA | 5.60e-04 | NA |
| 7. B | P38035 | Transcriptional regulatory protein RtcR | 3.72e-03 | NA | 0.013 | NA |
| 7. B | O78516 | ATP-dependent zinc metalloprotease FtsH | 5.55e-04 | NA | 0.014 | NA |
| 7. B | Q9BW62 | Katanin p60 ATPase-containing subunit A-like 1 | 5.54e-03 | NA | 5.78e-05 | NA |
| 7. B | O82150 | ATP-dependent zinc metalloprotease FTSH, chloroplastic | 5.84e-03 | NA | 0.021 | NA |
| 7. B | Q9WV86 | Katanin p60 ATPase-containing subunit A1 | 4.77e-03 | NA | 0.011 | NA |
| 7. B | Q6MDI5 | ATP-dependent zinc metalloprotease FtsH | 1.75e-03 | NA | 8.80e-04 | NA |
| 7. B | Q9A3G8 | Holliday junction ATP-dependent DNA helicase RuvB | 2.24e-03 | NA | 0.018 | NA |
| 7. B | P94304 | ATP-dependent zinc metalloprotease FtsH | 1.42e-02 | NA | 0.013 | NA |
| 7. B | O59824 | ATP-dependent zinc metalloprotease YME1 homolog | 1.23e-03 | NA | 0.008 | NA |
| 7. B | B8H444 | ATP-dependent zinc metalloprotease FtsH | 1.79e-03 | NA | 0.040 | NA |
| 7. B | A9GRC9 | ATP-dependent zinc metalloprotease FtsH 1 | 1.13e-02 | NA | 0.011 | NA |
| 7. B | Q7SGP2 | Peroxisomal biogenesis factor 6 | 4.85e-02 | NA | 0.042 | NA |
| 7. B | Q39444 | ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) | 4.76e-03 | NA | 0.032 | NA |
| 7. B | O26878 | Archaeal Lon protease | 3.78e-05 | NA | 2.31e-21 | NA |
| 7. B | Q39102 | ATP-dependent zinc metalloprotease FTSH 1, chloroplastic | 5.07e-03 | NA | 0.033 | NA |
| 7. B | O22993 | Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic | 6.21e-03 | NA | 0.003 | NA |
| 7. B | P0AAI3 | ATP-dependent zinc metalloprotease FtsH | 2.29e-03 | NA | 0.048 | NA |
| 7. B | P0ABH9 | ATP-dependent Clp protease ATP-binding subunit ClpA | 1.99e-03 | NA | 0.037 | NA |
| 7. B | Q9N3T5 | AFG3-like protein spg-7 | 1.05e-02 | NA | 0.020 | NA |
| 7. B | B3EX35 | Katanin p60 ATPase-containing subunit A-like 1 | 1.28e-02 | NA | 4.35e-05 | NA |
| 7. B | A2ZVG7 | ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial | 4.00e-03 | NA | 0.023 | NA |
| 7. B | Q4L3G8 | ATP-dependent zinc metalloprotease FtsH | 4.28e-03 | NA | 0.005 | NA |
| 7. B | P33297 | 26S proteasome regulatory subunit 6A | 2.32e-03 | NA | 0.008 | NA |
| 7. B | O83746 | ATP-dependent zinc metalloprotease FtsH | 4.00e-03 | NA | 0.007 | NA |
| 7. B | P32795 | Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 | 6.17e-03 | NA | 0.003 | NA |
| 7. B | P75120 | ATP-dependent zinc metalloprotease FtsH | 6.43e-03 | NA | 0.002 | NA |
| 7. B | B5X3X5 | Katanin p60 ATPase-containing subunit A1 | 2.72e-03 | NA | 6.44e-05 | NA |
| 7. B | Q60AK1 | ATP-dependent zinc metalloprotease FtsH | 2.55e-03 | NA | 0.001 | NA |
| 7. B | O22025 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 4.57e-06 | NA | 0.016 | NA |
| 7. B | P24517 | DNA repair protein RadA | 1.08e-03 | NA | 0.001 | NA |
| 7. B | C7M0M0 | ATP-dependent zinc metalloprotease FtsH | 5.02e-03 | NA | 0.004 | NA |
| 7. B | O88967 | ATP-dependent zinc metalloprotease YME1L1 | 4.98e-03 | NA | 0.003 | NA |
| 7. B | Q8SSJ5 | Cell division control protein 48 | 4.94e-03 | NA | 0.029 | NA |
| 7. B | Q9PUL2 | Katanin p60 ATPase-containing subunit A1 (Fragment) | 8.43e-03 | NA | 6.61e-04 | NA |
| 7. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 2.09e-03 | NA | 0.047 | NA |
| 7. B | Q5HHB0 | Chaperone protein ClpB | 3.94e-04 | NA | 0.013 | NA |
| 7. B | Q67LC0 | ATP-dependent zinc metalloprotease FtsH 1 | 1.97e-03 | NA | 0.027 | NA |
| 7. B | A4XIX0 | ATP-dependent protease ATPase subunit HslU | 2.55e-02 | NA | 0.043 | NA |
| 7. B | Q7V2A3 | Chaperone protein ClpB | 2.89e-04 | NA | 0.046 | NA |
| 7. B | O75449 | Katanin p60 ATPase-containing subunit A1 | 4.22e-03 | NA | 0.007 | NA |
| 7. B | P54813 | ATP-dependent zinc metalloprotease YME1 homolog | 1.96e-03 | NA | 0.002 | NA |
| 7. B | D1CDT8 | ATP-dependent zinc metalloprotease FtsH | 5.47e-03 | NA | 0.005 | NA |
| 7. B | A0L4S0 | ATP-dependent zinc metalloprotease FtsH | 3.89e-03 | NA | 0.015 | NA |
| 7. B | Q67T82 | ATP-dependent zinc metalloprotease FtsH 2 | 2.45e-03 | NA | 0.043 | NA |
| 7. B | O28972 | Cell division cycle protein 48 homolog AF_1297 | 6.60e-03 | NA | 0.014 | NA |
| 7. B | Q9HJ89 | Archaeal Lon protease | 4.09e-04 | NA | 1.40e-19 | NA |
| 7. B | Q58812 | Archaeal Lon protease | 1.35e-04 | NA | 3.09e-16 | NA |
| 7. B | O80860 | ATP-dependent zinc metalloprotease FTSH 2, chloroplastic | 3.51e-03 | NA | 0.037 | NA |
| 7. B | Q60649 | Caseinolytic peptidase B protein homolog | 1.15e-02 | NA | 0.042 | NA |
| 7. B | Q8U1S1 | Putative adenylate kinase | 5.27e-01 | NA | 0.040 | NA |
| 7. B | Q9PKZ8 | Holliday junction ATP-dependent DNA helicase RuvB | 1.18e-03 | NA | 5.79e-04 | NA |
| 7. B | Q99VB5 | Chaperone protein ClpB | 2.98e-04 | NA | 0.012 | NA |
| 7. B | Q04Q03 | ATP-dependent zinc metalloprotease FtsH | 7.84e-03 | NA | 0.013 | NA |
| 7. B | P63343 | ATP-dependent zinc metalloprotease FtsH | 2.72e-03 | NA | 0.039 | NA |
| 7. B | Q4R407 | Katanin p60 ATPase-containing subunit A1 | 3.16e-03 | NA | 0.007 | NA |
| 7. B | P74361 | Chaperone protein ClpB 2 | 1.46e-04 | NA | 0.002 | NA |
| 7. B | Q8W585 | ATP-dependent zinc metalloprotease FTSH 8, chloroplastic | 5.15e-03 | NA | 0.032 | NA |
| 7. B | P62335 | 26S proteasome regulatory subunit 10B | 2.11e-03 | NA | 0.021 | NA |
| 7. B | Q7A6G6 | Chaperone protein ClpB | 4.11e-04 | NA | 0.012 | NA |
| 7. B | O74445 | Probable 26S proteasome subunit rpt4 | 1.61e-03 | NA | 0.002 | NA |
| 7. B | Q6GX84 | Fidgetin-like protein 1 | 2.93e-02 | NA | 0.027 | NA |
| 7. B | Q8LQJ8 | ATP-dependent zinc metalloprotease FTSH 5, mitochondrial | 3.63e-03 | NA | 0.001 | NA |
| 7. B | Q0W037 | Replication factor C small subunit | 2.24e-04 | NA | 4.36e-04 | NA |