Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54765.1

JCVISYN3A_0401

Uncharacterized peptidase.
M. mycoides homolog: Q6MTE9.
TIGRfam Classification: 2=Generic.
Category: Nonessential.

Statistics

Total GO Annotation: 172
Unique PROST Go: 79
Unique BLAST Go: 1
Unique Foldseek Go: 44

Total Homologs: 265
Unique PROST Homologs: 43
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 171

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: ABC transporter, ATP-binding and permease protein Abc
Antczak et al. [3]: Transmembrane peptidase, C39 family
Zhang et al. [4]: GO:0042626|ATPase activity, coupled to transmembrane movement of substances
Bianchi et al. [5]: "Transporter, transmembrane peptidase"

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P68579 (SPbeta prophage-derived sublancin-168-processing and transport ATP-binding protein SunT) with a FATCAT P-Value: 0 and RMSD of 2.72 angstrom. The sequence alignment identity is 26.8%.
Structural alignment shown in left. Query protein AVX54765.1 colored as red in alignment, homolog P68579 colored as blue. Query protein AVX54765.1 is also shown in right top, homolog P68579 showed in right bottom. They are colored based on secondary structures.

  AVX54765.1 MIFIKLIKQT-QYN--DCSIACIAMIINYYYNQNYDLDRLKLEINYVEEMLSFYDISNICSKYFLTCKALQI-END----LEQINKKV-YLAQVV--NQT 89
      P68579 MNKKKKYVHTKQFNSHDCGLACISSILK-FHNLNYGIDFL-LDLIGDKEGYSLRDLIVIFKKMGIKTRPLELQENKTFEALKQI--KLPCIA-LLEGEEY 95

  AVX54765.1 GLLHFVVV-EKQNNHLIIYDPLKTKKQKFT-YK--DFYQIFTGYIL-IFNSNY--K----KFKANYNNLF--TLFDSFYLAYLFYIIL-NIFSILLTI-- 173
      P68579 G--HYITIYEIRNNYLLVSDP---DKDKITKIKKEDFESKFTNFILEIDKESIPEKEKDQK-KHSY--FFKDILFRN-KL-IVFVILLTSLFVVGLAVAG 185

  AVX54765.1 -LEMRFLYVYSLSI-TNLNNSYF-LYLYFLAIFIIN-IFLNEISKFLLNKYYQKNKSKKLETFYYYLVEKNIKLDIINTY---SEIEFISSYQ--TYV-- 262
      P68579 SFYIKFL-V-DLIIPRSLRESLITITLIFISMVLIRCIF-DFVRSYLIIKLSYK-VDKEMSNVYF---NKVTKLP-INFFENREDGEVISRFNDGIYIKD 277

  AVX54765.1 --LLNTISAVINSLVI--LFVIFY-INKTIFLVLFVFDLFWLVISFI-YNFF-----TNQ----NKTNNQNLNLITHLLNKTKLID-KKTS--LE---L- 340
      P68579 FFSANFVTAIIDIILILGLGVILYRTNNILFLTI-ILPI--LLLSCLAILFFDHLKKKNQKLMEDKAKSTSL-LINFLKNMTTVYSLNKTSFFLEKFHLT 373

  AVX54765.1 IKKDLNKT--------QTDYLH-ILFNFFEKISLLVIYYISWDLLKFNYIEFSILLIIVLFKAIHT------NDLKKLVYF---LQNFN----KYKQLLI 418
      P68579 YDKQLNSTFSVAKAVISNEILKGLIQNSF---TIIILWVGTRQVL--N--D-SMSLGTLLF--INTLAAFLLSSLDRILSMQSDLQQAHVASIRFFDVV- 462

  AVX54765.1 KFNNFKL---AN-NYIELEQINNIQIRNLLTNL----------DIN--LDQKINYL-SNEYDL-K-TFIK--TK--NSNDHILILINKINLKDISTF--- 492
      P68579 ---NYPVQQDSNENLTELDFIQNIKTVNL--NIGADPMRYIVEDINLILDRKDKVLIIGESGTGKSTFAKSLSKLYKVPDKSIYL-N--GL-DINRYDHL 553

  AVX54765.1 SLNKHFIHLD-N--LEIKYSTILQNI----IINQSDL-N--IFT--HKIIKDLINKYQINLTKI-INLETITKLETEFIK-LL---RIFYLDHHYLLFN- 574
      P68579 SIRKRIVYIDENPFL-FK-GTIKENLCMGEIFDQNEIENACIMSQCHEFICNLDKQYSYKLSENGSNLSTGQKQRLALARAILHQPQVLILDES--LSNI 649

  AVX54765.1 --DN----FEIINKTDISLVLKLFTSYSNSSLIITSND---IKYN--LISKD---------------- 615
      P68579 DPDNTKLIYETLHRMD-CLI-----------ILITHNDPSNFKYNKKLVFRNNRIIESSYSENKEYSI 705

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0008234	cysteine-type peptidase activity
1. PBF	GO:0043214	ABC-type bacteriocin transporter activity
1. PBF	GO:0055085	transmembrane transport
1. PBF	GO:0015031	protein transport
1. PBF	GO:0016021	integral component of membrane
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0034040	ATPase-coupled lipid transmembrane transporter activity
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0017000	antibiotic biosynthetic process
1. PBF	GO:0042626	ATPase-coupled transmembrane transporter activity
1. PBF	GO:0043213	bacteriocin transport
1. PBF	GO:0030420	establishment of competence for transformation
2. PF	GO:0140466	iron-sulfur cluster export from the mitochondrion
2. PF	GO:0044179	hemolysis in another organism
2. PF	GO:0015440	ABC-type peptide transporter activity
2. PF	GO:0042824	MHC class I peptide loading complex
2. PF	GO:0006778	porphyrin-containing compound metabolic process
2. PF	GO:0019534	toxin transmembrane transporter activity
2. PF	GO:0015462	ABC-type protein transporter activity
2. PF	GO:0071996	glutathione transmembrane import into vacuole
2. PF	GO:0015433	ABC-type peptide antigen transporter activity
2. PF	GO:0140603	obsolete ATP hydrolysis activity
2. PF	GO:0008233	peptidase activity
2. PF	GO:0031901	early endosome membrane
2. PF	GO:0019885	antigen processing and presentation of endogenous peptide antigen via MHC class I
2. PF	GO:0042825	TAP complex
2. PF	GO:0030256	type I protein secretion system complex
2. PF	GO:0035351	heme transmembrane transport
2. PF	GO:0032940	secretion by cell
2. PF	GO:0042168	heme metabolic process
2. PF	GO:0036020	endolysosome membrane
2. PF	GO:0030253	protein secretion by the type I secretion system
2. PF	GO:0071627	integral component of fungal-type vacuolar membrane
2. PF	GO:0015833	peptide transport
2. PF	GO:0006879	cellular iron ion homeostasis
2. PF	GO:0044604	ABC-type phytochelatin transporter activity
2. PF	GO:0046979	TAP2 binding
2. PF	GO:0046978	TAP1 binding
2. PF	GO:0034775	glutathione transmembrane transport
2. PF	GO:0015437	lipopolysaccharide floppase activity
2. PF	GO:0015772	oligosaccharide transport
2. PF	GO:0036246	phytochelatin 2 import into vacuole
2. PF	GO:0098849	cellular detoxification of cadmium ion
2. PF	GO:0140359	ABC-type transporter activity
2. PF	GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
2. PF	GO:0042287	MHC protein binding
2. PF	GO:0006508	proteolysis
2. PF	GO:0036249	cadmium ion import into vacuole
5. P	GO:0033162	melanosome membrane
5. P	GO:0031307	integral component of mitochondrial outer membrane
5. P	GO:0071585	detoxification of cadmium ion
5. P	GO:0002237	response to molecule of bacterial origin
5. P	GO:0015886	heme transport
5. P	GO:0005777	peroxisome
5. P	GO:0033228	cysteine export across plasma membrane
5. P	GO:0043231	intracellular membrane-bounded organelle
5. P	GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane
5. P	GO:0005774	vacuolar membrane
5. P	GO:0015889	cobalamin transport
5. P	GO:0015607	ABC-type fatty-acyl-CoA transporter activity
5. P	GO:0042803	protein homodimerization activity
5. P	GO:0070453	regulation of heme biosynthetic process
5. P	GO:0046967	cytosol to endoplasmic reticulum transport
5. P	GO:0042270	protection from natural killer cell mediated cytotoxicity
5. P	GO:0033214	siderophore-dependent iron import into cell
5. P	GO:0043531	ADP binding
5. P	GO:0075139	response to host iron concentration
5. P	GO:0052572	response to host immune response
5. P	GO:0015439	ABC-type heme transporter activity
5. P	GO:0033013	tetrapyrrole metabolic process
5. P	GO:0034451	centriolar satellite
5. P	GO:0005741	mitochondrial outer membrane
5. P	GO:0015421	ABC-type oligopeptide transporter activity
5. P	GO:0015343	siderophore transmembrane transporter activity
5. P	GO:0005778	peroxisomal membrane
5. P	GO:0032000	positive regulation of fatty acid beta-oxidation
5. P	GO:0042288	MHC class I protein binding
5. P	GO:0015562	efflux transmembrane transporter activity
5. P	GO:0043588	skin development
5. P	GO:0043217	myelin maintenance
5. P	GO:0047617	acyl-CoA hydrolase activity
5. P	GO:0005779	integral component of peroxisomal membrane
5. P	GO:1903427	negative regulation of reactive oxygen species biosynthetic process
5. P	GO:2001280	positive regulation of unsaturated fatty acid biosynthetic process
5. P	GO:1900016	negative regulation of cytokine production involved in inflammatory response
5. P	GO:0006635	fatty acid beta-oxidation
5. P	GO:0014070	response to organic cyclic compound
5. P	GO:1990830	cellular response to leukemia inhibitory factor
5. P	GO:0002591	positive regulation of antigen processing and presentation of peptide antigen via MHC class I
5. P	GO:0006518	peptide metabolic process
5. P	GO:0005782	peroxisomal matrix
5. P	GO:0015910	long-chain fatty acid import into peroxisome
5. P	GO:1902497	iron-sulfur cluster transmembrane transport
5. P	GO:0002250	adaptive immune response
5. P	GO:0046980	tapasin binding
5. P	GO:0002489	antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
5. P	GO:0070574	cadmium ion transmembrane transport
5. P	GO:0000038	very long-chain fatty acid metabolic process
5. P	GO:0045454	cell redox homeostasis
5. P	GO:0005765	lysosomal membrane
5. P	GO:0007031	peroxisome organization
5. P	GO:1903232	melanosome assembly
5. P	GO:0015916	fatty-acyl-CoA transport
5. P	GO:0006878	cellular copper ion homeostasis
5. P	GO:0071995	phytochelatin import into vacuole
5. P	GO:0043190	ATP-binding cassette (ABC) transporter complex
5. P	GO:0006779	porphyrin-containing compound biosynthetic process
5. P	GO:0042758	long-chain fatty acid catabolic process
5. P	GO:0023029	MHC class Ib protein binding
5. P	GO:0002481	antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
5. P	GO:0032585	multivesicular body membrane
5. P	GO:0005324	long-chain fatty acid transporter activity
5. P	GO:1990535	neuron projection maintenance
5. P	GO:0001916	positive regulation of T cell mediated cytotoxicity
5. P	GO:1904680	peptide transmembrane transporter activity
5. P	GO:0042605	peptide antigen binding
5. P	GO:0002485	antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
5. P	GO:0042760	very long-chain fatty acid catabolic process
5. P	GO:0046968	peptide antigen transport
5. P	GO:0044847	iron acquisition from host
5. P	GO:0030670	phagocytic vesicle membrane
5. P	GO:0005789	endoplasmic reticulum membrane
5. P	GO:0005740	mitochondrial envelope
5. P	GO:0009235	cobalamin metabolic process
5. P	GO:0043621	protein self-association
5. P	GO:0030176	integral component of endoplasmic reticulum membrane
5. P	GO:0046906	tetrapyrrole binding
6. F	GO:0015441	ABC-type beta-glucan transporter activity
6. F	GO:0015108	chloride transmembrane transporter activity
6. F	GO:0043158	heterocyst differentiation
6. F	GO:0140481	ABC-type iron-sulfur cluster transporter activity
6. F	GO:0046903	secretion
6. F	GO:1902476	chloride transmembrane transport
6. F	GO:0050891	multicellular organismal water homeostasis
6. F	GO:0015106	bicarbonate transmembrane transporter activity
6. F	GO:0106138	Sec61 translocon complex binding
6. F	GO:0010312	detoxification of zinc ion
6. F	GO:0005260	intracellularly ATP-gated chloride channel activity
6. F	GO:0120189	positive regulation of bile acid secretion
6. F	GO:0055038	recycling endosome membrane
6. F	GO:0042883	cysteine transport
6. F	GO:0033285	ATPase-coupled monocarboxylic acid transmembrane transporter activity
6. F	GO:1904251	regulation of bile acid metabolic process
6. F	GO:0015432	ABC-type bile acid transporter activity
6. F	GO:0060081	membrane hyperpolarization
6. F	GO:0070455	positive regulation of heme biosynthetic process
6. F	GO:0071320	cellular response to cAMP
6. F	GO:0046872	metal ion binding
6. F	GO:0035377	transepithelial water transport
6. F	GO:0034707	chloride channel complex
6. F	GO:0048240	sperm capacitation
6. F	GO:1902943	positive regulation of voltage-gated chloride channel activity
6. F	GO:0005743	mitochondrial inner membrane
6. F	GO:0046581	intercellular canaliculus
6. F	GO:0008559	ABC-type xenobiotic transporter activity
6. F	GO:0005254	chloride channel activity
6. F	GO:0031998	regulation of fatty acid beta-oxidation
6. F	GO:0051454	intracellular pH elevation
6. F	GO:1902161	positive regulation of cyclic nucleotide-gated ion channel activity
6. F	GO:0015722	canalicular bile acid transport
6. F	GO:0000770	peptide pheromone export
6. F	GO:0046618	xenobiotic export
6. F	GO:0015126	canalicular bile acid transmembrane transporter activity
6. F	GO:0016226	iron-sulfur cluster assembly
6. F	GO:0019869	chloride channel inhibitor activity
6. F	GO:0008281	sulfonylurea receptor activity
6. F	GO:0046691	intracellular canaliculus
6. F	GO:1904322	cellular response to forskolin
6. F	GO:0015701	bicarbonate transport
6. F	GO:0006811	ion transport
6. F	GO:0055072	iron ion homeostasis
7. B	GO:0033644	host cell membrane

Uniprot GO Annotations

GO	Description
GO:0016021	integral component of membrane
GO:0008233	peptidase activity
GO:0016020	membrane
GO:0005524	ATP binding
GO:0006508	proteolysis

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	P37608	Lacticin-481/lactococcin-DR transport/processing ATP-binding protein lcnDR3	6.18e-13	1.21e-42	0.021	0.653
1. PBF	Q9EXN5	Probable microcin-H47 secretion/processing ATP-binding protein MchF	8.91e-12	2.42e-37	9.26e-06	0.7264
1. PBF	P59852	Lactococcin-G-processing and transport ATP-binding protein LagD	5.04e-14	3.73e-37	4.32e-08	0.653
1. PBF	P59653	Transport/processing ATP-binding protein ComA	1.05e-14	9.06e-34	0.009	0.6661
1. PBF	Q10418	Mesentericin-Y105 transport/processing ATP-binding protein MesD	1.40e-14	1.24e-37	2.72e-04	0.7115
1. PBF	P68579	SPbeta prophage-derived sublancin-168-processing and transport ATP-binding protein SunT	0.00e+00	6.71e-44	0.002	0.6238
1. PBF	Q03727	Transport/processing ATP-binding protein ComA	0.00e+00	3.61e-34	0.009	0.6537
1. PBF	Q49430	Putative ABC transporter ATP-binding MG390	5.77e-15	1.41e-48	2.36e-06	0.716
1. PBF	P75207	Putative ABC transporter ATP-binding MG390 homolog	1.11e-16	2.11e-48	2.29e-07	0.6962
1. PBF	P22520	Colicin V secretion/processing ATP-binding protein CvaB	4.46e-13	3.91e-37	2.11e-05	0.7008
2. PF	Q93FH6	Leukotoxin translocation ATP-binding protein LktB	8.53e-12	2.39e-18	NA	0.5236
2. PF	Q04473	Toxin RTX-III translocation ATP-binding protein	4.86e-13	7.54e-19	NA	0.5244
2. PF	P16532	Leukotoxin translocation ATP-binding protein LktB	9.16e-12	3.58e-18	NA	0.5312
2. PF	Q4HVU7	Iron-sulfur clusters transporter ATM1, mitochondrial	1.13e-08	2.46e-02	NA	0.548
2. PF	Q9RCG7	Exotoxin translocation ATP-binding protein PaxB	8.20e-12	4.53e-21	NA	0.5289
2. PF	Q933I3	Leukotoxin translocation ATP-binding protein LktB	7.80e-12	8.85e-19	NA	0.5185
2. PF	Q7VWD8	ATP-dependent lipid A-core flippase	7.49e-09	3.81e-02	NA	0.5919
2. PF	Q93FH3	Leukotoxin translocation ATP-binding protein LktB	9.61e-12	1.54e-18	NA	0.5189
2. PF	Q00564	Lactococcin-A transport/processing ATP-binding protein LcnC	2.11e-15	1.34e-38	NA	0.6837
2. PF	Q47258	Alpha-hemolysin translocation ATP-binding protein HlyB	9.52e-12	1.00e-18	NA	0.5264
2. PF	Q93FH0	Leukotoxin translocation ATP-binding protein LktB	7.23e-12	1.68e-18	NA	0.5215
2. PF	Q8FDZ8	Alpha-hemolysin translocation ATP-binding protein HlyB	8.86e-12	1.31e-18	NA	0.5098
2. PF	P23702	Leukotoxin export ATP-binding protein LtxB	7.42e-12	2.19e-15	NA	0.5061
2. PF	Q933E0	Leukotoxin translocation ATP-binding protein LktB	8.57e-12	9.85e-19	NA	0.5161
2. PF	P0DKX6	Cyclolysin secretion/processing ATP-binding protein CyaB	1.41e-13	1.19e-21	NA	0.5041
2. PF	Q7W9N7	ATP-dependent lipid A-core flippase	2.96e-11	3.63e-02	NA	0.5879
2. PF	Q9CJB8	Lactococcin transport/processing ATP-binding protein LcnC-like	9.99e-16	2.94e-37	NA	0.7082
2. PF	Q28433	Antigen peptide transporter 1	4.61e-07	7.79e-05	NA	0.5326
2. PF	P0C086	Leukotoxin translocation ATP-binding protein LktB	9.38e-12	1.33e-18	NA	0.5196
2. PF	Q4WLN7	Iron-sulfur clusters transporter atm1, mitochondrial	5.98e-07	2.97e-02	NA	0.5653
2. PF	G7CBF5	Mycobactin import ATP-binding/permease protein IrtA	9.41e-06	1.67e-02	NA	0.5615
2. PF	Q0P9C4	Protein glycosylation K	2.44e-09	2.29e-03	NA	0.5133
2. PF	A0A125QXJ1	ATP-binding cassette sub-family B member 6	6.47e-07	2.19e-02	NA	0.5134
2. PF	P26760	Toxin RTX-I translocation ATP-binding protein	7.19e-12	1.09e-20	NA	0.5031
2. PF	P36497	Pediocin PA-1 transport/processing ATP-binding protein PedD	2.33e-15	1.45e-36	NA	0.7193
2. PF	P9WQI8	Hydrophilic compounds import ATP-binding/permease protein BacA	6.55e-08	1.23e-03	NA	0.4546
2. PF	P10089	Alpha-hemolysin translocation ATP-binding protein HlyB	1.55e-11	4.33e-19	NA	0.5176
2. PF	P55122	Leukotoxin translocation ATP-binding protein LktB	7.16e-12	4.33e-20	NA	0.514
2. PF	P9WQJ8	Mycobactin import ATP-binding/permease protein IrtA	2.94e-06	1.18e-02	NA	0.5629
2. PF	A0R6H8	Mycobactin import ATP-binding/permease protein IrtA	2.13e-06	4.73e-03	NA	0.5262
2. PF	Q7WH20	ATP-dependent lipid A-core flippase	8.37e-09	3.63e-02	NA	0.5967
2. PF	P0DKX5	Cyclolysin secretion/processing ATP-binding protein CyaB	4.88e-15	2.53e-21	NA	0.5076
2. PF	P0C087	Leukotoxin translocation ATP-binding protein LktB	6.76e-12	1.33e-18	NA	0.5178
2. PF	P11599	Alpha-hemolysin translocation ATP-binding protein HlyB	7.18e-13	6.95e-21	NA	0.5073
2. PF	Q93FG6	Leukotoxin translocation ATP-binding protein LktB	1.21e-11	1.33e-18	NA	0.515
2. PF	Q2UPC0	ABC transporter aclQ	9.86e-08	8.06e-05	NA	0.5497
2. PF	P08716	Alpha-hemolysin translocation ATP-binding protein HlyB	1.01e-11	1.59e-18	NA	0.519
2. PF	P63392	Mycobactin import ATP-binding/permease protein IrtA	2.81e-06	1.18e-02	NA	0.5673
2. PF	Q46717	Alpha-hemolysin translocation ATP-binding protein HlyB	5.60e-11	6.16e-17	NA	0.5295
2. PF	Q93FH2	Leukotoxin translocation ATP-binding protein LktB	1.01e-11	1.46e-18	NA	0.5088
4. PB	P68580	Sublancin-168-processing and transport ATP-binding protein sunT	NA	6.71e-44	0.002	NA
5. P	Q6C6N0	Iron-sulfur clusters transporter ATM1, mitochondrial	1.14e-07	1.95e-02	NA	NA
5. P	P36372	Antigen peptide transporter 2	7.53e-09	1.61e-04	NA	NA
5. P	O07549	Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH	1.08e-05	2.25e-07	NA	NA
5. P	Q9NP58	ATP-binding cassette sub-family B member 6	8.28e-07	2.06e-02	NA	NA
5. P	P55096	ATP-binding cassette sub-family D member 3	4.61e-07	1.74e-04	NA	NA
5. P	P9WQJ9	Mycobactin import ATP-binding/permease protein IrtA	1.56e-06	1.18e-02	NA	NA
5. P	Q03519	Antigen peptide transporter 2	5.38e-09	7.00e-03	NA	NA
5. P	P23886	ATP-binding/permease protein CydC	3.06e-08	1.40e-02	NA	NA
5. P	P45221	Uncharacterized ABC transporter ATP-binding protein HI_1467	9.33e-08	1.91e-05	NA	NA
5. P	Q57335	Uncharacterized ABC transporter ATP-binding protein HI_0036	2.96e-10	1.24e-05	NA	NA
5. P	O14678	Lysosomal cobalamin transporter ABCD4	3.93e-07	4.33e-05	NA	NA
5. P	Q9QYJ4	ABC-type oligopeptide transporter ABCB9	4.56e-08	5.98e-04	NA	NA
5. P	O70595	ATP-binding cassette sub-family B member 6	6.05e-07	1.18e-02	NA	NA
5. P	P41909	Peroxisomal long-chain fatty acid import protein 2	2.22e-06	2.85e-03	NA	NA
5. P	Q02592	Heavy metal tolerance protein	1.83e-07	2.52e-05	NA	NA
5. P	Q9JJ59	ABC-type oligopeptide transporter ABCB9	1.63e-07	5.15e-04	NA	NA
5. P	Q57538	Probable ABC transporter ATP-binding/permease protein HI_0664	5.39e-09	2.97e-02	NA	NA
5. P	Q03518	Antigen peptide transporter 1	3.04e-07	4.11e-03	NA	NA
5. P	P97998	ATP-dependent permease MDL1	1.07e-07	8.38e-03	NA	NA
5. P	Q6NLC1	ABC transporter D family member 2, chloroplastic	1.85e-07	3.30e-02	NA	NA
5. P	P40416	Iron-sulfur clusters transporter ATM1, mitochondrial	1.93e-08	3.84e-02	NA	NA
5. P	Q08D64	ATP-binding cassette sub-family B member 6	9.80e-07	8.06e-04	NA	NA
5. P	Q7JUN3	ATP-binding cassette sub-family D member	4.04e-07	9.16e-06	NA	NA
5. P	P21958	Antigen peptide transporter 1	2.20e-07	1.88e-06	NA	NA
5. P	P16970	ATP-binding cassette sub-family D member 3	1.40e-06	3.61e-04	NA	NA
5. P	Q9NP78	ABC-type oligopeptide transporter ABCB9	4.08e-07	5.92e-04	NA	NA
5. P	Q9UBJ2	ATP-binding cassette sub-family D member 2	9.34e-07	1.78e-02	NA	NA
5. P	Q54RU1	ABC transporter B family member 6	2.29e-07	1.34e-03	NA	NA
5. P	Q54W19	ABC transporter D family member 1	3.09e-06	1.96e-03	NA	NA
5. P	Q55774	Uncharacterized ABC transporter ATP-binding protein sll0182	1.86e-07	6.36e-05	NA	NA
5. P	G5EFD4	Heavy metal tolerance factor 1	6.95e-07	1.66e-03	NA	NA
5. P	P45081	ATP-binding/permease protein CydC	5.86e-09	2.21e-02	NA	NA
5. P	O89016	Lysosomal cobalamin transporter ABCD4	4.38e-08	5.31e-05	NA	NA
5. P	Q9X2W0	Microcin-J25 export ATP-binding/permease protein McjD	1.61e-14	4.51e-02	NA	NA
5. P	Q9QY44	ATP-binding cassette sub-family D member 2	3.40e-06	2.39e-02	NA	NA
5. P	P31826	Inner membrane ABC transporter ATP-binding protein YddA	8.34e-13	1.24e-06	NA	NA
5. P	P28288	ATP-binding cassette sub-family D member 3	2.34e-07	3.77e-04	NA	NA
5. P	P36370	Antigen peptide transporter 1	2.09e-07	6.08e-05	NA	NA
5. P	P9WQI9	Hydrophilic compounds import ATP-binding/permease protein BacA	4.82e-08	1.23e-03	NA	NA
5. P	Q8T8P3	ABC transporter D family member 2	1.84e-07	5.92e-04	NA	NA
5. P	P36371	Antigen peptide transporter 2	2.09e-07	2.44e-03	NA	NA
5. P	Q61285	ATP-binding cassette sub-family D member 2	3.73e-06	3.06e-02	NA	NA
5. P	Q54W20	ABC transporter D family member 3	2.38e-06	7.45e-05	NA	NA
6. F	P35598	Putative ABC transporter ATP-binding protein exp8	3.14e-09	NA	NA	0.5357
6. F	Q5NIG3	ATP-dependent lipid A-core flippase	1.62e-09	NA	NA	0.4876
6. F	Q71ED1	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.16e-09	NA	NA	0.6088
6. F	Q6G868	Putative multidrug export ATP-binding/permease protein SAS1788	6.99e-10	NA	NA	0.563
6. F	Q5HEQ8	Putative multidrug export ATP-binding/permease protein SACOL1924	1.12e-09	NA	NA	0.5319
6. F	Q2FFM9	Putative multidrug export ATP-binding/permease protein SAUSA300_1847	6.66e-10	NA	NA	0.5725
6. F	A0A059JJ46	ABC multidrug transporter MDR2	4.73e-05	NA	NA	0.3803
6. F	Q8EDF0	ATP-dependent lipid A-core flippase	1.16e-08	NA	NA	0.4742
6. F	Q13BH6	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.20e-08	NA	NA	0.5785
6. F	Q2J0F4	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.03e-08	NA	NA	0.5932
6. F	Q9KQW9	ATP-dependent lipid A-core flippase	6.82e-08	NA	NA	0.476
6. F	Q21NS8	ATP-dependent lipid A-core flippase	2.31e-08	NA	NA	0.4943
6. F	Q8D2U8	ATP-dependent lipid A-core flippase	1.38e-11	NA	NA	0.5609
6. F	Q0HTS8	ATP-dependent lipid A-core flippase	1.11e-08	NA	NA	0.4698
6. F	Q20Z38	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	9.63e-09	NA	NA	0.579
6. F	Q9JW59	ATP-dependent lipid A-core flippase	4.17e-11	NA	NA	0.5268
6. F	O31708	Uncharacterized ABC transporter ATP-binding protein YknV	1.36e-07	NA	NA	0.5221
6. F	Q8PKS5	ATP-dependent lipid A-core flippase	4.54e-09	NA	NA	0.5549
6. F	Q7NZU6	ATP-dependent lipid A-core flippase	8.98e-12	NA	NA	0.5767
6. F	Q8XXB6	ATP-dependent lipid A-core flippase	5.86e-09	NA	NA	0.525
6. F	Q8FJB1	ATP-dependent lipid A-core flippase	4.31e-08	NA	NA	0.484
6. F	Q14JW6	ATP-dependent lipid A-core flippase	1.00e-09	NA	NA	0.4911
6. F	Q1QH37	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.04e-08	NA	NA	0.5855
6. F	P63398	Fatty acid ABC transporter ATP-binding/permease protein	1.20e-07	NA	NA	0.5036
6. F	Q8YH20	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.98e-09	NA	NA	0.6061
6. F	Q5E0F2	ATP-dependent lipid A-core flippase	1.63e-08	NA	NA	0.4772
6. F	Q4WSI1	ABC multidrug transporter mdr4	1.96e-04	NA	NA	0.4356
6. F	Q2ULH4	Iron-sulfur clusters transporter atm1, mitochondrial	6.25e-07	NA	NA	0.5227
6. F	Q6F9X0	ATP-dependent lipid A-core flippase	9.47e-09	NA	NA	0.5409
6. F	P71082	Putative multidrug export ATP-binding/permease protein YgaD	6.99e-10	NA	NA	0.548
6. F	Q07E16	Cystic fibrosis transmembrane conductance regulator	2.40e-04	NA	NA	0.4154
6. F	Q03203	Nisin transport ATP-binding protein NisT	6.29e-09	NA	NA	0.5775
6. F	Q3KJ31	ATP-dependent lipid A-core flippase	1.28e-08	NA	NA	0.4987
6. F	Q89A96	Multidrug resistance-like ATP-binding protein MdlB	2.44e-10	NA	NA	0.5374
6. F	Q2YU20	Putative multidrug export ATP-binding/permease protein SAB1799c	2.92e-10	NA	NA	0.5011
6. F	Q7AKE5	ABC transporter ATP-binding protein RamB	1.20e-08	NA	NA	0.4865
6. F	Q21WN9	ATP-dependent lipid A-core flippase	7.94e-09	NA	NA	0.5878
6. F	Q6G2Z5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.42e-09	NA	NA	0.5834
6. F	Q87VF3	ATP-dependent lipid A-core flippase	1.40e-08	NA	NA	0.4924
6. F	Q8ZGA9	ATP-dependent lipid A-core flippase	1.11e-07	NA	NA	0.5576
6. F	Q5H0H0	ATP-dependent lipid A-core flippase	6.66e-09	NA	NA	0.559
6. F	Q4FS42	ATP-dependent lipid A-core flippase	2.53e-09	NA	NA	0.5084
6. F	A0A0U1LQE1	ABC transporter cctS	1.16e-04	NA	NA	0.4151
6. F	P57552	Multidrug resistance-like ATP-binding protein MdlB	1.15e-09	NA	NA	0.5284
6. F	Q12M46	ATP-dependent lipid A-core flippase	1.64e-08	NA	NA	0.4847
6. F	Q2KYS6	ATP-dependent lipid A-core flippase	2.70e-10	NA	NA	0.5922
6. F	Q142P6	ATP-dependent lipid A-core flippase	3.30e-09	NA	NA	0.538
6. F	Q1GZI0	ATP-dependent lipid A-core flippase	1.22e-09	NA	NA	0.5731
6. F	P33951	ATP-binding protein SyrD	1.13e-06	NA	NA	0.5294
6. F	Q4PH16	Iron-sulfur clusters transporter ATM1, mitochondrial	7.02e-08	NA	NA	0.5526
6. F	P97046	Multidrug resistance ABC transporter ATP-binding and permease protein	1.02e-09	NA	NA	0.5908
6. F	Q60AA3	ATP-dependent lipid A-core flippase	1.16e-08	NA	NA	0.4333
6. F	Q751N2	Iron-sulfur clusters transporter ATM1, mitochondrial	5.23e-07	NA	NA	0.5334
6. F	P57551	Multidrug resistance-like ATP-binding protein MdlA	2.14e-09	NA	NA	0.5755
6. F	P9WQJ0	Uncharacterized ABC transporter ATP-binding protein MT1311	7.07e-10	NA	NA	0.537
6. F	Q47JR8	ATP-dependent lipid A-core flippase	2.63e-09	NA	NA	0.6012
6. F	Q7ANN4	Type I secretion system ATP-binding protein PrsD	6.60e-11	NA	NA	0.5855
6. F	Q6AJW3	ATP-dependent lipid A-core flippase	3.83e-10	NA	NA	0.5686
6. F	Q7MJ07	ATP-dependent lipid A-core flippase	6.62e-08	NA	NA	0.4978
6. F	Q7N6C6	ATP-dependent lipid A-core flippase	6.19e-08	NA	NA	0.5055
6. F	P63359	ATP-dependent lipid A-core flippase	1.31e-08	NA	NA	0.5608
6. F	Q31YT6	ATP-dependent lipid A-core flippase	6.64e-07	NA	NA	0.4613
6. F	A0R6H7	Mycobactin import ATP-binding/permease protein IrtB	1.17e-08	NA	NA	0.5821
6. F	Q1CA68	ATP-dependent lipid A-core flippase	1.09e-07	NA	NA	0.5259
6. F	Q9Y8G1	ABC multidrug transporter atrD	1.81e-05	NA	NA	0.4917
6. F	Q32E34	ATP-dependent lipid A-core flippase	5.85e-07	NA	NA	0.4306
6. F	Q12C33	ATP-dependent lipid A-core flippase	4.80e-09	NA	NA	0.576
6. F	Q0TJD9	ATP-dependent lipid A-core flippase	1.49e-07	NA	NA	0.4613
6. F	P23596	Proteases secretion ATP-binding protein PrtD	2.46e-13	NA	NA	0.624
6. F	P54719	Uncharacterized ABC transporter ATP-binding protein YfiC	2.39e-08	NA	NA	0.5803
6. F	Q09427	ATP-binding cassette sub-family C member 8	5.98e-05	NA	NA	0.5029
6. F	Q47908	ATP-dependent lipid A-core flippase	1.46e-08	NA	NA	0.5015
6. F	Q89UT8	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.53e-09	NA	NA	0.5725
6. F	Q52402	Transport ATP-binding protein AarD	1.15e-08	NA	NA	0.5552
6. F	P70864	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	8.90e-09	NA	NA	0.5625
6. F	Q88D92	ATP-dependent lipid A-core flippase	1.84e-08	NA	NA	0.5006
6. F	Q31FG2	ATP-dependent lipid A-core flippase	3.59e-10	NA	NA	0.5323
6. F	Q9PEE7	ATP-dependent lipid A-core flippase	5.47e-09	NA	NA	0.5821
6. F	Q6N1Y7	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	8.55e-09	NA	NA	0.5963
6. F	Q5PGH0	ATP-dependent lipid A-core flippase	1.73e-07	NA	NA	0.5278
6. F	Q1BUV6	ATP-dependent lipid A-core flippase	8.18e-10	NA	NA	0.5437
6. F	H2LNR5	Iron-sulfur clusters transporter ABCB7, mitochondrial	1.27e-07	NA	NA	0.5391
6. F	Q2HIE9	Iron-sulfur clusters transporter ATM1, mitochondrial	2.14e-07	NA	NA	0.4937
6. F	O07550	Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI	4.92e-14	NA	NA	0.5774
6. F	Q2SIN5	ATP-dependent lipid A-core flippase	2.86e-08	NA	NA	0.5353
6. F	Q3IGX5	ATP-dependent lipid A-core flippase	4.37e-09	NA	NA	0.4916
6. F	Q5ZUH9	ATP-dependent lipid A-core flippase	7.16e-09	NA	NA	0.5796
6. F	P13568	Multidrug resistance protein	5.57e-05	NA	NA	0.4485
6. F	Q5WVN2	ATP-dependent lipid A-core flippase	9.10e-09	NA	NA	0.5577
6. F	Q7RX59	Iron-sulfur clusters transporter atm1, mitochondrial	2.42e-08	NA	NA	0.5326
6. F	Q9WYC4	Uncharacterized ABC transporter ATP-binding protein TM_0288	3.76e-08	NA	NA	0.5468
6. F	B8K1W2	Bile salt export pump	3.65e-05	NA	NA	0.4629
6. F	Q6GFJ1	Putative multidrug export ATP-binding/permease protein SAR1956	1.24e-09	NA	NA	0.5393
6. F	Q46Y89	ATP-dependent lipid A-core flippase	9.69e-10	NA	NA	0.527
6. F	Q7VR44	ATP-dependent lipid A-core flippase	5.98e-09	NA	NA	0.5464
6. F	Q4KJB2	ATP-dependent lipid A-core flippase	1.57e-08	NA	NA	0.4951
6. F	P54718	Uncharacterized ABC transporter ATP-binding protein YfiB	2.83e-08	NA	NA	0.4746
6. F	Q2G506	ATM1-type heavy metal exporter	3.10e-08	NA	NA	0.5352
6. F	Q6BXD7	Iron-sulfur clusters transporter ATM1, mitochondrial	2.88e-08	NA	NA	0.5468
6. F	Q1LQD3	ATP-dependent lipid A-core flippase	1.83e-09	NA	NA	0.5627
6. F	Q03024	Alkaline protease secretion ATP-binding protein AprD	2.54e-11	NA	NA	0.5772
6. F	P9WQJ2	Fatty acid ABC transporter ATP-binding/permease protein	2.90e-08	NA	NA	0.497
6. F	P18767	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.79e-09	NA	NA	0.6239
6. F	Q492S9	ATP-dependent lipid A-core flippase	7.40e-08	NA	NA	0.5468
6. F	P53706	Alpha-factor-transporting ATPase	1.28e-04	NA	NA	0.5276
6. F	P94367	ATP-binding/permease protein CydD	3.65e-09	NA	NA	0.5379
6. F	P45861	Uncharacterized ABC transporter ATP-binding protein YwjA	6.85e-11	NA	NA	0.5402
6. F	Q9CMG7	ATP-dependent lipid A-core flippase	5.94e-08	NA	NA	0.5478
6. F	Q1RDU4	ATP-dependent lipid A-core flippase	2.01e-08	NA	NA	0.4673
6. F	Q9ZNB0	Uncharacterized ABC transporter ATP-binding protein SCO0742	7.21e-11	NA	NA	0.5839
6. F	Q1RJ91	Putative export ATP-binding/permease protein RBE_0492	7.32e-09	NA	NA	0.5147
6. F	Q2YQ73	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	6.14e-09	NA	NA	0.5594
6. F	Q2LVL0	ATP-dependent lipid A-core flippase	1.55e-09	NA	NA	0.5338
6. F	Q50500	Uncharacterized protein MTH_1463	2.18e-05	NA	NA	0.7791
6. F	Q15UY7	ATP-dependent lipid A-core flippase	3.10e-08	NA	NA	0.5075
6. F	Q2A1U9	ATP-dependent lipid A-core flippase	1.45e-09	NA	NA	0.4947
6. F	Q8G0T8	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.94e-09	NA	NA	0.5836
6. F	Q3Z3K7	ATP-dependent lipid A-core flippase	3.01e-09	NA	NA	0.4708
6. F	P9WQJ6	Mycobactin import ATP-binding/permease protein IrtB	1.35e-09	NA	NA	0.5335
6. F	P75094	Putative ABC transporter ATP-binding protein MG015 homolog	4.38e-07	NA	NA	0.5317
6. F	Q50770	Uncharacterized protein MTBMA_c00490	1.32e-05	NA	NA	0.7834
6. F	P55469	Uncharacterized ABC transporter ATP-binding protein y4gM	1.93e-08	NA	NA	0.5253
6. F	Q89A97	Multidrug resistance-like ATP-binding protein MdlA	1.47e-11	NA	NA	0.6242
6. F	Q7VL52	ATP-dependent lipid A-core flippase	2.28e-08	NA	NA	0.5098
6. F	Q6LPK6	ATP-dependent lipid A-core flippase	1.39e-07	NA	NA	0.5205
6. F	P22638	Heterocyst differentiation ATP-binding protein HepA	3.23e-08	NA	NA	0.5456
6. F	Q1QX69	ATP-dependent lipid A-core flippase	1.29e-08	NA	NA	0.5316
6. F	Q8P8W4	ATP-dependent lipid A-core flippase	9.04e-09	NA	NA	0.5773
6. F	P71355	Uncharacterized ABC transporter ATP-binding protein HI_0663	9.43e-09	NA	NA	0.4699
6. F	P33116	Subtilin transport ATP-binding protein SpaT	6.90e-09	NA	NA	0.537
6. F	Q7A0J1	Putative multidrug export ATP-binding/permease protein MW1806	1.21e-09	NA	NA	0.5414
6. F	Q83LP0	ATP-dependent lipid A-core flippase	8.06e-08	NA	NA	0.542
6. F	Q6FZF2	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.44e-09	NA	NA	0.5828
6. F	P0CL92	Iron-sulfur clusters transporter ATM1, mitochondrial	8.06e-08	NA	NA	0.5567
6. F	Q8K985	Multidrug resistance-like ATP-binding protein MdlA	3.19e-11	NA	NA	0.6089
6. F	Q5QU36	ATP-dependent lipid A-core flippase	1.52e-08	NA	NA	0.5371
6. F	P45082	ATP-binding/permease protein CydD	1.61e-08	NA	NA	0.537
6. F	I1S2J9	ABC transporter FGM5	1.51e-04	NA	NA	0.3763
6. F	Q1MAB5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.27e-10	NA	NA	0.6217
6. F	Q2SZW0	ATP-dependent lipid A-core flippase	1.24e-10	NA	NA	0.5392
6. F	Q4UV65	ATP-dependent lipid A-core flippase	9.64e-09	NA	NA	0.5503
6. F	Q68W42	Putative export ATP-binding/permease protein RT0691	1.17e-09	NA	NA	0.5265
6. F	A1USS5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	6.57e-09	NA	NA	0.5708
6. F	Q080T2	ATP-dependent lipid A-core flippase	6.44e-10	NA	NA	0.4952
6. F	Q5F4X8	ATP-dependent lipid A-core flippase	3.15e-11	NA	NA	0.5121
6. F	O31707	Uncharacterized ABC transporter ATP-binding protein YknU	6.94e-10	NA	NA	0.5592
6. F	Q87EF0	ATP-dependent lipid A-core flippase	5.86e-09	NA	NA	0.5762
6. F	Q0I4C5	ATP-dependent lipid A-core flippase	4.59e-08	NA	NA	0.5469
6. F	Q6FIK3	Iron-sulfur clusters transporter ATM1, mitochondrial	7.14e-07	NA	NA	0.5153
6. F	P47260	Putative ABC transporter ATP-binding protein MG014	3.59e-09	NA	NA	0.4561
6. F	Q9ZCM8	Putative export ATP-binding/permease protein RP696	1.29e-08	NA	NA	0.5565
6. F	A1KF14	Multidrug efflux ATP-binding/permease protein BCG_0231	1.27e-05	NA	NA	0.5019
6. F	P0CE70	ABC transporter NFT1	1.15e-04	NA	NA	0.4627
6. F	P60753	ATP-dependent lipid A-core flippase	6.47e-07	NA	NA	0.4654
6. F	Q0BKJ3	ATP-dependent lipid A-core flippase	1.66e-09	NA	NA	0.522
6. F	Q00555	Cystic fibrosis transmembrane conductance regulator	3.05e-04	NA	NA	0.4041
6. F	Q3SP57	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.11e-08	NA	NA	0.5842
6. F	Q1CGH0	ATP-dependent lipid A-core flippase	1.13e-07	NA	NA	0.5556
6. F	Q8K984	Multidrug resistance-like ATP-binding protein MdlB	7.80e-09	NA	NA	0.5368
6. F	O06967	Multidrug resistance ABC transporter ATP-binding/permease protein BmrA	2.11e-09	NA	NA	0.5767
6. F	Q7A4T3	Putative multidrug export ATP-binding/permease protein SA1683	1.37e-09	NA	NA	0.529
6. F	P0C529	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.60e-09	NA	NA	0.5737
6. F	Q63VX7	ATP-dependent lipid A-core flippase	1.00e-10	NA	NA	0.5626
6. F	P0A4W5	Uncharacterized ABC transporter ATP-binding protein Mb1304c	4.06e-10	NA	NA	0.5305
6. F	Q07QX6	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.10e-08	NA	NA	0.5659
6. F	Q983H5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.01e-09	NA	NA	0.6569
6. F	Q4QPI4	ATP-dependent lipid A-core flippase	1.23e-09	NA	NA	0.5491
6. F	Q483B6	ATP-dependent lipid A-core flippase 1	1.77e-08	NA	NA	0.513
6. F	Q65U21	ATP-dependent lipid A-core flippase	6.39e-08	NA	NA	0.5439
6. F	P94366	ATP-binding/permease protein CydC	3.57e-09	NA	NA	0.5669
6. F	Q62IG3	ATP-dependent lipid A-core flippase	1.04e-10	NA	NA	0.5304