Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54767.1

JCVISYN3A_0403

Ribosome GTPase.
M. mycoides homolog: Q6MTE6.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 88
Unique PROST Go: 53
Unique BLAST Go: 13
Unique Foldseek Go: 2

Total Homologs: 3130
Unique PROST Homologs: 1154
Unique BLAST Homologs: 936
Unique Foldseek Homologs: 70

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: era; GTPase Era
Zhang et al. [4]: GO:0043024|ribosomal small subunit binding
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A0Q1Q0 (GTPase Era) with a FATCAT P-Value: 0 and RMSD of 1.11 angstrom. The sequence alignment identity is 42.5%.
Structural alignment shown in left. Query protein AVX54767.1 colored as red in alignment, homolog A0Q1Q0 colored as blue. Query protein AVX54767.1 is also shown in right top, homolog A0Q1Q0 showed in right bottom. They are colored based on secondary structures.

  AVX54767.1 MSNFKSGFVSIIGRPNVGKSTLLNKLIGEKISIVTNKPQTTRNNIRGILTKKDQYQIVFIDTPGVHTSKKQLDKFLNTSALKSTKDVDVILFL-APSDEV 99
      A0Q1Q0 M--FKSGFISIIGRPNVGKSTLTNEILGEKLSIVSCRPQTTRNNIRAVLT-RDDYQLVFLDTPGIHKPRHKLGEYMVKAAETSTDEVDLIVFITTPEGE- 96

  AVX54767.1 IGKND-LFL--LKQIENLDVFKILVITKADSVTKEQLILKA-NEWSSYQDQFDEIIITSSITNLNIEKLLELIVNNLSDNDYQFYDDDILTDQSDRFMIK 195
      A0Q1Q0 ISKGDELILEGLKNSKK-PVF--LVINKIDE-NPQELVAKTLKQYSEYMD-FAEIIPISARKSKNVDTLLELMIKYMPEGP-KYYPEDMITDVQERFVVS 190

  AVX54767.1 EIIRENILLK-TGQEVPHSVAVLVEHLEQNEN-----EINISCAIIVERQSQKSIIIGKNGVKISDIR-YKSKKQIQALFKKRINLELFVKVQENWRNSP 288
      A0Q1Q0 EIIREK-ALKLLSEEVPHGIAVEIISMKQSKRGTYHIDANLLC----EKDSHKGIIIGKGGQKLKTISTY-ARQDIEKFLDAKVNLKVWVKVKKEWRDSN 284

  AVX54767.1 SLIKKMGYNKDQY 301
      A0Q1Q0 FMLKELGY-KE-- 294

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0000028	ribosomal small subunit assembly
1. PBF	GO:0043022	ribosome binding
1. PBF	GO:0003723	RNA binding
1. PBF	GO:0043024	ribosomal small subunit binding
1. PBF	GO:0070181	small ribosomal subunit rRNA binding
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0003924	GTPase activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0042254	ribosome biogenesis
1. PBF	GO:0042274	ribosomal small subunit biogenesis
1. PBF	GO:0046872	metal ion binding
1. PBF	GO:0005525	GTP binding
2. PF	GO:0006412	translation
3. BF	GO:0000917	division septum assembly
3. BF	GO:0000027	ribosomal large subunit assembly
3. BF	GO:0006400	tRNA modification
4. PB	GO:0005524	ATP binding
4. PB	GO:0005615	extracellular space
4. PB	GO:0019843	rRNA binding
4. PB	GO:0005634	nucleus
5. P	GO:1904263	positive regulation of TORC1 signaling
5. P	GO:0042244	spore wall assembly
5. P	GO:0032587	ruffle membrane
5. P	GO:0071364	cellular response to epidermal growth factor stimulus
5. P	GO:0008135	translation factor activity, RNA binding
5. P	GO:0009535	chloroplast thylakoid membrane
5. P	GO:1903432	regulation of TORC1 signaling
5. P	GO:0042601	endospore-forming forespore
5. P	GO:1903778	protein localization to vacuolar membrane
5. P	GO:0030864	cortical actin cytoskeleton
5. P	GO:0005853	eukaryotic translation elongation factor 1 complex
5. P	GO:0070590	spore wall biogenesis
5. P	GO:1900425	negative regulation of defense response to bacterium
5. P	GO:0006414	translational elongation
5. P	GO:0004781	sulfate adenylyltransferase (ATP) activity
5. P	GO:0045903	positive regulation of translational fidelity
5. P	GO:0010507	negative regulation of autophagy
5. P	GO:0071986	Ragulator complex
5. P	GO:0001731	formation of translation preinitiation complex
5. P	GO:0010446	response to alkaline pH
5. P	GO:0051301	cell division
5. P	GO:0043595	endospore cortex
5. P	GO:0010506	regulation of autophagy
5. P	GO:0000103	sulfate assimilation
5. P	GO:0043023	ribosomal large subunit binding
5. P	GO:0020011	apicoplast
5. P	GO:0034301	endospore formation
5. P	GO:0044651	adhesion of symbiont to host epithelial cell
5. P	GO:1990130	GATOR1 complex
5. P	GO:0070814	hydrogen sulfide biosynthetic process
5. P	GO:0032008	positive regulation of TOR signaling
5. P	GO:0016887	ATP hydrolysis activity
5. P	GO:0070499	exosporium assembly
5. P	GO:0042268	regulation of cytolysis
5. P	GO:0009267	cellular response to starvation
5. P	GO:0003746	translation elongation factor activity
5. P	GO:0005576	extracellular region
5. P	GO:0070125	mitochondrial translational elongation
5. P	GO:0034198	cellular response to amino acid starvation
5. P	GO:0019048	modulation by virus of host process
5. P	GO:0005850	eukaryotic translation initiation factor 2 complex
5. P	GO:1990131	Gtr1-Gtr2 GTPase complex
5. P	GO:0006790	sulfur compound metabolic process
5. P	GO:0044068	modulation by symbiont of host cellular process
5. P	GO:1900022	regulation of D-erythro-sphingosine kinase activity
5. P	GO:0003743	translation initiation factor activity
5. P	GO:0016020	membrane
5. P	GO:0002182	cytoplasmic translational elongation
5. P	GO:0110045	negative regulation of cell cycle switching, mitotic to meiotic cell cycle
5. P	GO:0071230	cellular response to amino acid stimulus
5. P	GO:0007049	cell cycle
5. P	GO:1901001	negative regulation of response to salt stress
5. P	GO:0031160	spore wall
6. F	GO:0005759	mitochondrial matrix
6. F	GO:0045727	positive regulation of translation
7. B	GO:0015093	ferrous iron transmembrane transporter activity
7. B	GO:0005783	endoplasmic reticulum
7. B	GO:0070899	mitochondrial tRNA wobble uridine modification
7. B	GO:0016021	integral component of membrane
7. B	GO:0030488	tRNA methylation
7. B	GO:0002098	tRNA wobble uridine modification
7. B	GO:0042802	identical protein binding
7. B	GO:0005654	nucleoplasm
7. B	GO:0045036	protein targeting to chloroplast
7. B	GO:0061927	TOC-TIC supercomplex I
7. B	GO:0097216	guanosine tetraphosphate binding
7. B	GO:0000287	magnesium ion binding
7. B	GO:0042644	chloroplast nucleoid

Uniprot GO Annotations

GO	Description
GO:0000166	nucleotide binding
GO:0003723	RNA binding
GO:0070181	small ribosomal subunit rRNA binding
GO:0005886	plasma membrane
GO:0003924	GTPase activity
GO:0016020	membrane
GO:0005737	cytoplasm
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis
GO:0019843	rRNA binding
GO:0005525	GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q8Z4K5	GTPase Era	0.00e+00	8.91e-74	4.14e-62	0.9107
1. PBF	A0KUJ9	GTPase Der	5.65e-07	3.96e-02	6.25e-14	0.4198
1. PBF	B1KX71	GTPase Der	6.25e-07	4.58e-02	1.35e-09	0.4216
1. PBF	A1APR8	GTPase Era	0.00e+00	1.41e-68	2.63e-65	0.9298
1. PBF	Q9KD52	GTPase Era	0.00e+00	6.91e-73	1.05e-83	0.9515
1. PBF	Q0SRG1	GTPase Era	0.00e+00	4.01e-77	2.05e-83	0.9518
1. PBF	B7I5H1	GTPase Der	5.53e-07	1.28e-03	7.73e-10	0.439
1. PBF	B0KV26	GTPase Era	0.00e+00	5.37e-74	5.14e-56	0.9197
1. PBF	B8ZP66	GTPase Era	0.00e+00	5.94e-68	1.53e-81	0.9546
1. PBF	Q5HAY9	GTPase Era	0.00e+00	1.45e-59	7.42e-41	0.8958
1. PBF	B7MYJ7	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9071
1. PBF	A5N7W7	GTPase Der	6.40e-07	2.71e-02	4.21e-10	0.4298
1. PBF	B8I736	GTPase Era	0.00e+00	1.06e-76	1.40e-72	0.9611
1. PBF	Q5XDG3	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9533
1. PBF	B2THQ9	GTPase Der	4.56e-07	2.42e-02	1.73e-12	0.4294
1. PBF	A2BPL9	GTPase Der	2.60e-07	1.43e-02	6.66e-09	0.4275
1. PBF	B9KGA1	GTPase Era	0.00e+00	1.19e-68	1.12e-45	0.9262
1. PBF	P64084	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9675
1. PBF	Q2KWX8	GTPase Era	0.00e+00	1.41e-70	1.97e-53	0.9334
1. PBF	Q038T2	GTPase Era	0.00e+00	1.49e-80	5.19e-76	0.9404
1. PBF	A4TKX7	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.9165
1. PBF	Q1B6C5	GTPase Era	0.00e+00	1.67e-69	2.34e-66	0.9261
1. PBF	B5XK74	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9542
1. PBF	Q0BND2	GTPase Der	6.13e-07	1.34e-02	7.76e-10	0.461
1. PBF	B0RT56	GTPase Der	2.35e-07	4.55e-03	3.24e-12	0.4628
1. PBF	A4YWC7	GTPase Era	0.00e+00	3.71e-57	6.36e-53	0.9065
1. PBF	B8F3C8	GTPase Era	0.00e+00	4.81e-77	5.23e-59	0.9188
1. PBF	Q48UW6	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9531
1. PBF	Q6AEC6	GTPase Era	0.00e+00	2.68e-73	3.55e-65	0.9372
1. PBF	Q1I5V9	GTPase Era	0.00e+00	2.13e-74	3.60e-56	0.921
1. PBF	Q9PG37	GTPase Der	1.74e-07	1.80e-03	4.47e-12	0.4953
1. PBF	B6J4J8	GTPase Era	0.00e+00	3.03e-75	5.72e-60	0.9593
1. PBF	A5W8F1	GTPase Era	0.00e+00	1.13e-73	1.27e-56	0.9161
1. PBF	A3MZR0	GTPase Era	0.00e+00	1.11e-69	3.47e-61	0.9402
1. PBF	Q8P979	GTPase Der	2.80e-07	4.55e-03	3.24e-12	0.497
1. PBF	A5G693	GTPase Era	0.00e+00	4.21e-69	1.47e-78	0.9616
1. PBF	Q8EW66	GTPase Era	0.00e+00	1.93e-69	1.26e-48	0.8854
1. PBF	A4WDD7	GTPase Era	0.00e+00	2.39e-72	4.97e-62	0.9107
1. PBF	Q0HKV5	GTPase Der	4.91e-07	3.96e-02	6.25e-14	0.424
1. PBF	B5FRC4	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9099
1. PBF	Q83C83	GTPase Der	4.57e-07	2.11e-03	1.82e-14	0.4632
1. PBF	A4XKV8	GTPase Era	0.00e+00	4.57e-73	3.90e-75	0.9343
1. PBF	B7MIQ1	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9202
1. PBF	B2TXX9	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9126
1. PBF	Q9PB97	GTPase Era	0.00e+00	1.49e-72	1.55e-60	0.9339
1. PBF	B4SSW8	GTPase Der	3.79e-07	4.19e-03	3.29e-10	0.443
1. PBF	B0U3D9	GTPase Era	0.00e+00	9.86e-73	1.35e-60	0.9331
1. PBF	A9IIJ3	GTPase Era	0.00e+00	8.39e-74	2.09e-54	0.9413
1. PBF	Q1CKE3	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.9262
1. PBF	Q7W5J7	GTPase Era	0.00e+00	3.94e-73	1.09e-52	0.9428
1. PBF	B9E055	GTPase Era	0.00e+00	3.00e-78	1.41e-76	0.9636
1. PBF	Q83NI3	GTPase Era	0.00e+00	1.14e-60	2.86e-57	0.9316
1. PBF	Q5NFD2	GTPase Der	5.49e-07	1.27e-02	1.01e-09	0.444
1. PBF	A1UIQ1	GTPase Era	0.00e+00	1.67e-69	2.34e-66	0.9259
1. PBF	A8MG70	GTPase Era	0.00e+00	1.11e-72	2.45e-77	0.9592
1. PBF	Q5H1R1	GTPase Era	0.00e+00	4.49e-66	5.08e-54	0.9314
1. PBF	Q48LZ0	GTPase Der	7.85e-07	1.22e-02	2.73e-13	0.4447
1. PBF	A5IIT6	GTPase Era	0.00e+00	1.00e-66	3.84e-58	0.946
1. PBF	Q5WHD9	GTPase Era	0.00e+00	3.74e-75	4.96e-84	0.9517
1. PBF	Q9WZV1	GTPase Era	0.00e+00	8.09e-70	9.48e-58	0.9469
1. PBF	Q02HS3	GTPase Era	0.00e+00	9.90e-66	1.08e-57	0.9133
1. PBF	P0A3C1	GTPase Era	0.00e+00	6.42e-75	3.02e-75	0.9451
1. PBF	C3LT16	GTPase Der	5.14e-07	2.38e-02	1.29e-14	0.4381
1. PBF	B0BUA7	GTPase Era	0.00e+00	2.12e-70	1.31e-60	0.9409
1. PBF	Q89AM7	GTPase Era	0.00e+00	8.05e-53	1.91e-30	0.8765
1. PBF	B1MYE3	GTPase Era	0.00e+00	1.87e-75	1.91e-79	0.9532
1. PBF	Q4UKB0	GTPase Era	0.00e+00	9.91e-70	2.19e-49	0.9186
1. PBF	Q1QD14	GTPase Der	6.71e-07	4.81e-03	3.90e-11	0.4343
1. PBF	C7LZP1	GTPase Era	0.00e+00	8.67e-50	3.44e-32	0.8969
1. PBF	A4SYD7	GTPase Der	3.40e-07	2.38e-03	5.84e-09	0.4075
1. PBF	A5IC36	GTPase Der	5.43e-07	3.36e-03	3.80e-12	0.4321
1. PBF	Q1JN21	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9517
1. PBF	A5U557	GTPase Era	0.00e+00	1.50e-70	6.58e-66	0.946
1. PBF	C1CK50	GTPase Era	0.00e+00	5.45e-68	1.98e-81	0.955
1. PBF	A7ZQ10	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9168
1. PBF	A0Q1Q0	GTPase Era	0.00e+00	3.03e-75	2.72e-74	0.9678
1. PBF	B8DE49	GTPase Era	0.00e+00	4.30e-73	5.08e-77	0.9549
1. PBF	Q5PNI6	GTPase Der	4.24e-07	3.73e-02	8.99e-15	0.4378
1. PBF	B2UTX1	GTPase Era	0.00e+00	6.44e-61	1.88e-51	0.9154
1. PBF	Q4UUM0	GTPase Der	2.69e-07	4.55e-03	3.24e-12	0.4476
1. PBF	A9N1T2	GTPase Era	0.00e+00	1.62e-74	8.07e-62	0.9082
1. PBF	B1XU78	GTPase Der	7.32e-06	5.77e-03	3.26e-09	0.4094
1. PBF	B2FPX8	GTPase Era	0.00e+00	4.79e-71	7.23e-56	0.9194
1. PBF	Q5HNY0	GTPase Era	0.00e+00	8.20e-67	7.47e-79	0.9719
1. PBF	A1TZQ4	GTPase Der	5.31e-07	9.23e-03	1.64e-10	0.4385
1. PBF	Q98QI1	GTPase Era	0.00e+00	1.79e-65	8.29e-58	0.9292
1. PBF	Q4KHT0	GTPase Era	0.00e+00	3.63e-75	1.29e-58	0.9219
1. PBF	Q5P7B7	GTPase Der	1.93e-07	3.14e-02	5.77e-08	0.434
1. PBF	Q5ZV99	GTPase Der	5.10e-07	4.68e-03	4.32e-12	0.4313
1. PBF	B4RV85	GTPase Der	5.38e-07	3.12e-03	2.36e-12	0.4404
1. PBF	P0A3C4	GTPase Era	0.00e+00	5.45e-68	1.98e-81	0.9546
1. PBF	A5UFI7	GTPase Era	0.00e+00	1.58e-72	5.19e-59	0.9186
1. PBF	Q8YYD8	GTPase Era	0.00e+00	1.40e-45	1.60e-69	0.9271
1. PBF	A1KL54	GTPase Era	0.00e+00	1.50e-70	6.58e-66	0.947
1. PBF	B7VJU2	GTPase Der	1.75e-05	1.63e-02	5.96e-14	0.417
1. PBF	Q49Y10	GTPase Era	0.00e+00	3.44e-68	3.34e-78	0.9637
1. PBF	Q55526	GTPase Era	0.00e+00	9.90e-54	2.02e-67	0.9427
1. PBF	A6U239	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9628
1. PBF	Q57LD1	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9112
1. PBF	A9KLK7	GTPase Der	5.14e-07	4.51e-02	1.30e-11	0.4285
1. PBF	Q3YRS0	GTPase Era	0.00e+00	5.15e-64	1.26e-39	0.9166
1. PBF	A1KT93	GTPase Der	7.04e-07	3.61e-03	2.26e-06	0.4559
1. PBF	Q3YYV0	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9116
1. PBF	P0DA96	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9552
1. PBF	B8CXI2	GTPase Era	0.00e+00	2.54e-72	7.74e-73	0.9593
1. PBF	Q87S12	GTPase Der	4.27e-07	2.55e-02	1.34e-13	0.4225
1. PBF	C0PYN4	GTPase Der	4.26e-07	4.70e-02	9.33e-15	0.4381
1. PBF	A0AIR3	GTPase Era	0.00e+00	2.91e-71	3.05e-77	0.958
1. PBF	Q3JCW1	GTPase Der	3.42e-07	1.74e-02	2.68e-09	0.4464
1. PBF	Q7MHN9	GTPase Era	0.00e+00	7.01e-47	4.42e-58	0.9137
1. PBF	A1VHK4	GTPase Era	0.00e+00	1.11e-67	6.77e-62	0.9369
1. PBF	B2V3Z1	GTPase Der	4.49e-07	4.58e-02	6.60e-13	0.4309
1. PBF	O83552	GTPase Era	0.00e+00	2.61e-58	6.37e-43	0.891
1. PBF	Q3SL66	GTPase Der	5.26e-07	3.33e-05	1.11e-09	0.446
1. PBF	Q71ZK8	GTPase Era	0.00e+00	2.45e-73	9.55e-78	0.9578
1. PBF	A1AE96	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9211
1. PBF	Q72G11	GTPase Era	0.00e+00	1.11e-67	6.77e-62	0.9331
1. PBF	Q8Y750	GTPase Era	0.00e+00	2.45e-73	9.55e-78	0.9582
1. PBF	C1CXC1	GTPase Era	0.00e+00	9.68e-61	3.53e-53	0.914
1. PBF	B7K414	GTPase Era	0.00e+00	5.01e-56	3.55e-71	0.9341
1. PBF	Q0T1T9	GTPase Era	0.00e+00	2.17e-73	3.06e-62	0.9273
1. PBF	A3Q264	GTPase Era	0.00e+00	2.81e-69	1.48e-66	0.9264
1. PBF	P0DA97	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9543
1. PBF	Q0VNE4	GTPase Der	5.40e-07	3.96e-02	5.36e-09	0.4415
1. PBF	Q3AZ65	GTPase Der	2.69e-07	9.07e-03	2.90e-09	0.4041
1. PBF	Q0TES2	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.914
1. PBF	Q031W8	GTPase Era	0.00e+00	2.87e-74	2.30e-75	0.946
1. PBF	B1J4E1	GTPase Era	0.00e+00	3.33e-74	1.41e-57	0.9123
1. PBF	Q17XF9	GTPase Era	0.00e+00	2.93e-62	1.24e-53	0.9153
1. PBF	A8Z4A6	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9685
1. PBF	B3ETC6	GTPase Era	0.00e+00	4.93e-71	3.22e-57	0.9223
1. PBF	Q8NNB9	GTPase Era	0.00e+00	2.16e-62	2.65e-60	0.9026
1. PBF	Q8DYI1	GTPase Era	0.00e+00	1.53e-71	9.69e-82	0.9551
1. PBF	Q7WD33	GTPase Era	0.00e+00	3.94e-73	1.09e-52	0.9399
1. PBF	Q1G9W6	GTPase Era	0.00e+00	4.75e-75	1.60e-75	0.9195
1. PBF	A7FFU0	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.9296
1. PBF	Q9RDF2	GTPase Era	0.00e+00	4.11e-58	5.98e-60	0.9379
1. PBF	B7M8H9	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9136
1. PBF	A4VW74	GTPase Era	0.00e+00	2.12e-70	3.94e-81	0.9583
1. PBF	B0V4V6	GTPase Der	6.70e-07	3.45e-03	8.25e-10	0.46
1. PBF	Q8G1P9	GTPase Era	0.00e+00	1.17e-47	1.31e-55	0.909
1. PBF	A1U2V4	GTPase Era	0.00e+00	8.22e-60	1.00e-60	0.9097
1. PBF	Q4K6V3	GTPase Der	7.22e-07	2.30e-02	9.87e-13	0.4477
1. PBF	B2SF94	GTPase Der	5.40e-07	9.92e-03	1.97e-09	0.4443
1. PBF	Q6LU45	GTPase Der	9.36e-06	4.43e-02	2.97e-14	0.4397
1. PBF	Q7NS92	GTPase Der	9.40e-06	2.85e-04	2.65e-08	0.4613
1. PBF	Q83QI5	GTPase Era	0.00e+00	3.94e-73	5.62e-63	0.9141
1. PBF	A7GHG2	GTPase Era	0.00e+00	1.12e-77	2.56e-79	0.9489
1. PBF	B1KLB1	GTPase Der	1.14e-05	2.24e-02	4.86e-14	0.4335
1. PBF	Q7MNE7	GTPase Der	6.25e-07	2.88e-02	4.21e-14	0.4188
1. PBF	Q1C554	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.9229
1. PBF	A3QCG6	GTPase Der	1.05e-05	2.62e-02	1.54e-14	0.4282
1. PBF	B2TMB9	GTPase Era	0.00e+00	2.97e-76	3.08e-80	0.9602
1. PBF	B0TZQ0	GTPase Der	6.02e-07	8.91e-03	4.10e-11	0.4435
1. PBF	A1WUL5	GTPase Der	8.98e-06	8.56e-04	1.02e-12	0.4441
1. PBF	A9N941	GTPase Era	0.00e+00	1.31e-73	1.78e-58	0.9592
1. PBF	Q68XY6	GTPase Era	0.00e+00	6.60e-70	2.62e-47	0.9062
1. PBF	A7MZE5	GTPase Der	4.73e-07	1.78e-02	1.00e-13	0.4319
1. PBF	Q6NG20	GTPase Era	0.00e+00	1.98e-66	6.25e-61	0.8933
1. PBF	B0RX26	GTPase Era	0.00e+00	9.90e-66	4.49e-54	0.9332
1. PBF	B7J2L5	GTPase Era	0.00e+00	5.08e-70	6.07e-51	0.9353
1. PBF	B4U458	GTPase Era	0.00e+00	1.27e-73	1.09e-81	0.9554
1. PBF	Q87XG2	GTPase Era	0.00e+00	4.93e-71	3.17e-57	0.9345
1. PBF	Q1RHA4	GTPase Era	0.00e+00	3.84e-72	1.66e-50	0.9161
1. PBF	Q03F63	GTPase Era	0.00e+00	1.40e-67	1.29e-79	0.958
1. PBF	A4W2H9	GTPase Era	0.00e+00	2.12e-70	3.94e-81	0.9587
1. PBF	B7K1S0	GTPase Der	3.00e-07	4.66e-02	2.19e-14	0.4444
1. PBF	A3M215	GTPase Der	6.66e-07	3.45e-03	8.25e-10	0.4396
1. PBF	Q9PHL1	GTPase Era	0.00e+00	1.32e-69	5.27e-49	0.9195
1. PBF	A5I626	GTPase Era	0.00e+00	3.09e-78	1.29e-79	0.946
1. PBF	B5Z140	GTPase Era	0.00e+00	5.06e-74	1.28e-62	0.9133
1. PBF	Q3BTW0	GTPase Der	3.53e-07	4.51e-03	1.73e-11	0.4355
1. PBF	Q182C3	GTPase Era	0.00e+00	8.91e-74	1.31e-72	0.9409
1. PBF	C1FSU2	GTPase Der	5.84e-07	6.49e-03	1.36e-09	0.4396
1. PBF	A9N205	GTPase Der	3.64e-07	2.46e-02	8.67e-15	0.441
1. PBF	Q9JZY1	GTPase Der	6.91e-07	2.56e-03	3.64e-06	0.4569
1. PBF	A9BE09	GTPase Der	2.60e-07	4.11e-03	2.51e-10	0.4143
1. PBF	C0MBF0	GTPase Era	0.00e+00	1.35e-73	4.49e-81	0.9553
1. PBF	B2IPC3	GTPase Era	0.00e+00	5.45e-68	1.98e-81	0.9554
1. PBF	A8F6R1	GTPase Era	0.00e+00	9.39e-71	5.60e-61	0.9518
1. PBF	A1W581	GTPase Der	2.84e-07	2.93e-02	1.07e-06	0.4538
1. PBF	C1CDW4	GTPase Era	0.00e+00	9.94e-68	4.16e-81	0.9519
1. PBF	A0KJ48	GTPase Der	6.28e-07	4.47e-02	1.29e-13	0.4343
1. PBF	Q9KTW7	GTPase Der	6.38e-07	2.38e-02	1.29e-14	0.4304
1. PBF	Q3ICZ9	GTPase Der	1.22e-05	8.51e-03	5.24e-13	0.4424
1. PBF	Q8ZD71	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.918
1. PBF	B7IH25	GTPase Era	0.00e+00	9.10e-66	9.21e-64	0.9448
1. PBF	A7X2W5	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9669
1. PBF	Q8XIU8	GTPase Era	0.00e+00	4.53e-77	2.47e-83	0.953
1. PBF	C6E2H7	GTPase Era	0.00e+00	6.14e-72	2.29e-73	0.9399
1. PBF	Q15R60	GTPase Der	1.58e-05	4.76e-03	3.36e-12	0.4206
1. PBF	Q2FGF6	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9691
1. PBF	C3L3F3	GTPase Era	0.00e+00	2.42e-78	3.08e-79	0.9522
1. PBF	B4RKD2	GTPase Der	4.76e-07	5.27e-03	6.94e-07	0.4635
1. PBF	A6TSJ8	GTPase Era	0.00e+00	1.07e-74	3.20e-75	0.9624
1. PBF	A1VZ20	GTPase Era	0.00e+00	4.53e-70	6.97e-49	0.9225
1. PBF	Q04A20	GTPase Era	0.00e+00	4.75e-75	1.60e-75	0.9261
1. PBF	B5F1G0	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9168
1. PBF	B6J7Q3	GTPase Der	3.92e-07	2.11e-03	1.82e-14	0.4636
1. PBF	B7LUZ8	GTPase Era	0.00e+00	5.14e-73	4.44e-64	0.906
1. PBF	O24756	GTPase Era	0.00e+00	1.37e-70	7.88e-82	0.9564
1. PBF	Q73Y13	GTPase Era	0.00e+00	3.07e-69	4.23e-67	0.9272
1. PBF	Q2LVR8	GTPase Era	0.00e+00	1.18e-62	6.33e-77	0.9316
1. PBF	C0MCD8	GTPase Era	0.00e+00	5.21e-74	1.15e-80	0.9522
1. PBF	B5BAY9	GTPase Der	4.12e-07	3.73e-02	8.99e-15	0.4408
1. PBF	Q5QYB3	GTPase Der	6.44e-07	9.66e-03	9.27e-13	0.4282
1. PBF	B2KB94	GTPase Era	0.00e+00	4.80e-70	1.12e-42	0.9201
1. PBF	B1ILK9	GTPase Era	0.00e+00	4.74e-78	8.09e-80	0.9488
1. PBF	Q5FFN4	GTPase Era	0.00e+00	5.81e-62	7.19e-41	0.918
1. PBF	Q1D5X5	GTPase Der	6.44e-06	1.49e-02	4.79e-11	0.4134
1. PBF	Q7VW40	GTPase Era	0.00e+00	3.94e-73	1.09e-52	0.9422
1. PBF	A1KSV0	GTPase Era	0.00e+00	3.30e-56	7.82e-46	0.878
1. PBF	B2S103	GTPase Era	0.00e+00	6.30e-66	5.30e-49	0.9091
1. PBF	Q9XCI8	GTPase Der	4.21e-07	3.73e-02	8.99e-15	0.4401
1. PBF	Q87B41	GTPase Der	2.06e-07	3.58e-03	3.26e-11	0.4535
1. PBF	Q1IXB4	GTPase Era	0.00e+00	1.38e-60	2.49e-45	0.9144
1. PBF	B2V2K0	GTPase Era	0.00e+00	3.78e-76	4.36e-80	0.9608
1. PBF	B6IZ00	GTPase Era	0.00e+00	1.30e-77	2.44e-60	0.957
1. PBF	A7NAB1	GTPase Der	5.34e-07	1.34e-02	7.76e-10	0.432
1. PBF	B5QTU7	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9091
1. PBF	A1R085	GTPase Era	0.00e+00	9.39e-68	1.94e-42	0.9081
1. PBF	Q6GGD3	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9685
1. PBF	P75210	GTPase Era	2.23e-13	3.55e-48	1.33e-13	0.7497
1. PBF	Q4ZX19	GTPase Der	9.83e-07	1.45e-02	2.51e-13	0.4334
1. PBF	B9MS56	GTPase Era	0.00e+00	4.70e-73	1.33e-74	0.9513
1. PBF	Q8RB50	GTPase Era	0.00e+00	7.56e-73	1.14e-73	0.9375
1. PBF	Q1LU74	GTPase Der	5.91e-06	2.97e-04	4.35e-09	0.4481
1. PBF	B8J3P9	GTPase Era	0.00e+00	4.18e-62	1.54e-50	0.9208
1. PBF	B0USS2	GTPase Era	0.00e+00	2.51e-68	6.60e-59	0.9234
1. PBF	Q8FF17	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9131
1. PBF	Q5X522	GTPase Der	5.22e-07	3.36e-03	3.80e-12	0.4322
1. PBF	Q3KHL8	GTPase Era	0.00e+00	6.81e-74	4.97e-57	0.9209
1. PBF	Q9ZE30	GTPase Era	0.00e+00	1.12e-70	1.42e-46	0.9106
1. PBF	Q9K0C7	GTPase Era	0.00e+00	2.06e-56	3.03e-46	0.8869
1. PBF	A7ZDF6	GTPase Era	0.00e+00	8.01e-72	1.24e-48	0.9142
1. PBF	Q31XS1	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9199
1. PBF	C1CRT1	GTPase Era	0.00e+00	5.45e-68	1.98e-81	0.9562
1. PBF	A7FXK1	GTPase Era	0.00e+00	3.09e-78	1.29e-79	0.9511
1. PBF	A7MH00	GTPase Era	0.00e+00	2.53e-75	4.66e-62	0.9109
1. PBF	P0C0C0	GTPase Era (Fragment)	0.00e+00	1.96e-03	3.44e-53	0.9216
1. PBF	B5R578	GTPase Der	4.15e-07	3.34e-02	8.83e-15	0.439
1. PBF	P0A3C3	GTPase Era	0.00e+00	5.45e-68	1.98e-81	0.9554
1. PBF	Q2Y6F9	GTPase Der	4.51e-07	2.66e-02	2.47e-08	0.4307
1. PBF	A8A376	GTPase Era	0.00e+00	1.77e-73	8.65e-63	0.9264
1. PBF	B0K708	GTPase Era	0.00e+00	2.52e-71	2.80e-72	0.9335
1. PBF	B2I605	GTPase Era	0.00e+00	9.86e-73	4.63e-59	0.9332
1. PBF	Q1JI67	GTPase Era	0.00e+00	2.54e-72	1.18e-81	0.9544
1. PBF	A4IXH0	GTPase Der	5.43e-07	8.99e-03	7.21e-10	0.4441
1. PBF	B0KPJ1	GTPase Der	7.41e-07	2.28e-02	2.78e-14	0.4444
1. PBF	Q831T9	GTPase Era	0.00e+00	2.62e-74	1.95e-73	0.9516
1. PBF	Q6G900	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9673
1. PBF	B5Z6P0	GTPase Era	0.00e+00	7.80e-63	1.36e-52	0.9133
1. PBF	Q8PKY6	GTPase Der	1.62e-07	4.99e-03	1.53e-11	0.4637
1. PBF	A5IT95	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9676
1. PBF	Q49768	GTPase Era	0.00e+00	4.15e-70	5.24e-67	0.9451
1. PBF	A5N6N6	GTPase Era	0.00e+00	3.00e-78	1.41e-76	0.9633
1. PBF	Q9CPH8	GTPase Era	0.00e+00	1.45e-68	6.40e-59	0.9224
1. PBF	B5RCY8	GTPase Der	4.10e-07	1.95e-02	8.99e-15	0.4408
1. PBF	B8H630	GTPase Era	0.00e+00	1.16e-53	2.30e-45	0.9034
1. PBF	Q0AE46	GTPase Der	6.97e-07	2.07e-03	1.59e-08	0.4454
1. PBF	A2RG20	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9541
1. PBF	P0C0B9	GTPase Era	0.00e+00	2.19e-72	1.02e-81	0.9538
1. PBF	A7GYN7	GTPase Era	0.00e+00	1.98e-66	1.37e-47	0.9211
1. PBF	B2KA46	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.9174
1. PBF	B5RMK6	GTPase Era	0.00e+00	6.85e-68	3.35e-40	0.9191
1. PBF	A0Q534	GTPase Der	6.46e-07	1.18e-02	7.02e-10	0.453
1. PBF	P37214	GTPase Era	0.00e+00	1.67e-74	2.52e-82	0.9569
1. PBF	B0VKR4	GTPase Der	6.83e-07	3.79e-03	8.25e-10	0.4603
1. PBF	Q2NB82	GTPase Era	0.00e+00	1.17e-59	2.04e-44	0.93
1. PBF	Q92R46	GTPase Era	0.00e+00	1.03e-54	1.57e-57	0.9202
1. PBF	Q2SDW8	GTPase Der	4.50e-07	5.28e-04	5.46e-13	0.4375
1. PBF	A0RPN6	GTPase Era	0.00e+00	8.14e-68	3.27e-53	0.9169
1. PBF	B1LP79	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.911
1. PBF	P58071	GTPase Era	0.00e+00	1.16e-53	2.30e-45	0.8993
1. PBF	Q92BP8	GTPase Era	0.00e+00	4.57e-73	3.12e-78	0.9582
1. PBF	A7H4F3	GTPase Era	0.00e+00	5.62e-69	3.33e-48	0.9227
1. PBF	Q9XCX8	GTPase Era	0.00e+00	9.90e-66	1.08e-57	0.9211
1. PBF	Q8UGK1	GTPase Era	0.00e+00	5.13e-46	2.11e-59	0.9224
1. PBF	Q88VS0	GTPase Era	0.00e+00	6.91e-73	1.48e-76	0.963
1. PBF	Q0SMJ3	GTPase Era	0.00e+00	1.44e-69	3.06e-50	0.9377
1. PBF	B9DRF9	GTPase Era	0.00e+00	4.48e-75	7.70e-83	0.9579
1. PBF	Q2A515	GTPase Der	5.72e-07	1.34e-02	7.76e-10	0.4434
1. PBF	Q4FTW3	GTPase Der	9.86e-07	2.76e-02	2.27e-12	0.4268
1. PBF	C1DQS3	GTPase Era	0.00e+00	4.82e-76	5.42e-56	0.926
1. PBF	Q2GGZ1	GTPase Era	0.00e+00	1.08e-64	2.01e-41	0.9186
1. PBF	B4SRK9	GTPase Era	0.00e+00	1.09e-70	1.47e-55	0.9306
1. PBF	Q0AB37	GTPase Der	6.85e-06	1.43e-02	8.95e-12	0.4505
1. PBF	A5EKL6	GTPase Era	0.00e+00	3.28e-55	1.43e-50	0.9067
1. PBF	Q667V2	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.9143
1. PBF	B5RQ02	GTPase Era	0.00e+00	2.09e-67	1.02e-39	0.9181
1. PBF	B8D950	GTPase Era	0.00e+00	3.74e-47	2.50e-30	0.9209
1. PBF	B4T0P5	GTPase Der	3.83e-07	3.73e-02	8.99e-15	0.4365
1. PBF	A8GUZ8	GTPase Era	0.00e+00	1.83e-72	8.63e-50	0.9165
1. PBF	Q04KV9	GTPase Era	0.00e+00	5.45e-68	1.98e-81	0.9543
1. PBF	A4XSC5	GTPase Era	0.00e+00	1.63e-72	3.82e-57	0.9271
1. PBF	Q83MZ2	GTPase Era	0.00e+00	1.14e-60	2.86e-57	0.9329
1. PBF	P64088	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9543
1. PBF	Q9RWM0	GTPase Era	0.00e+00	3.33e-59	2.18e-42	0.9137
1. PBF	Q03Y33	GTPase Era	0.00e+00	1.72e-76	1.41e-79	0.968
1. PBF	Q9KPB3	GTPase Era	0.00e+00	4.33e-47	4.13e-58	0.9174
1. PBF	A8EXI4	GTPase Era	0.00e+00	2.11e-71	2.34e-50	0.9178
1. PBF	Q21KS9	GTPase Der	4.62e-07	2.46e-04	2.87e-11	0.4494
1. PBF	B0TLI8	GTPase Der	1.13e-05	4.43e-02	2.05e-13	0.4229
1. PBF	Q73LG9	GTPase Era	0.00e+00	6.05e-70	3.88e-50	0.928
1. PBF	A5VYT9	GTPase Der	8.94e-07	3.11e-02	4.22e-14	0.4604
1. PBF	B1JDV4	GTPase Der	7.20e-07	1.08e-02	2.09e-14	0.4479
1. PBF	Q8Z4P6	GTPase Der	4.08e-07	3.22e-02	9.25e-15	0.4408
1. PBF	Q87C05	GTPase Era	0.00e+00	9.86e-73	4.63e-59	0.9331
1. PBF	Q3K022	GTPase Era	0.00e+00	1.53e-71	9.69e-82	0.957
1. PBF	Q39T84	GTPase Era	0.00e+00	1.53e-71	9.48e-70	0.9418
1. PBF	O51604	GTPase Era	0.00e+00	5.08e-70	6.07e-51	0.9411
1. PBF	Q3BVV5	GTPase Era	0.00e+00	7.08e-65	1.28e-52	0.9312
1. PBF	Q660L0	GTPase Era	0.00e+00	2.84e-70	1.98e-48	0.9398
1. PBF	Q7U8G2	GTPase Der	3.02e-07	5.72e-03	7.04e-08	0.4186
1. PBF	Q87LP0	GTPase Era	0.00e+00	5.78e-47	2.66e-60	0.9073
1. PBF	A5IXQ6	GTPase Era	0.00e+00	1.13e-76	3.09e-61	0.96
1. PBF	Q1QTK4	GTPase Der	2.76e-07	3.37e-02	1.24e-08	0.4475
1. PBF	Q9JVD2	GTPase Era	0.00e+00	8.86e-57	3.19e-46	0.8679
1. PBF	Q0I4Z4	GTPase Era	0.00e+00	5.14e-73	8.40e-59	0.9239
1. PBF	Q2YT12	GTPase Era	0.00e+00	2.00e-70	3.64e-82	0.9663
1. PBF	Q56057	GTPase Era	0.00e+00	2.52e-73	1.09e-61	0.9129
1. PBF	Q1JD46	GTPase Era	0.00e+00	3.31e-72	1.40e-81	0.9549
1. PBF	B3WEL1	GTPase Era	0.00e+00	6.19e-80	9.83e-76	0.9385
1. PBF	Q4ZPE2	GTPase Era	0.00e+00	4.14e-71	4.10e-57	0.9186
1. PBF	B3E422	GTPase Era	0.00e+00	8.02e-73	1.02e-71	0.9171
1. PBF	A6QHB0	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9684
1. PBF	B1XB40	GTPase Era	0.00e+00	1.77e-73	8.65e-63	0.9262
1. PBF	A8H249	GTPase Der	1.01e-05	2.40e-02	1.72e-13	0.4367
1. PBF	Q88PJ3	GTPase Der	8.37e-07	2.69e-02	2.61e-14	0.4456
1. PBF	B2I7V0	GTPase Der	1.93e-07	3.58e-03	3.26e-11	0.4532
1. PBF	Q82SJ6	GTPase Era	0.00e+00	1.49e-69	6.62e-62	0.9435
1. PBF	C5BLV6	GTPase Der	7.99e-06	3.00e-03	8.58e-12	0.4334
1. PBF	A9MGX7	GTPase Era	0.00e+00	9.74e-74	1.21e-62	0.9207
1. PBF	Q1IEH7	GTPase Der	8.36e-07	4.43e-02	1.69e-14	0.4462
1. PBF	B6JGG2	GTPase Era	0.00e+00	9.73e-63	1.02e-53	0.9045
1. PBF	Q1CU14	GTPase Era	0.00e+00	3.35e-61	2.28e-51	0.9094
1. PBF	Q5WWG8	GTPase Der	4.07e-07	5.03e-03	1.38e-12	0.4293
1. PBF	Q8EPY0	GTPase Era	0.00e+00	3.09e-79	8.32e-81	0.9653
1. PBF	B4TS13	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9068
1. PBF	Q1J822	GTPase Era	0.00e+00	2.86e-72	4.02e-82	0.9537
1. PBF	A1JKK4	GTPase Era	0.00e+00	4.07e-72	5.08e-65	0.9096
1. PBF	A4SNZ8	GTPase Der	7.25e-07	4.51e-02	1.28e-12	0.4335
1. PBF	P64085	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9673
1. PBF	B7UH06	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9127
1. PBF	Q97JI5	GTPase Era	0.00e+00	6.81e-74	6.37e-81	0.9463
1. PBF	B2I3F0	GTPase Der	6.67e-07	3.45e-03	8.25e-10	0.4583
1. PBF	Q92JA9	GTPase Era	0.00e+00	5.76e-23	1.69e-49	0.916
1. PBF	B0TAF1	GTPase Era	0.00e+00	1.78e-76	4.89e-74	0.9586
1. PBF	A9KFA1	GTPase Era	0.00e+00	3.03e-75	5.72e-60	0.9563
1. PBF	Q31KP9	GTPase Der	2.43e-07	4.47e-02	7.90e-10	0.4418
1. PBF	A2SHB1	GTPase Der	2.45e-07	3.83e-02	6.65e-08	0.4549
1. PBF	Q1WTU6	GTPase Era	0.00e+00	1.19e-78	8.75e-70	0.9607
1. PBF	B5BAT1	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9139
1. PBF	Q886Y6	GTPase Der	6.95e-07	7.64e-03	2.40e-13	0.4446
1. PBF	A6TCI0	GTPase Era	0.00e+00	5.87e-74	1.44e-62	0.9203
1. PBF	Q5HVB3	GTPase Era	0.00e+00	1.05e-69	3.40e-48	0.9229
1. PBF	O69162	GTPase Era	0.00e+00	4.24e-54	7.12e-53	0.9102
1. PBF	B1XLH8	GTPase Der	2.35e-07	4.31e-03	9.35e-13	0.4663
1. PBF	Q0TNU5	GTPase Era	0.00e+00	4.14e-77	1.24e-83	0.9539
1. PBF	Q12PT0	GTPase Der	5.82e-07	3.45e-02	1.35e-13	0.4361
1. PBF	A6LL68	GTPase Era	0.00e+00	3.21e-72	4.62e-61	0.948
1. PBF	B1XXK9	GTPase Der	3.47e-07	3.93e-02	1.46e-08	0.4616
1. PBF	Q6MB45	GTPase Der	1.41e-06	9.98e-05	7.71e-10	0.4661
1. PBF	Q0AF71	GTPase Era	0.00e+00	1.76e-67	1.28e-67	0.9463
1. PBF	B7N6F4	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9136
1. PBF	B1HTJ0	GTPase Era	0.00e+00	4.49e-74	5.30e-81	0.9567
1. PBF	Q14GT5	GTPase Der	4.96e-07	1.27e-02	1.01e-09	0.444
1. PBF	B8GTN1	GTPase Der	3.75e-07	8.07e-03	3.08e-10	0.4207
1. PBF	B7H065	GTPase Der	6.26e-07	3.45e-03	8.25e-10	0.4598
1. PBF	Q2P4M0	GTPase Era	0.00e+00	4.49e-66	5.08e-54	0.9334
1. PBF	B7NRL9	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9106
1. PBF	B0U489	GTPase Der	1.89e-07	7.50e-03	8.13e-12	0.4541
1. PBF	A2BV51	GTPase Der	4.35e-07	1.75e-02	6.06e-10	0.4316
1. PBF	A7I277	GTPase Era	0.00e+00	4.37e-63	9.32e-46	0.9305
1. PBF	B3PDM5	GTPase Der	8.33e-06	1.88e-04	2.55e-11	0.432
1. PBF	Q3AEZ3	GTPase Era	0.00e+00	2.24e-73	1.01e-70	0.9375
1. PBF	B1IVR1	GTPase Era	0.00e+00	1.77e-73	8.65e-63	0.9243
1. PBF	B8DQN1	GTPase Era	0.00e+00	8.02e-63	7.20e-54	0.9194
1. PBF	Q0APC5	GTPase Era	0.00e+00	5.36e-55	9.41e-45	0.9142
1. PBF	A9KFU3	GTPase Der	3.22e-07	2.11e-03	1.82e-14	0.469
1. PBF	B5RD48	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9166
1. PBF	B6JL99	GTPase Era	0.00e+00	1.11e-60	1.47e-52	0.9108
1. PBF	Q5PIG4	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9134
1. PBF	Q8PB51	GTPase Era	0.00e+00	9.90e-66	4.49e-54	0.9223
1. PBF	B6IZN3	GTPase Der	3.82e-07	2.34e-03	1.74e-14	0.4473
1. PBF	B9DNL3	GTPase Era	0.00e+00	1.44e-74	1.64e-75	0.9438
1. PBF	P44536	GTPase Der	1.12e-05	3.83e-02	4.55e-13	0.4413
1. PBF	Q8K9R2	GTPase Era	0.00e+00	7.02e-51	6.24e-28	0.8702
1. PBF	Q9JV01	GTPase Der	5.43e-07	2.15e-03	2.96e-06	0.4405
1. PBF	B1KZM3	GTPase Era	0.00e+00	1.67e-78	3.18e-79	0.9511
1. PBF	B4TE14	GTPase Era	0.00e+00	2.52e-73	1.09e-61	0.9131
1. PBF	B8CKR5	GTPase Der	1.04e-05	1.98e-02	4.75e-14	0.4199
1. PBF	B7JC34	GTPase Der	1.82e-07	1.71e-03	6.70e-12	0.4547
1. PBF	B2FNR1	GTPase Der	3.69e-07	3.00e-03	8.66e-10	0.461
1. PBF	Q67NS9	GTPase Der	6.50e-07	1.36e-02	8.27e-10	0.4285
1. PBF	B0KA54	GTPase Era	0.00e+00	2.52e-71	2.80e-72	0.9342
1. PBF	B5EJF7	GTPase Der	2.31e-07	1.71e-03	6.70e-12	0.4537
1. PBF	Q057R5	GTPase Era	0.00e+00	3.31e-51	7.07e-17	0.798
1. PBF	A8FT74	GTPase Der	1.04e-05	2.81e-02	5.80e-14	0.4536
1. PBF	B3GX86	GTPase Era	0.00e+00	1.11e-69	3.47e-61	0.9391
1. PBF	A9R403	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.9145
1. PBF	B4T1F7	GTPase Era	0.00e+00	2.52e-73	1.09e-61	0.9139
1. PBF	Q8PMU9	GTPase Era	0.00e+00	3.80e-63	2.53e-52	0.9311
1. PBF	Q28QC6	GTPase Der	4.25e-06	2.36e-02	8.87e-08	0.4112
1. PBF	A6U7A9	GTPase Era	0.00e+00	1.80e-56	9.28e-59	0.9189
1. PBF	A8LLE0	GTPase Era	0.00e+00	3.72e-65	3.42e-36	0.9009
1. PBF	B7UYX1	GTPase Era	0.00e+00	9.90e-66	1.08e-57	0.9224
1. PBF	B5XNH1	GTPase Era	0.00e+00	2.05e-73	3.84e-62	0.9121
1. PBF	Q32CV5	GTPase Era	0.00e+00	2.05e-73	1.78e-62	0.9163
1. PBF	P51836	GTPase Era	0.00e+00	1.31e-73	1.78e-58	0.9591
1. PBF	P42182	GTPase Era	0.00e+00	2.97e-76	1.64e-83	0.9517
1. PBF	A5WGA8	GTPase Der	3.14e-07	1.47e-03	1.89e-12	0.4538
1. PBF	B9MFY0	GTPase Der	3.15e-07	4.39e-02	1.12e-06	0.4524
1. PBF	A9NDV6	GTPase Der	2.71e-07	2.11e-03	1.82e-14	0.4696
1. PBF	B1JRC8	GTPase Era	0.00e+00	2.53e-70	1.13e-64	0.9231
1. PBF	Q5N167	GTPase Der	2.72e-07	4.47e-02	7.90e-10	0.4315
1. PBF	P57345	GTPase Era	0.00e+00	8.91e-47	2.40e-30	0.918
1. PBF	B7LDF9	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9146
1. PBF	B6I5E0	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9103
1. PBF	Q892S2	GTPase Era	0.00e+00	8.84e-77	5.93e-72	0.963
1. PBF	Q5FJT7	GTPase Era	0.00e+00	1.52e-75	6.09e-73	0.9346
1. PBF	C1FVS6	GTPase Era	0.00e+00	1.42e-77	2.27e-79	0.9475
1. PBF	B1WT49	GTPase Era	0.00e+00	1.27e-51	6.89e-67	0.9414
1. PBF	Q8E443	GTPase Era	0.00e+00	1.53e-71	9.69e-82	0.9567
1. PBF	Q8Y0I0	GTPase Era	0.00e+00	1.06e-68	1.37e-53	0.9259
1. PBF	P58070	GTPase Era	0.00e+00	5.06e-74	1.28e-62	0.9119
1. PBF	A8YVM7	GTPase Era	0.00e+00	2.33e-76	8.16e-73	0.9334
1. PBF	C1KVA9	GTPase Era	0.00e+00	2.45e-73	9.55e-78	0.9573
1. PBF	Q2P2T5	GTPase Der	1.69e-07	6.04e-03	1.68e-11	0.4868
1. PBF	Q5SM23	GTPase Era	0.00e+00	6.41e-70	1.36e-54	0.918
1. PBF	Q4USF8	GTPase Era	0.00e+00	9.90e-66	4.49e-54	0.9346
1. PBF	Q1R8G7	GTPase Era	0.00e+00	3.71e-73	5.62e-63	0.9123
1. PBF	A3CP94	GTPase Era	0.00e+00	2.53e-70	9.59e-82	0.9547
1. PBF	Q3K7C0	GTPase Der	8.65e-07	8.59e-03	2.31e-13	0.4293
1. PBF	B1IBC9	GTPase Era	0.00e+00	5.94e-68	1.53e-81	0.9549
1. PBF	P9WNK8	GTPase Era	0.00e+00	1.50e-70	6.58e-66	0.9455
1. PBF	A1SHZ4	GTPase Era	0.00e+00	2.70e-66	1.86e-57	0.933
1. PBF	A5F3E6	GTPase Der	4.52e-07	2.38e-02	1.29e-14	0.4507
1. PBF	B9M913	GTPase Era	0.00e+00	2.46e-70	5.63e-77	0.9606
1. PBF	Q48EV4	GTPase Era	0.00e+00	4.14e-71	4.10e-57	0.9172
1. PBF	B8D7F4	GTPase Era	0.00e+00	6.36e-47	2.69e-30	0.9168
1. PBF	A0QEB0	GTPase Era	0.00e+00	2.10e-69	4.57e-67	0.9277
1. PBF	O87407	GTPase Der	4.57e-07	4.81e-03	6.58e-07	0.4633
1. PBF	P64086	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9704
1. PBF	Q82XU6	GTPase Der	4.97e-07	4.39e-03	2.08e-08	0.461
1. PBF	P47627	GTPase Era	1.50e-11	5.13e-52	8.89e-13	0.6625
1. PBF	P43728	GTPase Era	0.00e+00	1.58e-72	5.19e-59	0.9359
1. PBF	Q5HFJ3	GTPase Era	0.00e+00	6.42e-71	2.84e-82	0.9692
1. PBF	Q9ZLW0	GTPase Era	0.00e+00	3.91e-59	1.02e-52	0.9114
1. PBF	C1C6U6	GTPase Era	0.00e+00	5.45e-68	1.98e-81	0.9528
1. PBF	O67800	GTPase Era	0.00e+00	6.42e-71	2.16e-51	0.936
1. PBF	Q88MY4	GTPase Era	0.00e+00	7.33e-72	4.29e-56	0.9129
1. PBF	A8AD18	GTPase Era	0.00e+00	1.78e-72	5.15e-63	0.9174
1. PBF	Q8CP21	GTPase Era	0.00e+00	1.67e-66	5.63e-79	0.9711
1. PBF	P56059	GTPase Era	0.00e+00	2.31e-60	3.56e-53	0.9161
1. PBF	Q8DC75	GTPase Era	0.00e+00	7.01e-47	4.42e-58	0.9048
1. PBF	Q4L6R7	GTPase Era	0.00e+00	1.81e-66	6.63e-79	0.9604
1. PBF	Q7NWC3	GTPase Era	0.00e+00	1.24e-73	6.02e-51	0.9121
1. PBF	A6LRP9	GTPase Era	0.00e+00	1.08e-77	2.72e-81	0.959
1. PBF	P0A563	GTPase Era	0.00e+00	1.50e-70	6.58e-66	0.9463
1. PBF	C4ZYI9	GTPase Era	0.00e+00	1.77e-73	8.65e-63	0.9262
1. PBF	Q8JIF5	GTPase Era, mitochondrial	0.00e+00	1.26e-02	9.15e-13	0.8037
1. PBF	Q7VL76	GTPase Era	0.00e+00	1.58e-69	8.07e-60	0.9175
1. PBF	C1AQS7	GTPase Era	0.00e+00	1.50e-70	6.58e-66	0.9467
1. PBF	Q985A5	GTPase Era	0.00e+00	2.00e-55	1.68e-57	0.9105
1. PBF	B5ZBZ8	GTPase Era	0.00e+00	6.87e-79	7.25e-57	0.9156
1. PBF	Q8YG75	GTPase Era	0.00e+00	3.16e-47	1.85e-54	0.9157
1. PBF	B1AJD1	GTPase Era	0.00e+00	1.30e-77	6.50e-58	0.9048
1. PBF	P0A3C2	GTPase Era	0.00e+00	6.42e-75	3.02e-75	0.9461
1. PBF	C0PYG8	GTPase Era	0.00e+00	1.83e-74	4.61e-62	0.9152
1. PBF	Q9PPZ9	GTPase Era	0.00e+00	1.30e-77	6.50e-58	0.9232
1. PBF	Q57LJ0	GTPase Der	3.98e-07	4.70e-02	9.33e-15	0.4401
1. PBF	Q8RGM1	GTPase Era	0.00e+00	1.35e-76	1.44e-74	0.9495
1. PBF	A8GM80	GTPase Era	0.00e+00	5.01e-69	1.08e-50	0.9235
1. PBF	A8FL79	GTPase Era	0.00e+00	3.48e-70	7.43e-49	0.9216
1. PBF	B2S3D3	GTPase Era	0.00e+00	2.61e-58	6.37e-43	0.8911
3. BF	C5D3F4	GTPase Der	1.75e-07	NA	1.18e-10	0.4449
3. BF	B5Z0Y0	GTPase Der	5.71e-07	NA	3.69e-14	0.4365
3. BF	A0LJ92	GTPase Der	2.40e-07	NA	5.90e-12	0.4356
3. BF	B7UGV7	GTPase Der	4.80e-07	NA	3.46e-14	0.4392
3. BF	A9IXE1	Probable GTP-binding protein EngB	1.46e-10	NA	0.003	0.7256
3. BF	A1VZU7	tRNA modification GTPase MnmE	5.14e-04	NA	2.92e-08	0.521
3. BF	Q7VM29	GTPase Der	4.45e-07	NA	1.27e-13	0.4477
3. BF	Q7N702	GTPase Der	6.45e-07	NA	3.46e-13	0.438
3. BF	Q8A135	GTPase Der	1.41e-06	NA	7.05e-08	0.4199
3. BF	A6LEP5	GTPase Der	1.06e-06	NA	6.36e-07	0.4158
3. BF	A6KXK1	GTPase Der	8.37e-04	NA	3.09e-07	0.4448
3. BF	Q834T4	GTPase Der	2.91e-07	NA	2.55e-11	0.4241
3. BF	B1YR40	GTPase Der	2.99e-07	NA	2.47e-08	0.4509
3. BF	B1I462	GTPase Der	1.85e-07	NA	3.99e-10	0.5608
3. BF	Q0P5E7	GTP-binding protein 8	5.05e-10	NA	0.026	0.7137
3. BF	Q8G2E8	GTPase Der	1.34e-06	NA	1.25e-08	0.4311
3. BF	A1TM31	GTPase Der	3.61e-07	NA	1.20e-07	0.4395
3. BF	A1JKS6	GTPase Der	4.64e-07	NA	8.49e-13	0.438
3. BF	Q668A3	GTPase Der	6.91e-07	NA	5.12e-13	0.4372
3. BF	Q5WEP2	Probable GTP-binding protein EngB	3.48e-13	NA	3.06e-04	0.7607
3. BF	Q9ZG89	GTP-binding protein EngB	6.48e-10	NA	3.84e-05	0.6979
3. BF	A8A317	GTPase Der	4.40e-07	NA	3.69e-14	0.4392
3. BF	A3CPT0	GTPase Der	3.31e-07	NA	6.23e-12	0.4476
3. BF	B3QS35	Probable GTP-binding protein EngB	9.04e-11	NA	0.002	0.7558
3. BF	C3P591	GTPase Der	1.82e-07	NA	3.10e-10	0.4408
3. BF	B8H1E7	Probable GTP-binding protein EngB	5.42e-10	NA	3.84e-05	0.7056
3. BF	B2IRW4	GTPase Der	7.50e-07	NA	8.68e-12	0.4356
3. BF	Q2JV46	GTPase Der	2.46e-07	NA	8.74e-10	0.4338
3. BF	A7Z636	GTPase Der	1.62e-07	NA	7.63e-12	0.4362
3. BF	Q8FF59	GTPase Der	4.09e-07	NA	3.94e-14	0.4406
3. BF	B5ZYX3	GTPase Der	1.45e-06	NA	1.09e-06	0.4382
3. BF	Q4L6I0	GTPase Der	2.52e-07	NA	8.28e-11	0.4171
3. BF	A5N2K5	Probable GTP-binding protein EngB	3.38e-12	NA	6.11e-05	0.726
3. BF	Q8EQA8	GTPase Der	2.59e-07	NA	5.47e-10	0.4449
3. BF	A5UY19	tRNA modification GTPase MnmE	3.22e-05	NA	4.13e-06	0.6598
3. BF	Q6GGT6	GTPase Der	3.01e-07	NA	1.65e-10	0.4406
3. BF	Q5M5X5	GTPase Der	2.49e-07	NA	2.27e-10	0.4255
3. BF	B1YJV8	Probable GTP-binding protein EngB	2.10e-13	NA	0.017	0.6995
3. BF	Q7V2S6	GTPase Der	4.07e-07	NA	2.86e-09	0.4476
3. BF	A0RBV9	GTPase Der	2.13e-07	NA	3.10e-10	0.4417
3. BF	A6LNG7	GTPase Der	6.19e-06	NA	2.62e-09	0.4545
3. BF	Q2W7M7	GTPase Der	2.43e-06	NA	3.73e-07	0.417
3. BF	P64058	GTPase Der	6.02e-07	NA	3.22e-06	0.4351
3. BF	B7GH28	Probable GTP-binding protein EngB	8.26e-13	NA	0.047	0.7255
3. BF	Q6G8Q2	Probable GTP-binding protein EngB	5.24e-13	NA	3.85e-05	0.7271
3. BF	Q74AX4	GTPase Der	3.98e-07	NA	1.73e-12	0.4291
3. BF	C3MF47	Probable GTP-binding protein EngB	1.10e-10	NA	0.005	0.6847
3. BF	O84709	GTPase Der	1.74e-06	NA	4.05e-08	0.4154
3. BF	Q92UK6	GTPase Der	1.27e-06	NA	2.09e-07	0.4336
3. BF	B1JSA4	GTPase Der	5.50e-07	NA	5.82e-13	0.4357
3. BF	B0B8S9	GTPase Der	1.37e-06	NA	4.16e-08	0.418
3. BF	A3NPX5	tRNA modification GTPase MnmE	5.85e-05	NA	7.32e-06	0.5837
3. BF	A0QH59	GTPase Der	6.45e-07	NA	5.96e-05	0.4333
3. BF	C0RH89	GTPase Der	2.02e-06	NA	1.28e-08	0.4209
3. BF	B1I766	GTPase Der	4.95e-07	NA	8.68e-12	0.4528
3. BF	Q2J2B7	Probable GTP-binding protein EngB	8.66e-12	NA	0.015	0.7511
3. BF	C5BES7	GTPase Der	3.36e-07	NA	1.08e-13	0.4387
3. BF	A6SZW6	GTPase Der	4.06e-07	NA	5.43e-10	0.4335
3. BF	Q2FGW7	GTPase Der	2.98e-07	NA	2.26e-09	0.4399
3. BF	B3CL86	Probable GTP-binding protein EngB	3.20e-12	NA	0.015	0.7215
3. BF	Q2SRR7	GTPase Der	2.33e-07	NA	7.61e-12	0.436
3. BF	B3E421	GTPase Der	2.84e-07	NA	3.89e-12	0.4426
3. BF	Q3JXI0	tRNA modification GTPase MnmE	6.07e-05	NA	7.45e-06	0.5667
3. BF	Q47WC5	GTPase Der	4.49e-07	NA	3.01e-11	0.4481
3. BF	B1XAY6	GTPase Der	4.35e-07	NA	3.69e-14	0.4377
3. BF	A3MS17	tRNA modification GTPase MnmE	6.81e-05	NA	7.32e-06	0.4192
3. BF	B3QLF4	GTPase Der	6.32e-07	NA	5.41e-07	0.4453
3. BF	C1CSX0	GTPase Der	3.08e-07	NA	8.68e-12	0.4271
3. BF	Q9Z762	GTPase Der	1.46e-06	NA	3.18e-10	0.4219
3. BF	C5CEL1	Probable GTP-binding protein EngB	3.53e-12	NA	1.25e-08	0.7702
3. BF	B7IDZ1	Probable GTP-binding protein EngB	5.15e-11	NA	3.56e-06	0.7045
3. BF	B7M7L5	GTPase Der	3.71e-07	NA	3.69e-14	0.4408
3. BF	Q74JL6	GTPase Der	3.25e-07	NA	1.55e-09	0.5673
3. BF	B9J8E2	Probable GTP-binding protein EngB	3.48e-10	NA	0.005	0.7223
3. BF	Q986D9	GTPase Der	2.87e-06	NA	1.13e-06	0.4216
3. BF	Q7VDI8	GTPase Der	1.92e-07	NA	1.71e-08	0.4213
3. BF	B8D8G4	GTPase Der	1.89e-07	NA	6.04e-09	0.4388
3. BF	Q030L6	GTPase Der	7.03e-07	NA	7.07e-10	0.4405
3. BF	Q64NV3	GTPase Der	1.42e-06	NA	2.29e-07	0.4279
3. BF	Q63DM8	GTPase Der	1.81e-07	NA	3.10e-10	0.4351
3. BF	Q5L8K8	GTPase Der	1.31e-06	NA	2.29e-07	0.409
3. BF	Q085U2	GTPase Der	5.42e-07	NA	1.10e-13	0.454
3. BF	Q3B6D1	Probable GTP-binding protein EngB	2.87e-13	NA	0.002	0.7023
3. BF	Q5HNN0	Probable GTP-binding protein EngB	3.34e-13	NA	4.15e-05	0.7699
3. BF	B2V5W6	GTPase Der	2.09e-07	NA	2.44e-11	0.4146
3. BF	Q633X5	Probable GTP-binding protein EngB	5.74e-13	NA	0.006	0.7401
3. BF	C4LC41	GTPase Der	5.26e-07	NA	5.73e-14	0.4336
3. BF	B1MYB5	GTPase Der	3.49e-07	NA	3.50e-13	0.4508
3. BF	Q81SW9	GTPase Der	1.48e-07	NA	3.10e-10	0.4492
3. BF	Q9X1F8	GTPase Der	1.60e-05	NA	4.67e-10	0.4279
3. BF	Q8ZCT9	GTPase Der	7.85e-07	NA	5.82e-13	0.4328
3. BF	P50743	GTPase Der	2.66e-07	NA	2.26e-11	0.4363
3. BF	B9DTQ3	GTPase Der	3.46e-07	NA	3.86e-11	0.436
3. BF	C1DE52	GTPase Der	6.45e-07	NA	1.64e-12	0.4461
3. BF	A4XY28	GTPase Der	7.19e-07	NA	2.46e-11	0.4535
3. BF	B5ZN41	Probable GTP-binding protein EngB	1.99e-10	NA	0.047	0.7186
3. BF	P57812	GTPase Der	9.05e-06	NA	1.62e-12	0.4268
3. BF	B7HQM9	Probable GTP-binding protein EngB	5.51e-13	NA	0.006	0.7395
3. BF	Q6HL51	GTPase Der	2.48e-07	NA	3.10e-10	0.4514
3. BF	C6DBH0	GTPase Der	1.09e-06	NA	4.44e-14	0.4423
3. BF	A6U5K8	Probable GTP-binding protein EngB	1.44e-10	NA	0.004	0.7181
3. BF	Q9EWW8	GTPase Der	5.42e-07	NA	1.50e-06	0.4239
3. BF	A7ZPV4	GTPase Der	6.20e-07	NA	3.69e-14	0.4355
3. BF	Q0BU77	Probable GTP-binding protein EngB	8.05e-11	NA	5.44e-04	0.719
3. BF	A8Z2J4	Probable GTP-binding protein EngB	2.98e-13	NA	3.85e-05	0.7701
3. BF	B1LBK5	Probable GTP-binding protein EngB	1.32e-11	NA	5.33e-12	0.752
3. BF	Q11KI3	GTPase Der	1.87e-06	NA	9.36e-07	0.4227
3. BF	A5I4V0	GTPase Der	7.69e-07	NA	2.22e-11	0.4335
3. BF	C3P9F4	Probable GTP-binding protein EngB	8.48e-13	NA	0.006	0.7327
3. BF	B2SXS6	GTPase Der	4.89e-07	NA	3.15e-08	0.4464
3. BF	B5FAX6	GTPase Der	8.02e-06	NA	1.57e-12	0.434
3. BF	A8F732	tRNA modification GTPase MnmE	6.93e-05	NA	2.80e-10	0.5513
3. BF	Q10VJ7	tRNA modification GTPase MnmE	1.11e-04	NA	4.84e-10	0.4278
3. BF	D2GU20	GTPase Era, mitochondrial	0.00e+00	NA	3.32e-17	0.7956
3. BF	A0AK49	GTPase Der	3.02e-07	NA	2.72e-11	0.4307
3. BF	B7MYE6	GTPase Der	3.97e-07	NA	3.83e-14	0.4407
3. BF	Q13F29	Probable GTP-binding protein EngB	1.33e-12	NA	0.040	0.7634
3. BF	A7GTE8	Probable GTP-binding protein EngB	9.65e-13	NA	0.036	0.7343
3. BF	A8EZN9	GTPase Der	3.66e-07	NA	1.42e-08	0.4248
3. BF	C5D5L1	Probable GTP-binding protein EngB	3.01e-13	NA	0.002	0.7393
3. BF	Q6HD57	Probable GTP-binding protein EngB	6.96e-13	NA	0.006	0.7393
3. BF	O51881	GTPase Der	1.03e-07	NA	9.89e-11	0.4581
3. BF	A1BJ02	Probable GTP-binding protein EngB	1.22e-12	NA	0.015	0.7874
3. BF	B1IWF0	GTPase Der	4.40e-07	NA	3.69e-14	0.4303
3. BF	B9DNV9	GTPase Der	2.36e-07	NA	1.92e-11	0.4492
3. BF	A5IMB8	Probable GTP-binding protein EngB	1.40e-11	NA	2.86e-12	0.7596
3. BF	B2S9M3	GTPase Der	2.11e-06	NA	1.35e-08	0.4348
3. BF	B3EP28	Probable GTP-binding protein EngB	1.46e-13	NA	0.035	0.81
3. BF	B3QZ96	GTPase Der	2.37e-07	NA	1.34e-07	0.4408
3. BF	Q57EY6	GTPase Der	2.07e-06	NA	1.35e-08	0.4206
3. BF	Q03SA1	GTPase Der	2.78e-07	NA	8.09e-14	0.4182
3. BF	Q6NC42	Probable GTP-binding protein EngB	1.09e-11	NA	0.029	0.7528
3. BF	Q5HUK3	tRNA modification GTPase MnmE	7.30e-04	NA	1.71e-08	0.5086
3. BF	O82626	GTP-binding protein ERG	0.00e+00	NA	3.00e-25	0.842
3. BF	A4SCU1	Probable GTP-binding protein EngB	2.97e-13	NA	0.032	0.7451
3. BF	Q04J64	GTPase Der	3.40e-07	NA	8.68e-12	0.4653
3. BF	B8ZMH4	GTPase Der	2.59e-07	NA	8.68e-12	0.4353
3. BF	Q8CS80	Probable GTP-binding protein EngB	1.93e-13	NA	4.15e-05	0.7745
3. BF	Q5KXT0	GTPase Der	1.88e-07	NA	1.20e-12	0.4468
3. BF	C3L700	Probable GTP-binding protein EngB	5.82e-13	NA	0.006	0.7404
3. BF	Q6YPI0	tRNA modification GTPase MnmE	1.91e-04	NA	2.32e-04	0.4191
3. BF	B1AIQ5	Probable GTP-binding protein EngB	4.97e-08	NA	6.36e-04	0.7583
3. BF	B7HHQ7	GTPase Der	1.78e-07	NA	3.10e-10	0.4406
3. BF	Q6D280	GTPase Der	4.44e-07	NA	8.42e-14	0.4447
3. BF	Q8UD28	GTPase Der	9.98e-07	NA	3.12e-09	0.434
3. BF	Q46ZI7	GTPase Der	2.88e-07	NA	2.52e-08	0.4565
3. BF	A6VV10	GTPase Der	3.08e-07	NA	8.21e-12	0.4517
3. BF	Q1J8C9	GTPase Der	3.39e-07	NA	2.24e-11	0.4405
3. BF	Q3KKZ1	GTPase Der	1.93e-06	NA	4.12e-08	0.4203
3. BF	B3EGV8	Probable GTP-binding protein EngB	6.89e-14	NA	1.29e-05	0.7765
3. BF	B2UMV5	GTPase Der	4.24e-07	NA	7.53e-08	0.4175
3. BF	Q30TK8	GTPase Der	4.64e-07	NA	3.83e-11	0.4328
3. BF	P64060	GTPase Der	2.52e-07	NA	1.65e-10	0.4377
3. BF	Q11QK1	GTPase Der	1.06e-06	NA	6.30e-08	0.5968
3. BF	Q1RK21	GTPase Der	4.35e-07	NA	6.55e-09	0.4275
3. BF	Q7URJ8	GTPase Der	3.52e-07	NA	1.33e-07	0.4262
3. BF	B0CK66	GTPase Der	2.33e-06	NA	1.28e-08	0.4226
3. BF	A0LE48	tRNA modification GTPase MnmE	3.87e-05	NA	2.69e-07	0.4039
3. BF	B7JGY9	GTPase Der	1.91e-07	NA	3.10e-10	0.4415
3. BF	A8GHW1	GTPase Der	5.84e-07	NA	3.39e-14	0.4325
3. BF	Q1CK87	GTPase Der	6.64e-07	NA	5.82e-13	0.4335
3. BF	A2RM49	GTPase Der	3.93e-07	NA	7.07e-10	0.4435
3. BF	A6U1U3	GTPase Der	3.99e-07	NA	1.65e-10	0.4384
3. BF	Q5M1D9	GTPase Der	2.81e-07	NA	2.27e-10	0.4281
3. BF	Q4UMV9	GTPase Der	1.33e-07	NA	4.42e-08	0.4323
3. BF	A9AH00	GTPase Der	3.22e-07	NA	5.07e-09	0.4617
3. BF	B8E9T1	GTPase Der	5.60e-07	NA	5.06e-13	0.4149
3. BF	B0BUT3	GTPase Der	4.62e-07	NA	2.86e-08	0.4214
3. BF	A1VNF8	GTPase Der	3.05e-07	NA	8.66e-07	0.4454
3. BF	Q817Q5	Probable GTP-binding protein EngB	6.15e-13	NA	0.023	0.7342
3. BF	Q9WYA4	tRNA modification GTPase MnmE	1.56e-04	NA	8.08e-10	0.3873
3. BF	A0KBN1	tRNA modification GTPase MnmE	4.09e-05	NA	7.24e-05	0.4217
3. BF	Q119L7	GTPase Der	2.73e-07	NA	6.82e-13	0.4376
3. BF	Q17ZA7	tRNA modification GTPase MnmE	1.53e-04	NA	4.78e-08	0.5686
3. BF	Q8Y026	GTPase Der	3.14e-07	NA	2.91e-08	0.4304
3. BF	Q7WHN4	GTPase Der	4.58e-07	NA	5.69e-08	0.4314
3. BF	B3QCI1	Probable GTP-binding protein EngB	1.34e-11	NA	0.031	0.7628
3. BF	P74120	GTPase Der	1.85e-07	NA	1.42e-13	0.4553
3. BF	Q0BEX1	GTPase Der	2.98e-07	NA	2.32e-08	0.454
3. BF	Q1MDD6	GTPase Der	1.17e-06	NA	2.17e-06	0.4318
3. BF	A7MGU7	GTPase Der	4.55e-07	NA	4.67e-14	0.4296
3. BF	P64061	GTPase Der	3.22e-07	NA	1.65e-10	0.4258
3. BF	C3MG60	GTPase Der	1.42e-06	NA	1.29e-07	0.5013
3. BF	Q5HFU8	GTPase Der	2.81e-07	NA	1.65e-10	0.4254
3. BF	B6I583	GTPase Der	4.28e-07	NA	3.69e-14	0.4401
3. BF	A4IQA2	GTPase Der	1.97e-07	NA	5.78e-12	0.4472
3. BF	Q2YJR1	Probable GTP-binding protein EngB	2.06e-10	NA	0.010	0.7261
3. BF	A4G4K6	GTPase Der	2.89e-07	NA	1.29e-08	0.4518
3. BF	B1LNG6	GTPase Der	3.81e-07	NA	3.83e-14	0.4404
3. BF	C1CM45	GTPase Der	7.26e-07	NA	8.68e-12	0.4471
3. BF	B4SC74	Probable GTP-binding protein EngB	1.07e-13	NA	5.23e-05	0.7643
3. BF	A7NN19	tRNA modification GTPase MnmE	2.93e-05	NA	4.97e-05	0.6402
3. BF	A4VX53	GTPase Der	3.55e-07	NA	1.23e-12	0.4211
3. BF	B9K8C0	Probable GTP-binding protein EngB	8.99e-12	NA	7.56e-11	0.7738
3. BF	Q7V491	tRNA modification GTPase MnmE	1.04e-04	NA	3.27e-06	0.5732
3. BF	A6TCD0	GTPase Der	3.81e-07	NA	1.51e-14	0.4377
3. BF	Q2K5L2	GTPase Der	1.37e-06	NA	1.03e-06	0.4415
3. BF	A4JEN6	GTPase Der	3.00e-07	NA	2.34e-08	0.4607
3. BF	Q11LE3	Probable GTP-binding protein EngB	3.46e-10	NA	0.003	0.7391
3. BF	Q8DY73	GTPase Der	6.47e-07	NA	3.83e-08	0.4242
3. BF	Q21W32	GTPase Der	2.81e-07	NA	3.79e-08	0.4244
3. BF	P9WNL2	GTPase Der	5.24e-07	NA	3.22e-06	0.438
3. BF	B4S433	GTPase Der	7.70e-07	NA	5.23e-10	0.4219
3. BF	B3QQY9	Probable GTP-binding protein EngB	4.62e-14	NA	0.024	0.7869
3. BF	A7HYV8	GTPase Der	3.29e-06	NA	3.07e-11	0.4082
3. BF	Q828Y7	GTPase Der	1.04e-06	NA	8.75e-07	0.4235
3. BF	Q02RV3	GTPase Der	6.79e-07	NA	6.56e-12	0.4581
3. BF	Q9PLM3	GTPase Der	1.81e-06	NA	4.70e-09	0.408
3. BF	B7HEA1	Probable GTP-binding protein EngB	5.70e-13	NA	0.023	0.7293
3. BF	B5E756	GTPase Der	3.90e-07	NA	8.68e-12	0.4665
3. BF	C1EN01	GTPase Der	2.12e-07	NA	3.10e-10	0.4415
3. BF	A9R7Z8	GTPase Der	6.72e-07	NA	5.82e-13	0.4331
3. BF	C1A8T3	GTPase Der	4.66e-07	NA	1.36e-10	0.3973
3. BF	A3N480	tRNA modification GTPase MnmE	4.93e-05	NA	7.32e-06	0.5852
3. BF	A5IXT1	Probable GTP-binding protein EngB	1.52e-11	NA	2.59e-05	0.7251
3. BF	Q9TLX6	Probable tRNA modification GTPase MnmE	4.62e-05	NA	2.51e-07	0.6433
3. BF	B5X2B8	GTPase Era, mitochondrial	0.00e+00	NA	1.64e-12	0.826
3. BF	B8D8C1	GTPase Der	1.63e-07	NA	6.10e-09	0.4395
3. BF	Q3B1B4	tRNA modification GTPase MnmE	9.71e-05	NA	7.32e-09	0.6019
3. BF	A1BHZ8	GTPase Der	3.93e-07	NA	1.57e-08	0.4197
3. BF	B1YQJ5	tRNA modification GTPase MnmE	5.54e-05	NA	6.80e-05	0.4288
3. BF	Q2JM09	GTPase Der	1.94e-07	NA	3.44e-10	0.4212
3. BF	A8LYU3	GTPase Der	1.02e-06	NA	1.13e-05	0.4754
3. BF	A4W3F7	GTPase Der	3.50e-07	NA	1.23e-12	0.4219
3. BF	A1URU0	GTPase Der	2.07e-06	NA	2.57e-09	0.4046
3. BF	A1KJD0	GTPase Der	5.06e-07	NA	3.22e-06	0.4334
3. BF	Q92SF6	Probable GTP-binding protein EngB	1.02e-10	NA	0.005	0.6998
3. BF	B7UWJ2	GTPase Der	7.01e-07	NA	3.32e-12	0.4545
3. BF	Q12AC2	GTPase Der	2.96e-07	NA	7.32e-07	0.4609
3. BF	A0RJ86	Probable GTP-binding protein EngB	8.08e-13	NA	0.006	0.7393
3. BF	A9VIU3	Probable GTP-binding protein EngB	5.88e-13	NA	0.005	0.7352
3. BF	Q6G2G5	Probable GTP-binding protein EngB	1.36e-10	NA	4.21e-05	0.7386
3. BF	P64066	Probable GTP-binding protein EngB	2.13e-10	NA	0.010	0.7231
3. BF	A9BMU9	GTPase Der	4.14e-07	NA	1.54e-06	0.4455
3. BF	B2VE93	GTPase Der	6.12e-07	NA	8.32e-14	0.4384
3. BF	A5IMD9	GTPase Der	1.56e-05	NA	2.29e-08	0.4398
3. BF	Q9ZCP6	GTPase Der	1.98e-07	NA	6.70e-10	0.435
3. BF	Q740D6	GTPase Der	3.22e-07	NA	5.50e-05	0.4359
3. BF	B0JFL6	GTPase Der	2.20e-07	NA	2.10e-13	0.4296
3. BF	A4TMT3	GTPase Der	6.25e-07	NA	5.82e-13	0.4325
3. BF	P0DA91	GTPase Der	3.69e-07	NA	1.09e-11	0.4266
3. BF	Q72ZV7	Probable GTP-binding protein EngB	6.64e-13	NA	0.006	0.7338
3. BF	A8HVL5	GTPase Der	1.28e-06	NA	1.78e-08	0.4315
3. BF	C3L9F4	GTPase Der	2.19e-07	NA	3.10e-10	0.4417
3. BF	Q38WW3	GTPase Der	3.40e-07	NA	2.41e-11	0.4191
3. BF	A3MK70	GTPase Der	3.78e-07	NA	2.34e-08	0.4587
3. BF	Q9CHH6	GTPase Der	4.53e-07	NA	5.73e-10	0.4402
3. BF	A6WQP3	GTPase Der	6.36e-07	NA	5.06e-13	0.4147
3. BF	Q9ZJG6	tRNA modification GTPase MnmE	1.57e-04	NA	1.96e-09	0.5397
3. BF	P64067	Probable GTP-binding protein EngB	1.84e-10	NA	0.010	0.7296
3. BF	A0Q2K7	Probable GTP-binding protein EngB	1.35e-12	NA	0.016	0.7719
3. BF	Q4A647	tRNA modification GTPase MnmE	3.00e-04	NA	1.43e-09	0.3656
3. BF	B4EZS9	GTPase Der	4.59e-07	NA	3.59e-14	0.4453
3. BF	C3PPD1	GTPase Der	2.14e-07	NA	4.46e-08	0.4186
3. BF	Q8R9J1	GTPase Der	6.97e-07	NA	2.00e-11	0.4029
3. BF	Q89A14	GTPase Der	3.54e-07	NA	8.87e-06	0.4284
3. BF	Q1JIH4	GTPase Der	3.37e-07	NA	2.24e-11	0.435
3. BF	Q5FKF4	GTPase Der	2.93e-07	NA	7.79e-09	0.4364
3. BF	B0KBA1	Probable GTP-binding protein EngB	3.35e-12	NA	4.36e-04	0.702
3. BF	Q16AA3	Probable GTP-binding protein EngB	1.03e-12	NA	0.028	0.7574
3. BF	C6E0Y6	GTPase Der	2.39e-07	NA	7.15e-08	0.4243
3. BF	Q576T9	Probable GTP-binding protein EngB	1.82e-10	NA	0.010	0.7247
3. BF	A5G9V3	tRNA modification GTPase MnmE	2.78e-04	NA	5.88e-08	0.3855
3. BF	C4XIQ6	GTPase Der	3.60e-07	NA	2.55e-08	0.4361
3. BF	C4ZX86	GTPase Der	4.32e-07	NA	3.69e-14	0.439
3. BF	B3PVJ6	GTPase Der	1.37e-06	NA	1.00e-06	0.4421
3. BF	Q748I9	Probable GTP-binding protein EngB	1.77e-12	NA	0.008	0.7195
3. BF	B2JIU7	GTPase Der	4.09e-07	NA	3.68e-08	0.4503
3. BF	B2K9P6	GTPase Der	5.47e-07	NA	5.12e-13	0.4325
3. BF	B5EE25	GTPase Der	2.34e-07	NA	7.02e-08	0.4452
3. BF	Q2RP11	Probable GTP-binding protein EngB	7.76e-12	NA	5.04e-04	0.7968
3. BF	A7ZCZ1	tRNA modification GTPase MnmE	2.33e-04	NA	3.27e-06	0.361
3. BF	Q5HW81	GTPase Der	5.99e-07	NA	5.63e-07	0.4127
3. BF	Q9RNL6	GTP-binding protein EngB	1.56e-10	NA	0.003	0.7182
3. BF	B1LBI4	GTPase Der	1.24e-05	NA	3.09e-10	0.4325
3. BF	A1SU43	GTPase Der	5.86e-07	NA	5.82e-13	0.437
3. BF	A4WD89	GTPase Der	4.26e-07	NA	1.66e-13	0.4284
3. BF	B7HL14	GTPase Der	2.05e-07	NA	3.10e-10	0.4416
3. BF	Q7MT48	GTPase Der	1.09e-06	NA	1.23e-08	0.4315
3. BF	Q6AGF6	GTPase Der	1.89e-04	NA	2.65e-07	0.4486
3. BF	Q92GU2	GTPase Der	2.31e-07	NA	3.83e-08	0.4243
3. BF	P0A6P6	GTPase Der	4.27e-07	NA	3.69e-14	0.4392
3. BF	Q5E768	GTPase Der	1.07e-05	NA	1.57e-12	0.435
3. BF	A8MH56	GTPase Der	3.26e-07	NA	6.91e-16	0.4327
3. BF	C4K2K1	GTPase Der	2.97e-07	NA	3.83e-08	0.4303
3. BF	A5IT03	GTPase Der	2.51e-07	NA	1.65e-10	0.4367
3. BF	A8Z454	GTPase Der	2.42e-07	NA	2.26e-09	0.4399
3. BF	Q0T208	GTPase Der	3.93e-07	NA	3.59e-14	0.4405
3. BF	Q1IRA2	Probable GTP-binding protein EngB	5.33e-11	NA	0.001	0.7336
3. BF	O25991	tRNA modification GTPase MnmE	1.68e-04	NA	3.99e-09	0.5501
3. BF	A5VNV9	GTPase Der	2.45e-06	NA	1.21e-08	0.4316
3. BF	Q9PNX9	tRNA modification GTPase MnmE	1.77e-04	NA	2.87e-08	0.5042
3. BF	C5CIV1	GTPase Der	2.81e-07	NA	4.69e-10	0.4687
3. BF	B8F4X7	GTPase Der	7.31e-07	NA	4.23e-13	0.4468
3. BF	A2S2A6	GTPase Der	3.40e-07	NA	2.34e-08	0.4563
3. BF	Q46H20	GTPase Der	2.84e-07	NA	9.53e-10	0.4277
3. BF	Q7NGF9	GTPase Der	3.11e-07	NA	3.03e-10	0.4375
3. BF	B9JZQ5	GTPase Der	1.59e-06	NA	2.15e-06	0.431
3. BF	Q39BQ4	tRNA modification GTPase MnmE	4.26e-05	NA	6.92e-05	0.4286
3. BF	Q2GAU7	Probable GTP-binding protein EngB	1.25e-11	NA	0.001	0.7783
3. BF	Q3APK7	Probable GTP-binding protein EngB	1.19e-13	NA	0.011	0.7934
3. BF	A9IQH4	GTPase Der	2.03e-06	NA	9.97e-10	0.4307
3. BF	A2C0J7	GTPase Der	2.19e-07	NA	1.01e-09	0.4272
3. BF	C1ANY6	GTPase Der	5.69e-07	NA	3.22e-06	0.4354
3. BF	B1JT88	GTPase Der	2.88e-07	NA	2.15e-08	0.451
3. BF	B9K8E0	GTPase Der	1.49e-05	NA	2.61e-07	0.4345
3. BF	A1K3Z3	GTPase Der	2.66e-07	NA	1.53e-08	0.429
3. BF	B9IVM6	GTPase Der	1.65e-07	NA	3.10e-10	0.4407
3. BF	A7IIE4	GTPase Der	7.17e-07	NA	8.48e-08	0.432
3. BF	Q03MB1	GTPase Der	2.95e-07	NA	3.10e-10	0.4266
3. BF	Q49884	GTPase Der	5.96e-07	NA	1.55e-06	0.4374
3. BF	A9M8F4	GTPase Der	1.96e-06	NA	1.25e-08	0.4243
3. BF	A9VMB3	GTPase Der	2.74e-07	NA	1.36e-11	0.4457
3. BF	B2TXT6	GTPase Der	4.40e-07	NA	3.59e-14	0.4391
3. BF	Q3SN20	Probable GTP-binding protein EngB	1.56e-11	NA	0.013	0.7683
3. BF	Q6G988	GTPase Der	2.96e-07	NA	1.65e-10	0.5749
3. BF	B7IIY0	Probable GTP-binding protein EngB	2.75e-12	NA	0.008	0.7294
3. BF	Q8RGV7	GTPase Der	3.77e-07	NA	2.51e-10	0.4389
3. BF	A4J3P1	GTPase Der	4.16e-07	NA	9.23e-12	0.4344
3. BF	Q81LC2	Probable GTP-binding protein EngB	6.49e-13	NA	0.006	0.7347
3. BF	Q63US9	GTPase Der	4.50e-07	NA	2.34e-08	0.4376
3. BF	Q8NQK6	GTPase Der	1.43e-06	NA	3.01e-08	0.4437
3. BF	Q1WTQ4	GTPase Der	2.93e-07	NA	8.37e-12	0.4434
3. BF	A6QH24	GTPase Der	2.62e-07	NA	1.65e-10	0.441
3. BF	B3DXK2	GTPase Der	4.74e-07	NA	8.37e-12	0.5638
3. BF	B9DNB9	Probable GTP-binding protein EngB	3.02e-13	NA	1.28e-04	0.7714
3. BF	Q7NAD9	tRNA modification GTPase MnmE	5.53e-04	NA	2.06e-11	0.5317
3. BF	B2A4M9	GTPase Der	1.79e-07	NA	1.49e-12	0.4273
3. BF	A3MZC1	GTPase Der	1.25e-05	NA	7.59e-14	0.4451
3. BF	A4YUE1	GTPase Der	1.20e-06	NA	6.68e-08	0.4393
3. BF	Q13X32	GTPase Der	4.02e-07	NA	3.15e-08	0.4601
3. BF	B2HRU9	GTPase Der	6.10e-07	NA	4.87e-05	0.4317
3. BF	Q39FR3	GTPase Der	3.15e-07	NA	2.13e-08	0.4353
3. BF	C1C8U6	GTPase Der	7.43e-07	NA	8.68e-12	0.4487
3. BF	B7JQ62	Probable GTP-binding protein EngB	6.05e-13	NA	0.006	0.739
3. BF	A9KLX9	tRNA modification GTPase MnmE	2.64e-03	NA	5.98e-09	0.5409
3. BF	A1V7D3	tRNA modification GTPase MnmE	5.15e-05	NA	7.32e-06	0.4197
3. BF	A8GPH5	GTPase Der	1.63e-07	NA	9.10e-09	0.4241
3. BF	Q65I15	GTPase Der	2.36e-07	NA	7.29e-12	0.4336
3. BF	Q71Y78	GTPase Der	2.75e-07	NA	2.82e-11	0.4242
3. BF	B4EAW5	GTPase Der	3.42e-07	NA	5.65e-09	0.4445
3. BF	Q88VE3	Probable GTP-binding protein EngB	5.90e-12	NA	0.002	0.6542
3. BF	A8GT93	GTPase Der	3.83e-07	NA	9.35e-09	0.4169
3. BF	Q5XDR3	GTPase Der	6.41e-07	NA	1.30e-11	0.4407
3. BF	Q47BS0	GTPase Der	2.57e-07	NA	1.66e-09	0.4174
3. BF	A7FFZ3	GTPase Der	6.95e-07	NA	5.82e-13	0.4367
3. BF	A5PK43	GTPase Era, mitochondrial	0.00e+00	NA	9.50e-17	0.7867
3. BF	P64059	GTPase Der	2.43e-07	NA	1.65e-10	0.4372
3. BF	Q8G6A8	GTPase Der	5.23e-07	NA	2.97e-06	0.4405
3. BF	B9E746	Probable GTP-binding protein EngB	6.19e-13	NA	0.004	0.7174
3. BF	Q0BAQ4	tRNA modification GTPase MnmE	3.73e-05	NA	6.92e-05	0.4131
3. BF	B5XJW0	GTPase Der	3.79e-07	NA	1.30e-11	0.4389
3. BF	A7HK07	tRNA modification GTPase MnmE	3.76e-04	NA	1.01e-11	0.3758
3. BF	A3D6V5	GTPase Der	7.37e-07	NA	5.06e-13	0.4231
3. BF	A5D1U6	GTPase Der	4.86e-07	NA	1.36e-07	0.4461
3. BF	A8YV35	GTPase Der	3.87e-07	NA	1.83e-08	0.4318
3. BF	Q73KN7	tRNA modification GTPase MnmE	7.50e-05	NA	4.59e-04	0.5881
3. BF	B9M914	GTPase Der	3.30e-07	NA	2.30e-09	0.4596
3. BF	Q3JZR6	GTPase Der	6.79e-07	NA	3.83e-08	0.4246
3. BF	B3R1J8	GTPase Der	3.66e-07	NA	2.20e-08	0.4496
3. BF	A8AD75	GTPase Der	3.99e-07	NA	9.87e-15	0.4399
3. BF	P64062	GTPase Der	7.34e-07	NA	8.68e-12	0.4478
3. BF	B7N699	GTPase Der	3.83e-07	NA	3.83e-14	0.4411
3. BF	Q88VZ6	GTPase Der	3.61e-07	NA	6.02e-14	0.4309
3. BF	Q8RC22	Probable GTP-binding protein EngB	1.22e-12	NA	7.01e-05	0.7632
3. BF	A9WKE3	tRNA modification GTPase MnmE	1.02e-04	NA	1.09e-05	0.4018
3. BF	Q8DS90	GTPase Der	3.20e-07	NA	5.78e-10	0.4246
3. BF	A1S859	GTPase Der	6.61e-07	NA	1.14e-13	0.4231
3. BF	P64063	GTPase Der	7.34e-07	NA	8.68e-12	0.4474
3. BF	Q68W59	GTPase Der	1.80e-07	NA	1.53e-08	0.4362
3. BF	Q1QMP4	GTPase Der	1.25e-06	NA	1.05e-07	0.4404
3. BF	A4JJ44	tRNA modification GTPase MnmE	5.78e-05	NA	2.08e-05	0.4124
3. BF	Q8YFH2	GTPase Der	2.34e-06	NA	1.28e-08	0.4226
3. BF	A2S8D8	tRNA modification GTPase MnmE	4.31e-05	NA	7.32e-06	0.4105
3. BF	A0PSX2	GTPase Der	5.83e-07	NA	5.00e-05	0.4339
3. BF	Q0TEX4	GTPase Der	4.53e-07	NA	3.94e-14	0.4383
3. BF	C4K4J2	GTPase Der	4.59e-07	NA	1.80e-12	0.4275
3. BF	Q6G0H5	GTPase Der	7.86e-07	NA	3.27e-09	0.4376
3. BF	Q2GA15	GTPase Der	9.31e-07	NA	6.59e-06	0.4138
3. BF	Q2RIV4	GTPase Der	3.31e-07	NA	2.78e-11	0.4429
3. BF	Q6G5J7	GTPase Der	1.62e-04	NA	1.59e-09	0.4214
3. BF	A7X2I1	GTPase Der	3.52e-07	NA	1.65e-10	0.4373
3. BF	B0S1N2	GTPase Der	6.47e-07	NA	4.87e-12	0.4204
3. BF	Q1JNC4	GTPase Der	3.51e-07	NA	1.30e-11	0.4404
3. BF	Q8E3T9	GTPase Der	3.89e-07	NA	3.08e-08	0.4207
3. BF	Q4L712	Probable GTP-binding protein EngB	3.34e-13	NA	4.87e-06	0.7766
3. BF	B7LCQ1	GTPase Der	5.43e-07	NA	3.69e-14	0.4373
3. BF	Q97FU0	Probable GTP-binding protein EngB	7.60e-11	NA	4.05e-05	0.7467
3. BF	A1TA72	GTPase Der	5.15e-07	NA	1.76e-07	0.4254
3. BF	Q8FTK5	GTPase Der	1.58e-06	NA	4.23e-10	0.4448
3. BF	A1R5C7	GTPase Der	8.23e-07	NA	4.42e-09	0.4256
3. BF	B9IZ44	Probable GTP-binding protein EngB	6.89e-13	NA	0.006	0.7333
3. BF	B6EGZ1	GTPase Der	1.04e-05	NA	6.31e-13	0.4299
3. BF	Q49XS9	GTPase Der	4.21e-07	NA	5.73e-12	0.4242
3. BF	Q8EX09	Probable GTP-binding protein EngB	1.69e-12	NA	0.032	0.6889
3. BF	A8F7S2	GTPase Der	2.40e-04	NA	1.56e-08	0.4793
3. BF	A6WW65	GTPase Der	1.96e-06	NA	2.21e-08	0.4112
3. BF	Q1C5J2	GTPase Der	1.12e-06	NA	5.82e-13	0.4334
3. BF	Q6MTJ6	GTPase Der	2.26e-07	NA	7.68e-12	0.4491
3. BF	A4X692	GTPase Der	9.12e-07	NA	1.11e-04	0.484
3. BF	B1KUB2	tRNA modification GTPase MnmE	5.44e-04	NA	3.25e-07	0.5662
3. BF	A1WE12	GTPase Der	5.41e-07	NA	1.21e-06	0.4251
3. BF	Q2NS44	GTPase Der	5.19e-07	NA	1.62e-13	0.4312
3. BF	B8CWY9	GTPase Der	2.76e-07	NA	1.32e-13	0.4652
3. BF	B7MHZ6	GTPase Der	4.17e-07	NA	3.83e-14	0.4393
3. BF	A3NA49	GTPase Der	3.76e-07	NA	2.34e-08	0.442
3. BF	C1ETR5	Probable GTP-binding protein EngB	5.70e-13	NA	0.006	0.7397
3. BF	A1KCP8	tRNA modification GTPase MnmE	9.54e-05	NA	3.47e-06	0.5618
3. BF	Q03WN4	GTPase Der	3.42e-07	NA	2.38e-10	0.429
3. BF	A6V0W4	GTPase Der	7.18e-07	NA	4.54e-12	0.4527
3. BF	Q9HXJ8	GTPase Der	7.00e-07	NA	4.54e-12	0.4438
3. BF	Q1BSF9	tRNA modification GTPase MnmE	4.05e-05	NA	7.24e-05	0.4216
3. BF	Q169E2	GTPase Der	2.39e-06	NA	1.06e-06	0.4275
3. BF	B7LKC7	GTPase Der	3.71e-07	NA	3.90e-14	0.4411
3. BF	Q6F1R7	GTPase Der	3.02e-07	NA	9.41e-13	0.4482
3. BF	A4VNW7	GTPase Der	8.02e-07	NA	9.12e-13	0.4517
3. BF	A7GYZ1	tRNA modification GTPase MnmE	2.04e-04	NA	3.26e-07	0.5159
3. BF	B2U9V3	GTPase Der	3.22e-07	NA	5.35e-08	0.4642
3. BF	Q3SR12	GTPase Der	7.53e-07	NA	3.72e-07	0.4217
3. BF	Q8CP62	GTPase Der	2.71e-07	NA	4.30e-12	0.4344
3. BF	Q8YN91	tRNA modification GTPase MnmE	7.69e-05	NA	6.07e-08	0.6081
3. BF	Q81FR5	GTPase Der	2.41e-07	NA	3.10e-10	0.4408
3. BF	B7NQW0	GTPase Der	3.53e-07	NA	3.94e-14	0.4425
3. BF	B7IP82	GTPase Der	2.16e-07	NA	2.77e-11	0.4441
3. BF	A7HZI3	GTPase Der	3.49e-07	NA	2.79e-11	0.4112
3. BF	A0K7T2	GTPase Der	3.09e-07	NA	2.15e-08	0.4433
3. BF	Q1CRH7	tRNA modification GTPase MnmE	3.13e-04	NA	3.88e-09	0.5333
3. BF	C1CFT0	GTPase Der	3.29e-07	NA	8.68e-12	0.4487
3. BF	B0CBB0	tRNA modification GTPase MnmE	1.29e-04	NA	8.22e-10	0.5979
3. BF	B2G718	GTPase Der	4.35e-07	NA	1.43e-12	0.447
3. BF	B9J7W1	GTPase Der	8.42e-07	NA	8.22e-07	0.4135
3. BF	B1K0Y2	tRNA modification GTPase MnmE	4.21e-05	NA	2.93e-05	0.4226
3. BF	Q63YV9	tRNA modification GTPase MnmE	9.53e-05	NA	7.32e-06	0.4199
3. BF	A5U372	GTPase Der	5.66e-07	NA	3.22e-06	0.4343
3. BF	B9E6L5	GTPase Der	2.59e-07	NA	9.01e-13	0.4176
3. BF	A5EI59	GTPase Der	1.24e-06	NA	4.06e-08	0.4336
3. BF	B8FM51	GTPase Der	2.00e-07	NA	1.17e-10	0.4548
3. BF	A4Y8T6	GTPase Der	5.78e-07	NA	3.80e-13	0.4145
3. BF	B0BTQ8	GTPase Der	9.20e-06	NA	7.11e-14	0.4463
3. BF	Q1BGX0	GTPase Der	3.12e-07	NA	2.15e-08	0.4339
3. BF	A6TS39	GTPase Der	3.86e-07	NA	1.17e-13	0.4284
3. BF	A8AVL8	GTPase Der	3.76e-07	NA	3.20e-12	0.4497
3. BF	Q1LLJ5	GTPase Der	2.91e-07	NA	2.28e-08	0.4598
3. BF	A3NVW6	GTPase Der	3.85e-07	NA	2.34e-08	0.437
3. BF	A8GXR7	GTPase Der	6.33e-07	NA	9.51e-09	0.4156
3. BF	A1UTM1	Probable GTP-binding protein EngB	5.16e-11	NA	0.011	0.6835
3. BF	A6QHK7	Probable GTP-binding protein EngB	6.50e-13	NA	3.85e-05	0.7701
3. BF	B3H0R7	GTPase Der	1.08e-05	NA	6.98e-14	0.448
3. BF	B0K530	Probable GTP-binding protein EngB	2.93e-12	NA	4.36e-04	0.7029
3. BF	Q1JDF1	GTPase Der	3.63e-07	NA	1.30e-11	0.436
3. BF	A6H103	GTPase Der	9.61e-07	NA	1.51e-05	0.5911
3. BF	Q2YM98	GTPase Der	2.33e-06	NA	1.35e-08	0.4248
3. BF	P57662	GTPase Der	1.26e-07	NA	6.04e-09	0.4414
3. BF	Q3B5U3	GTPase Der	4.40e-07	NA	2.45e-09	0.4225
4. PB	P07776	Uncharacterized protein ACIAD1443	2.07e-04	4.11e-03	1.03e-04	NA
4. PB	B1IIN2	GTPase Der	5.18e-07	7.92e-03	1.22e-09	NA
4. PB	Q8DF02	GTPase Der	6.84e-07	3.31e-02	4.17e-14	NA
4. PB	B1X0B0	GTPase Der	2.18e-07	3.40e-02	6.37e-12	NA
4. PB	Q8YZH7	GTPase Der	2.68e-07	1.39e-02	1.22e-11	NA
4. PB	Q7V8X0	GTPase Der	2.21e-07	1.15e-02	5.19e-09	NA
4. PB	C3L0M1	GTPase Der	3.83e-07	7.17e-03	3.48e-10	NA
4. PB	Q7NBV2	GTPase Der	1.38e-05	4.74e-02	1.09e-10	NA
4. PB	Q2FY06	GTPase Era	0.00e+00	1.41e-70	3.03e-82	NA
4. PB	A3PBA9	GTPase Der	2.23e-07	8.51e-03	1.49e-09	NA
4. PB	Q8EC36	GTPase Der	6.58e-07	4.47e-02	9.04e-14	NA
4. PB	B2J1L2	GTPase Der	5.06e-07	7.37e-03	1.28e-12	NA
4. PB	B9E1C8	GTPase Der	5.00e-07	2.71e-02	4.21e-10	NA
4. PB	C1D094	GTPase Der	1.66e-07	4.81e-03	4.24e-10	NA
4. PB	Q9RS19	GTPase Der	1.89e-07	4.62e-02	8.14e-10	NA
4. PB	P9WNK9	GTPase Era	0.00e+00	1.50e-70	6.58e-66	NA
4. PB	A8G3A3	GTPase Der	2.30e-07	1.18e-02	3.25e-10	NA
4. PB	Q09523	Uncharacterized GTP-binding protein E02H1.2	0.00e+00	2.22e-18	1.38e-11	NA
4. PB	A8ZU05	GTPase Der	1.52e-06	9.25e-04	3.38e-13	NA
4. PB	C5CXH0	GTPase Der	3.39e-07	4.17e-02	1.27e-06	NA
4. PB	A1B4S0	GTPase Der	2.72e-05	1.82e-04	2.20e-07	NA
4. PB	Q0ICK8	GTPase Der	1.92e-07	5.36e-03	2.25e-08	NA
4. PB	Q0HX53	GTPase Der	6.34e-07	3.67e-02	9.66e-14	NA
4. PB	B5E488	GTPase Era	NA	1.86e-67	2.36e-79	NA
4. PB	B0C1P2	GTPase Der	3.64e-07	2.93e-02	8.14e-13	NA
4. PB	A6LSI6	GTPase Der	4.64e-07	1.55e-02	9.28e-11	NA
4. PB	Q1GHZ2	GTPase Der	2.89e-06	2.49e-02	5.42e-08	NA
4. PB	Q895X8	GTPase Der	3.22e-07	4.36e-02	9.05e-13	NA
4. PB	Q1IWI7	GTPase Der	1.71e-07	2.20e-02	1.54e-09	NA
4. PB	Q3AI13	GTPase Der	2.47e-07	3.15e-03	5.22e-08	NA
4. PB	A7GGA7	GTPase Der	8.21e-07	5.87e-03	1.52e-09	NA
4. PB	Q0TPJ9	GTPase Der	3.81e-07	3.70e-02	2.95e-10	NA
4. PB	A5GJ79	GTPase Der	2.17e-07	5.56e-03	1.69e-08	NA
4. PB	P06616	GTPase Era	0.00e+00	1.77e-73	8.65e-63	NA
4. PB	A0Q125	GTPase Der	5.18e-07	8.44e-03	6.99e-12	NA
4. PB	A5GR60	GTPase Der	2.62e-07	2.20e-02	4.27e-09	NA
4. PB	Q8XJK1	GTPase Der	3.94e-07	3.70e-02	2.95e-10	NA
4. PB	C0QA05	GTPase Der	2.15e-06	3.21e-03	7.98e-10	NA
4. PB	Q0SS66	GTPase Der	3.86e-07	3.70e-02	2.95e-10	NA
4. PB	Q3M929	GTPase Der	2.13e-07	1.23e-02	1.31e-11	NA
5. P	Q889X3	Elongation factor Tu	7.16e-06	4.52e-04	NA	NA
5. P	Q8DI42	Elongation factor Tu	8.13e-06	5.03e-03	NA	NA
5. P	P14864	Elongation factor 1-alpha	5.68e-05	3.06e-02	NA	NA
5. P	P0A1H6	Elongation factor Tu	6.47e-06	2.03e-04	NA	NA
5. P	O59949	Elongation factor 1-alpha	7.25e-05	4.63e-03	NA	NA
5. P	A6TWI4	Elongation factor Tu 1	6.22e-06	7.20e-04	NA	NA
5. P	A1AVJ8	Elongation factor Tu 1	8.34e-06	7.48e-04	NA	NA
5. P	P14963	Elongation factor 1-alpha	5.77e-05	1.28e-03	NA	NA
5. P	Q4FLK5	Elongation factor Tu	7.49e-06	9.15e-03	NA	NA
5. P	B0RB36	Elongation factor Tu	5.10e-06	4.64e-05	NA	NA
5. P	Q27139	Elongation factor 1-alpha 1	3.98e-05	1.47e-03	NA	NA
5. P	Q2EEV7	Elongation factor Tu, plastid	8.32e-06	1.52e-02	NA	NA
5. P	Q04634	Elongation factor 1-alpha	6.80e-05	4.48e-04	NA	NA
5. P	Q8E0H1	Elongation factor Tu	4.69e-06	5.60e-04	NA	NA
5. P	P64031	Elongation factor Tu	5.09e-06	1.21e-03	NA	NA
5. P	Q83GW1	Elongation factor Tu	5.24e-06	2.38e-05	NA	NA
5. P	Q1R0H7	Elongation factor Tu	5.29e-06	9.33e-04	NA	NA
5. P	P31018	Elongation factor 1-alpha	4.20e-05	2.61e-04	NA	NA
5. P	Q9HDF6	Elongation factor 1-alpha	9.57e-05	2.24e-02	NA	NA
5. P	A6U842	Elongation factor Tu	4.80e-06	3.21e-03	NA	NA
5. P	B1XCS7	Sulfate adenylyltransferase subunit 1	3.09e-05	1.90e-03	NA	NA
5. P	P0DA83	Elongation factor Tu	4.49e-06	7.41e-04	NA	NA
5. P	A0Q6F0	Sulfate adenylyltransferase subunit 1	2.05e-05	2.54e-03	NA	NA
5. P	B1KSM7	Elongation factor Tu	6.94e-06	1.08e-04	NA	NA
5. P	A4FWE9	Elongation factor 1-alpha	2.95e-05	5.56e-03	NA	NA
5. P	Q5LMR5	Elongation factor Tu	5.78e-06	2.79e-03	NA	NA
5. P	B5Z3B3	Sulfate adenylyltransferase subunit 1	2.56e-05	1.62e-03	NA	NA
5. P	P17197	Elongation factor 1-alpha	8.44e-05	2.51e-05	NA	NA
5. P	Q5GRY3	Elongation factor Tu 2	3.49e-06	3.27e-04	NA	NA
5. P	A1T056	Elongation factor Tu	5.33e-06	2.12e-04	NA	NA
5. P	Q8R7T8	Elongation factor Tu-B	5.26e-06	6.93e-04	NA	NA
5. P	Q482Z9	Sulfate adenylyltransferase subunit 1	2.63e-05	3.33e-03	NA	NA
5. P	P42472	Elongation factor Tu (Fragment)	3.72e-05	7.34e-04	NA	NA
5. P	A1WCN6	Elongation factor Tu 2	6.10e-06	3.23e-05	NA	NA
5. P	Q3ZJ24	Elongation factor Tu, chloroplastic	7.87e-06	1.30e-02	NA	NA
5. P	B1IGF6	Elongation factor Tu	6.93e-06	1.65e-04	NA	NA
5. P	Q8Z470	Sulfate adenylyltransferase subunit 1	3.19e-05	5.22e-03	NA	NA
5. P	A3DA74	Elongation factor Tu 1	6.34e-06	1.06e-04	NA	NA
5. P	A8MLC4	Elongation factor Tu	6.43e-06	1.63e-04	NA	NA
5. P	Q5FTY1	Elongation factor Tu	5.83e-06	1.15e-03	NA	NA
5. P	Q5NG10	Sulfate adenylyltransferase subunit 1	2.01e-04	3.12e-03	NA	NA
5. P	Q7VA05	Elongation factor Tu	4.97e-06	7.34e-04	NA	NA
5. P	Q5GSU2	Elongation factor Tu 1	5.29e-06	5.33e-04	NA	NA
5. P	A1KRF9	Elongation factor Tu	6.17e-06	1.25e-04	NA	NA
5. P	J9VR81	Eukaryotic translation initiation factor 2 subunit gamma	1.65e-04	1.51e-02	NA	NA
5. P	O31300	Elongation factor Tu (Fragment)	2.79e-05	3.12e-03	NA	NA
5. P	C0PXB1	Sulfate adenylyltransferase subunit 1	3.20e-05	2.34e-03	NA	NA
5. P	B3ETZ7	Elongation factor Tu	4.80e-06	3.68e-04	NA	NA
5. P	P13537	Elongation factor Tu	6.78e-06	3.03e-03	NA	NA
5. P	A0KP35	Sulfate adenylyltransferase subunit 1	2.53e-05	3.79e-03	NA	NA
5. P	A8EW02	Elongation factor Tu	8.10e-06	4.18e-05	NA	NA
5. P	Q6ACZ0	Elongation factor Tu	4.87e-06	1.57e-05	NA	NA
5. P	B8DTV7	Elongation factor Tu	6.05e-06	1.84e-04	NA	NA
5. P	A4SHU2	Elongation factor Tu	5.93e-06	9.87e-05	NA	NA
5. P	A2CI56	Elongation factor Tu, chloroplastic	8.85e-06	3.89e-03	NA	NA
5. P	B8D9K1	Sulfate adenylyltransferase subunit 1	4.28e-03	4.32e-02	NA	NA
5. P	Q3J5S4	Elongation factor Tu	6.33e-06	3.30e-04	NA	NA
5. P	Q4QMT5	Elongation factor Tu 2	6.32e-06	3.44e-04	NA	NA
5. P	A9VP75	Elongation factor Tu	4.99e-06	2.76e-03	NA	NA
5. P	Q664R7	Elongation factor Tu 2	6.17e-06	3.57e-04	NA	NA
5. P	B8D9U9	Elongation factor Tu	5.68e-06	2.18e-04	NA	NA
5. P	P57966	Elongation factor Tu-B	6.37e-06	5.44e-04	NA	NA
5. P	Q605B0	Elongation factor Tu	5.38e-06	3.87e-04	NA	NA
5. P	P57498	Sulfate adenylyltransferase subunit 1	6.93e-03	4.00e-02	NA	NA
5. P	B8D851	Elongation factor Tu	5.81e-06	2.18e-04	NA	NA
5. P	Q8FS84	Elongation factor Tu	5.83e-06	1.99e-04	NA	NA
5. P	Q46IW4	Elongation factor Tu	5.19e-06	1.53e-03	NA	NA
5. P	Q8ZBP2	Sulfate adenylyltransferase subunit 1	4.29e-05	1.84e-04	NA	NA
5. P	P13927	Elongation factor Tu	4.92e-06	8.06e-05	NA	NA
5. P	B2UUW8	Elongation factor Tu	5.95e-06	6.05e-04	NA	NA
5. P	Q979T1	Elongation factor 1-alpha	1.83e-05	4.57e-04	NA	NA
5. P	Q2N9A8	Elongation factor Tu	8.04e-06	3.08e-04	NA	NA
5. P	Q5FKR8	Elongation factor Tu	4.99e-06	1.55e-03	NA	NA
5. P	A1JIH3	Elongation factor Tu 1	7.26e-06	2.63e-04	NA	NA
5. P	P16018	Elongation factor 1-alpha	8.42e-06	3.24e-04	NA	NA
5. P	A1WHC3	Elongation factor Tu	6.11e-06	1.07e-04	NA	NA
5. P	A6Q6H4	Elongation factor Tu	1.03e-05	1.21e-03	NA	NA
5. P	B3QY22	Elongation factor Tu	5.56e-06	3.27e-04	NA	NA
5. P	A9A9U3	Elongation factor 1-alpha	3.21e-05	7.64e-03	NA	NA
5. P	P41203	Elongation factor 1-alpha	4.74e-05	4.15e-03	NA	NA
5. P	A6QB12	Sulfate adenylyltransferase subunit 1	2.47e-05	4.55e-02	NA	NA
5. P	P34825	Elongation factor 1-alpha	8.32e-05	1.27e-02	NA	NA
5. P	Q0I0A7	Elongation factor Tu 2	5.69e-06	1.43e-04	NA	NA
5. P	Q6MDN0	Elongation factor Tu	6.75e-06	2.36e-04	NA	NA
5. P	A5CCL4	Elongation factor Tu 2	4.96e-06	1.54e-04	NA	NA
5. P	P17746	Elongation factor Tu, chloroplastic	8.10e-06	2.46e-02	NA	NA
5. P	P69952	Elongation factor Tu	4.82e-06	7.00e-04	NA	NA
5. P	Q57H76	Elongation factor Tu	6.59e-06	2.03e-04	NA	NA
5. P	B1ZPC5	Elongation factor Tu	8.00e-06	1.79e-04	NA	NA
5. P	Q8TJT7	Translation initiation factor 2 subunit gamma	7.59e-04	3.36e-03	NA	NA
5. P	Q8ETY4	Elongation factor Tu	5.89e-06	1.81e-03	NA	NA
5. P	Q27140	Elongation factor 1-alpha 2	5.59e-05	3.06e-03	NA	NA
5. P	Q5HVZ7	Elongation factor Tu	6.06e-06	2.99e-04	NA	NA
5. P	Q3KM40	Elongation factor Tu	8.94e-06	1.82e-04	NA	NA
5. P	B0BQZ3	Elongation factor Tu	6.43e-06	1.67e-04	NA	NA
5. P	P40175	Elongation factor Tu-3	3.47e-06	1.28e-03	NA	NA
5. P	Q089R8	Elongation factor Tu 1	5.91e-06	9.68e-05	NA	NA
5. P	Q54XD8	Eukaryotic translation initiation factor 2 subunit 3	1.44e-04	2.76e-03	NA	NA
5. P	A4SCQ7	Elongation factor Tu	7.67e-06	3.11e-04	NA	NA
5. P	Q13TF5	Elongation factor Tu	6.59e-06	1.14e-04	NA	NA
5. P	A8GT71	Elongation factor Tu	5.07e-06	1.39e-03	NA	NA
5. P	C5BSJ5	Sulfate adenylyltransferase subunit 1	2.17e-05	2.25e-03	NA	NA
5. P	B5RPI0	Elongation factor Tu	4.16e-06	1.25e-03	NA	NA
5. P	A3DJ00	Elongation factor Tu	6.38e-06	2.77e-04	NA	NA
5. P	Q6NJD5	Elongation factor Tu	6.06e-06	1.54e-04	NA	NA
5. P	B5XKI1	Elongation factor Tu	4.83e-06	1.37e-03	NA	NA
5. P	Q3YWT3	Elongation factor Tu 1	8.41e-06	1.77e-04	NA	NA
5. P	Q8U152	Elongation factor 1-alpha	9.53e-05	1.30e-04	NA	NA
5. P	P95724	Elongation factor Tu	5.80e-06	7.48e-04	NA	NA
5. P	C1C881	Elongation factor Tu	5.15e-06	1.21e-03	NA	NA
5. P	Q1BRT3	Elongation factor Tu	6.64e-06	7.43e-05	NA	NA
5. P	P42482	Elongation factor Tu	6.25e-06	1.35e-03	NA	NA
5. P	Q2HJN4	Elongation factor 1-alpha 1	6.09e-05	5.66e-03	NA	NA
5. P	Q8KT99	Elongation factor Tu	5.11e-06	6.86e-04	NA	NA
5. P	Q5QWA3	Elongation factor Tu	4.70e-06	8.48e-04	NA	NA
5. P	Q0AUH8	Elongation factor Tu 1	5.85e-06	2.91e-04	NA	NA
5. P	Q042T5	Elongation factor Tu	5.21e-06	3.55e-03	NA	NA
5. P	Q6LXI1	Elongation factor 1-alpha	3.21e-05	1.00e-02	NA	NA
5. P	B9DRL9	Elongation factor Tu	4.68e-06	1.11e-03	NA	NA
5. P	B3E156	Elongation factor Tu	5.42e-06	1.14e-04	NA	NA
5. P	B9LSM6	Translation initiation factor 2 subunit gamma	1.15e-05	4.83e-06	NA	NA
5. P	Q3Z7S9	Elongation factor Tu	6.53e-06	9.33e-04	NA	NA
5. P	A1TJ05	Elongation factor Tu	6.20e-06	3.26e-05	NA	NA
5. P	Q59QD6	Elongation factor 1-alpha 2	6.71e-05	3.65e-03	NA	NA
5. P	P35021	Elongation factor 1-alpha	4.57e-05	2.43e-04	NA	NA
5. P	A4YBY5	Elongation factor Tu	5.31e-06	2.79e-04	NA	NA
5. P	P42439	Elongation factor Tu	5.80e-06	1.45e-04	NA	NA
5. P	P50371	Elongation factor Tu, chloroplastic	7.69e-06	6.20e-03	NA	NA
5. P	Q134R0	Elongation factor Tu 2	5.05e-06	7.13e-05	NA	NA
5. P	Q0BJ48	Elongation factor Tu	6.58e-06	7.43e-05	NA	NA
5. P	A1VYI6	Elongation factor Tu	5.93e-06	2.99e-04	NA	NA
5. P	Q9Y9C1	Translation initiation factor 2 subunit gamma	1.75e-04	9.79e-04	NA	NA
5. P	A4YSJ0	Elongation factor Tu	5.18e-06	9.87e-05	NA	NA
5. P	P10126	Elongation factor 1-alpha 1	6.69e-05	2.44e-02	NA	NA
5. P	Q2NZX1	Elongation factor Tu	5.90e-06	1.55e-04	NA	NA
5. P	A0T0K6	Elongation factor Tu, chloroplastic	6.68e-06	1.08e-02	NA	NA
5. P	Q822I4	Elongation factor Tu	8.57e-06	5.03e-04	NA	NA
5. P	Q0K5Z9	Elongation factor Tu	6.59e-06	1.54e-04	NA	NA
5. P	Q8PC59	Elongation factor Tu-A	5.91e-06	2.43e-04	NA	NA
5. P	Q0SQC8	Elongation factor Tu	5.28e-06	4.27e-05	NA	NA
5. P	P24203	P-loop guanosine triphosphatase YjiA	7.01e-02	7.48e-04	NA	NA
5. P	Q1C1T4	Elongation factor Tu 2	6.33e-06	1.22e-03	NA	NA
5. P	A2SLF9	Elongation factor Tu	6.75e-06	1.32e-04	NA	NA
5. P	Q92005	Elongation factor 1-alpha	8.45e-05	3.54e-02	NA	NA
5. P	B2RL52	Elongation factor Tu	5.33e-06	3.51e-04	NA	NA
5. P	Q3B6G3	Elongation factor Tu	7.79e-06	2.14e-04	NA	NA
5. P	A9KD33	Elongation factor Tu	4.99e-06	9.20e-05	NA	NA
5. P	Q1MIE3	Elongation factor Tu	5.12e-06	2.74e-03	NA	NA
5. P	A8GPF2	Elongation factor Tu	5.20e-06	8.06e-05	NA	NA
5. P	P62629	Elongation factor 1-alpha 1	6.27e-05	2.44e-02	NA	NA
5. P	Q4ZMP2	Elongation factor Tu	6.09e-06	4.26e-04	NA	NA
5. P	Q8TYP6	Elongation factor 1-alpha	4.47e-04	2.06e-04	NA	NA
5. P	Q2HJN8	Elongation factor 1-alpha 2	5.80e-05	6.04e-03	NA	NA
5. P	A8GVB2	Elongation factor Tu	5.05e-06	2.71e-04	NA	NA
5. P	Q748X8	Elongation factor Tu	5.36e-06	5.18e-04	NA	NA
5. P	Q5JDL3	Translation initiation factor 2 subunit gamma	1.12e-05	5.28e-04	NA	NA
5. P	Q73F98	Elongation factor Tu	4.90e-06	2.01e-03	NA	NA
5. P	Q980A5	Translation initiation factor 2 subunit gamma	1.06e-05	3.40e-04	NA	NA
5. P	A7ZQJ5	Sulfate adenylyltransferase subunit 1	3.05e-05	2.76e-03	NA	NA
5. P	Q1H4Q1	Elongation factor Tu 1	6.58e-06	1.42e-04	NA	NA
5. P	Q8EK81	Elongation factor Tu 1	5.38e-06	1.17e-04	NA	NA
5. P	P50372	Elongation factor Tu, chloroplastic	9.45e-06	4.36e-02	NA	NA
5. P	B6YVG2	Elongation factor 1-alpha	7.56e-05	1.89e-05	NA	NA
5. P	B4RYQ8	Elongation factor Tu	5.72e-06	1.14e-04	NA	NA
5. P	Q01698	Elongation factor Tu	7.86e-06	8.01e-04	NA	NA
5. P	Q1WU83	Elongation factor Tu	5.17e-06	1.41e-03	NA	NA
5. P	Q6A6L7	Elongation factor Tu	5.78e-06	1.63e-04	NA	NA
5. P	O50340	Elongation factor Tu	6.61e-06	3.47e-04	NA	NA
5. P	B0CCD0	Elongation factor Tu	6.89e-06	4.07e-03	NA	NA
5. P	B7GJ65	Elongation factor Tu	5.24e-06	2.06e-04	NA	NA
5. P	B1VET1	Elongation factor Tu	6.63e-06	3.54e-04	NA	NA
5. P	C6C171	Elongation factor Tu	5.48e-06	6.80e-04	NA	NA
5. P	Q1MPT8	Elongation factor Tu	5.73e-06	2.88e-04	NA	NA
5. P	A8G8E0	Elongation factor Tu 1	6.05e-06	4.06e-04	NA	NA
5. P	P62630	Elongation factor 1-alpha 1	7.07e-05	2.44e-02	NA	NA
5. P	Q80X95	Ras-related GTP-binding protein A	5.94e-05	1.01e-04	NA	NA
5. P	A9N2D8	Sulfate adenylyltransferase subunit 1	2.95e-05	1.78e-03	NA	NA
5. P	P52854	Elongation factor Tu	1.08e-05	5.58e-05	NA	NA
5. P	Q1R5Y2	Elongation factor Tu 1	8.79e-06	1.77e-04	NA	NA
5. P	A2C4U5	Elongation factor Tu	4.80e-06	1.10e-03	NA	NA
5. P	Q8R603	Elongation factor Tu	4.60e-06	3.44e-04	NA	NA
5. P	Q3IMM5	Translation initiation factor 2 subunit gamma	1.35e-05	2.57e-05	NA	NA
5. P	P43643	Elongation factor 1-alpha	5.86e-05	1.03e-03	NA	NA
5. P	A4SUU7	Elongation factor Tu	6.76e-06	9.87e-05	NA	NA
5. P	A0B7D6	Elongation factor 1-alpha	1.32e-05	3.72e-03	NA	NA
5. P	Q8DE73	Sulfate adenylyltransferase subunit 1	2.17e-05	7.78e-03	NA	NA
5. P	Q2FRI3	Elongation factor 1-alpha	1.70e-05	1.09e-03	NA	NA
5. P	O14078	Obg-like ATPase homolog	1.43e-01	1.62e-05	NA	NA
5. P	Q2NEL1	Elongation factor 1-alpha	1.02e-05	2.47e-03	NA	NA
5. P	B8D7V3	Sulfate adenylyltransferase subunit 1	7.22e-04	4.47e-02	NA	NA
5. P	P9WNN1	Elongation factor Tu	5.27e-06	3.79e-04	NA	NA
5. P	Q3MDM5	Elongation factor Tu	7.72e-06	6.98e-03	NA	NA
5. P	Q182W3	Stage IV sporulation protein A	3.59e-04	6.86e-04	NA	NA
5. P	P68105	Elongation factor 1-alpha 1	7.16e-05	1.90e-02	NA	NA
5. P	Q9Z9L6	Elongation factor Tu	5.21e-06	1.36e-04	NA	NA
5. P	P86933	Elongation factor 1-alpha	6.99e-05	6.09e-03	NA	NA
5. P	Q66EC7	Sulfate adenylyltransferase subunit 1	2.54e-05	1.84e-04	NA	NA
5. P	C1CSB0	Elongation factor Tu	4.90e-06	1.21e-03	NA	NA
5. P	B5BEY8	Sulfate adenylyltransferase subunit 1	3.00e-05	3.65e-03	NA	NA
5. P	Q66JG0	Obg-like ATPase 1	1.57e-02	3.93e-07	NA	NA
5. P	A4TGY7	Elongation factor Tu 1	6.93e-06	3.57e-04	NA	NA
5. P	B8DAY7	Elongation factor Tu	5.00e-06	1.97e-04	NA	NA
5. P	Q118Z2	Elongation factor Tu	8.37e-06	4.72e-03	NA	NA
5. P	Q1JHV6	Elongation factor Tu	5.20e-06	7.41e-04	NA	NA
5. P	O31301	Elongation factor Tu (Fragment)	2.75e-05	2.84e-03	NA	NA
5. P	P0CT55	Elongation factor 1-alpha-B/C	6.84e-05	4.51e-03	NA	NA
5. P	Q1ACI3	Elongation factor Tu, chloroplastic	1.02e-05	3.06e-03	NA	NA
5. P	P47270	Ribosome-binding ATPase YchF	8.44e-02	6.52e-10	NA	NA
5. P	A8EWR6	Sulfate adenylyltransferase subunit 1	2.79e-05	7.85e-04	NA	NA
5. P	A4VHM8	Elongation factor Tu 2	6.27e-06	8.65e-04	NA	NA
5. P	Q8YP63	Elongation factor Tu	7.71e-06	4.72e-03	NA	NA
5. P	A1AEU5	Sulfate adenylyltransferase subunit 1	2.71e-05	2.07e-03	NA	NA
5. P	Q1GAQ0	Elongation factor Tu	6.44e-06	2.45e-03	NA	NA
5. P	Q160Y4	Elongation factor Tu	5.80e-06	5.18e-04	NA	NA
5. P	C0Q9Y7	Elongation factor Tu	5.51e-06	1.30e-03	NA	NA
5. P	Q25820	Elongation factor Tu, apicoplast	1.00e-05	5.56e-03	NA	NA
5. P	A1BJ36	Elongation factor Tu	7.94e-06	8.81e-04	NA	NA
5. P	Q02T82	Elongation factor Tu	6.75e-06	8.81e-04	NA	NA
5. P	B3PII1	Sulfate adenylyltransferase subunit 1	2.32e-05	1.14e-02	NA	NA
5. P	A5UYI1	Elongation factor Tu 2	7.90e-06	2.56e-03	NA	NA
5. P	A7ZCN0	Elongation factor Tu	6.13e-06	2.48e-04	NA	NA
5. P	P38219	Obg-like ATPase 1	3.14e-02	6.91e-07	NA	NA
5. P	A7FNN8	Elongation factor Tu 2	6.24e-06	3.57e-04	NA	NA
5. P	Q3IJV1	Elongation factor Tu 2	5.25e-06	1.18e-04	NA	NA
5. P	Q6AF48	Nucleotide-binding protein Lxx11490	4.38e-02	2.40e-02	NA	NA
5. P	Q90835	Elongation factor 1-alpha 1	6.87e-05	2.05e-02	NA	NA
5. P	Q492B2	Elongation factor Tu	5.46e-06	3.72e-04	NA	NA
5. P	Q7VMI2	Ribosome-binding ATPase YchF	2.67e-02	1.70e-10	NA	NA
5. P	B4T461	Sulfate adenylyltransferase subunit 1	3.03e-05	2.25e-03	NA	NA
5. P	Q01372	Elongation factor 1-alpha	8.35e-05	3.18e-03	NA	NA
5. P	Q2HJ33	Obg-like ATPase 1	2.23e-02	4.16e-07	NA	NA
5. P	P54959	Elongation factor 1-alpha	5.24e-05	3.12e-03	NA	NA
5. P	A9MHG0	Elongation factor Tu	6.60e-06	2.03e-04	NA	NA
5. P	C5CGR6	Elongation factor Tu	6.34e-06	7.04e-03	NA	NA
5. P	Q0BV59	Nucleotide-binding protein GbCGDNIH1_0395	1.67e-02	2.93e-02	NA	NA
5. P	Q57770	Elongation factor 1-alpha	3.06e-05	3.61e-04	NA	NA
5. P	Q8UH69	Sulfate adenylyltransferase subunit 1	2.94e-05	6.26e-03	NA	NA
5. P	A3Q968	Elongation factor Tu 1	5.54e-06	2.99e-04	NA	NA
5. P	Q0SN31	Elongation factor Tu	4.10e-06	7.64e-03	NA	NA
5. P	P72483	Elongation factor Tu	5.55e-06	2.36e-04	NA	NA
5. P	B7MKM5	Sulfate adenylyltransferase subunit 1	2.69e-05	2.07e-03	NA	NA
5. P	A6UTL4	Translation initiation factor 2 subunit gamma	1.28e-04	5.04e-06	NA	NA
5. P	B0TX03	Elongation factor Tu	6.25e-06	7.51e-05	NA	NA
5. P	O33594	Elongation factor Tu	4.67e-06	1.05e-04	NA	NA
5. P	A5CUB6	Elongation factor Tu	5.00e-06	3.89e-05	NA	NA
5. P	A3DMQ1	Elongation factor 1-alpha	3.77e-05	4.94e-04	NA	NA
5. P	P0ABU2	Ribosome-binding ATPase YchF	4.57e-02	2.02e-11	NA	NA
5. P	P0CE48	Elongation factor Tu 2	8.68e-06	2.34e-04	NA	NA
5. P	P0CT31	Elongation factor 1-alpha	8.40e-05	6.09e-03	NA	NA
5. P	Q3K5X4	Elongation factor Tu	6.11e-06	2.16e-04	NA	NA
5. P	A5D5I8	Elongation factor Tu 2	6.55e-06	1.13e-03	NA	NA
5. P	Q85FT7	Elongation factor Tu, chloroplastic	7.05e-06	6.48e-04	NA	NA
5. P	Q6N4Q4	Elongation factor Tu	5.29e-06	1.81e-04	NA	NA
5. P	P09953	Elongation factor Tu	4.24e-06	3.58e-05	NA	NA
5. P	Q04PT6	Elongation factor Tu	7.00e-06	4.64e-05	NA	NA
5. P	A1WVD6	Elongation factor Tu 2	4.90e-06	8.57e-05	NA	NA
5. P	A8MAJ1	Elongation factor 1-alpha	4.42e-05	3.36e-03	NA	NA
5. P	P56893	Sulfate adenylyltransferase subunit 1	5.17e-05	6.67e-04	NA	NA
5. P	A1WVC4	Elongation factor Tu 1	5.53e-06	1.21e-04	NA	NA
5. P	Q6LVC0	Elongation factor Tu 1	5.66e-06	2.91e-04	NA	NA
5. P	P05303	Elongation factor 1-alpha 2	7.41e-05	4.19e-03	NA	NA
5. P	A4VHL6	Elongation factor Tu 1	5.98e-06	1.12e-03	NA	NA
5. P	O13998	Obg-like ATPase 1	3.26e-02	2.43e-07	NA	NA
5. P	Q7NVN5	Sulfate adenylyltransferase subunit 1	3.54e-05	1.05e-02	NA	NA
5. P	B3EP63	Elongation factor Tu	4.47e-06	3.15e-04	NA	NA
5. P	P42473	Elongation factor Tu	7.99e-06	3.24e-03	NA	NA
5. P	Q63486	Ras-related GTP-binding protein A	5.85e-05	1.01e-04	NA	NA
5. P	B5ZC31	Elongation factor Tu	4.73e-06	4.98e-05	NA	NA
5. P	P0CD71	Elongation factor Tu	8.63e-06	1.82e-04	NA	NA
5. P	P0A3B0	Elongation factor Tu	5.18e-06	2.40e-03	NA	NA
5. P	Q0WL56	Elongation factor 1-alpha 3	8.11e-05	1.20e-03	NA	NA
5. P	Q7L523	Ras-related GTP-binding protein A	1.78e-05	1.01e-04	NA	NA
5. P	Q2LQA3	Elongation factor Tu	4.39e-06	1.24e-03	NA	NA
5. P	P09591	Elongation factor Tu	6.77e-06	8.81e-04	NA	NA
5. P	Q9R342	Elongation factor Tu	7.95e-06	1.41e-03	NA	NA
5. P	P0A559	Elongation factor Tu	5.27e-06	3.79e-04	NA	NA
5. P	A4IJI7	Elongation factor Tu	5.22e-06	4.14e-04	NA	NA
5. P	Q8NL22	Elongation factor Tu	6.52e-06	2.85e-04	NA	NA
5. P	Q6CZW6	Elongation factor Tu	5.94e-06	3.05e-04	NA	NA
5. P	Q49V58	Elongation factor Tu	5.37e-06	8.90e-04	NA	NA
5. P	A3N246	Elongation factor Tu	6.19e-06	1.67e-04	NA	NA
5. P	A0KRL0	Elongation factor Tu	5.49e-06	7.90e-05	NA	NA
5. P	Q7N8L0	Sulfate adenylyltransferase subunit 1	2.84e-05	2.76e-02	NA	NA
5. P	P22679	Elongation factor Tu	6.32e-06	2.51e-04	NA	NA
5. P	A1VAK4	Elongation factor Tu	6.73e-06	3.02e-04	NA	NA
5. P	Q9HLA7	Translation initiation factor 2 subunit gamma	6.45e-04	2.51e-06	NA	NA
5. P	C0ZIH6	Elongation factor Tu	5.88e-06	1.12e-03	NA	NA
5. P	Q2RFP5	Elongation factor Tu	5.21e-06	3.33e-03	NA	NA
5. P	P86939	Elongation factor 1-alpha 2	6.80e-05	4.19e-03	NA	NA
5. P	Q81SW4	Stage IV sporulation protein A	2.64e-04	7.51e-05	NA	NA
5. P	C3LJ80	Elongation factor Tu	4.83e-06	1.37e-03	NA	NA
5. P	B7H1K5	Elongation factor Tu	5.72e-06	1.06e-03	NA	NA
5. P	Q8SQR3	Cell division control protein 10	7.94e-04	2.57e-02	NA	NA
5. P	Q5ZM25	Obg-like ATPase 1	3.93e-02	2.57e-07	NA	NA
5. P	P33165	Elongation factor Tu	5.35e-06	9.42e-04	NA	NA
5. P	P33170	Elongation factor Tu	4.93e-06	1.12e-03	NA	NA
5. P	A6LPP6	Elongation factor Tu	5.61e-06	1.22e-04	NA	NA
5. P	P0DA82	Elongation factor Tu	4.90e-06	7.41e-04	NA	NA
5. P	Q9CEI0	Elongation factor Tu	5.70e-06	2.08e-05	NA	NA
5. P	A9H3R7	Elongation factor Tu	5.34e-06	1.15e-03	NA	NA
5. P	Q1R5U4	Elongation factor Tu 2	7.95e-06	2.34e-04	NA	NA
5. P	Q039K9	Elongation factor Tu	5.51e-06	2.98e-03	NA	NA
5. P	O31297	Elongation factor Tu	6.04e-06	2.18e-04	NA	NA
5. P	O64937	Elongation factor 1-alpha	6.58e-05	3.61e-04	NA	NA
5. P	A7FLY2	Sulfate adenylyltransferase subunit 1	2.43e-05	1.84e-04	NA	NA
5. P	A3CTG3	Elongation factor 1-alpha	8.31e-06	9.66e-03	NA	NA
5. P	C3PPA9	Elongation factor Tu	5.12e-06	1.39e-03	NA	NA
5. P	Q5UR72	Putative GTP-binding protein R624	NA	1.74e-05	NA	NA
5. P	Q21RV6	Elongation factor Tu 2	6.06e-06	2.29e-05	NA	NA
5. P	A8AWA0	Elongation factor Tu	4.76e-06	1.30e-03	NA	NA
5. P	B0TM14	Elongation factor Tu	7.17e-06	2.71e-04	NA	NA
5. P	Q2YAZ9	Elongation factor Tu	5.45e-06	1.17e-04	NA	NA
5. P	B6I6E1	Sulfate adenylyltransferase subunit 1	2.72e-05	2.79e-03	NA	NA
5. P	B1ICR4	Elongation factor Tu	4.83e-06	1.21e-03	NA	NA
5. P	Q6FZL2	Elongation factor Tu 2	4.92e-06	4.72e-03	NA	NA
5. P	Q18KI6	Translation initiation factor 2 subunit gamma	7.74e-04	6.99e-07	NA	NA
5. P	Q3YV04	Elongation factor Tu 2	8.33e-06	2.34e-04	NA	NA
5. P	A1W2Q5	Elongation factor Tu 1	5.77e-06	3.10e-05	NA	NA
5. P	Q0ABH7	Elongation factor Tu	6.33e-06	8.73e-04	NA	NA
5. P	B1LBP2	Elongation factor Tu	6.77e-06	2.36e-03	NA	NA
5. P	Q8A463	Elongation factor Tu	5.37e-06	9.98e-04	NA	NA
5. P	Q9CP90	Ribosome-binding ATPase YchF	3.08e-02	9.23e-11	NA	NA
5. P	A7MWE9	Sulfate adenylyltransferase subunit 1	2.17e-05	5.56e-03	NA	NA
5. P	C3P9Q3	Elongation factor Tu	4.84e-06	1.37e-03	NA	NA
5. P	A1KGG5	Elongation factor Tu	5.47e-06	3.79e-04	NA	NA
5. P	Q8DD27	Elongation factor Tu 1	5.16e-06	8.81e-04	NA	NA
5. P	A5N4N1	Elongation factor Tu	6.77e-06	2.88e-04	NA	NA
5. P	A4XI37	Elongation factor Tu	5.74e-06	1.86e-04	NA	NA
5. P	A3PEZ7	Elongation factor Tu	5.02e-06	7.48e-04	NA	NA
5. P	P60338	Elongation factor Tu-A	7.90e-06	8.16e-04	NA	NA
5. P	P0A3A9	Elongation factor Tu	5.14e-06	2.40e-03	NA	NA
5. P	Q8PZA0	Translation initiation factor 2 subunit gamma	6.75e-04	1.02e-05	NA	NA
5. P	Q03LX0	Elongation factor Tu	5.35e-06	1.50e-03	NA	NA
5. P	Q2FJ92	Elongation factor Tu	5.68e-06	6.60e-04	NA	NA
5. P	A6TWJ8	Elongation factor Tu 2	6.20e-06	8.40e-04	NA	NA
5. P	P42474	Elongation factor Tu	6.42e-06	8.40e-04	NA	NA
5. P	Q600B6	Elongation factor Tu	7.60e-06	3.10e-05	NA	NA
5. P	Q97EH5	Elongation factor Tu	5.43e-06	1.15e-04	NA	NA
5. P	Q3YYB1	Sulfate adenylyltransferase subunit 1	2.67e-05	1.90e-03	NA	NA
5. P	O93729	Elongation factor 1-alpha	4.52e-05	6.20e-03	NA	NA
5. P	B0SAF6	Elongation factor Tu	8.11e-06	3.73e-05	NA	NA
5. P	A8F982	Elongation factor Tu	6.26e-06	5.55e-04	NA	NA
5. P	A6UZH4	Elongation factor Tu	7.09e-06	8.81e-04	NA	NA
5. P	P14865	Elongation factor 1-alpha	6.96e-05	3.58e-02	NA	NA
5. P	B0RU84	Elongation factor Tu 1	6.04e-06	2.16e-04	NA	NA
5. P	A5FIJ9	Elongation factor Tu	5.62e-06	6.54e-04	NA	NA
5. P	A0LIH6	Elongation factor Tu	4.97e-06	3.11e-04	NA	NA
5. P	Q6Z1J6	Obg-like ATPase 1	7.98e-02	2.40e-06	NA	NA
5. P	B8ELG5	Elongation factor Tu	5.47e-06	1.09e-03	NA	NA
5. P	A7MXE4	Elongation factor Tu	4.75e-06	5.60e-04	NA	NA
5. P	P13549	Elongation factor 1-alpha, somatic form	6.17e-05	1.07e-02	NA	NA
5. P	A6TEX7	Elongation factor Tu	6.49e-06	1.10e-04	NA	NA
5. P	B1MY04	Elongation factor Tu	5.66e-06	9.48e-05	NA	NA
5. P	Q5UYS2	Translation initiation factor 2 subunit gamma	1.72e-05	1.37e-06	NA	NA
5. P	Q123F6	Elongation factor Tu	6.35e-06	1.11e-04	NA	NA
5. P	P32186	Elongation factor 1-alpha	8.66e-05	1.16e-02	NA	NA
5. P	Q5NQ65	Elongation factor Tu	5.36e-06	1.43e-04	NA	NA
5. P	Q21M86	Elongation factor Tu	1.25e-05	5.60e-04	NA	NA
5. P	A7FZ71	Elongation factor Tu	7.05e-06	1.65e-04	NA	NA
5. P	A1A0T1	Elongation factor Tu	5.31e-06	1.38e-04	NA	NA
5. P	Q0I0B9	Elongation factor Tu 1	5.73e-06	6.51e-05	NA	NA
5. P	Q1D776	Elongation factor Tu 2	5.15e-06	4.26e-04	NA	NA
5. P	Q7V500	Elongation factor Tu	5.09e-06	2.85e-04	NA	NA
5. P	Q1RHL9	Elongation factor Tu	4.86e-06	2.71e-04	NA	NA
5. P	A3Q980	Elongation factor Tu 2	5.45e-06	2.74e-04	NA	NA
5. P	Q1IHG6	Elongation factor Tu	5.45e-06	2.01e-04	NA	NA
5. P	Q82DQ0	Elongation factor Tu 1	4.93e-06	1.01e-04	NA	NA
5. P	B3WE38	Elongation factor Tu	5.53e-06	2.98e-03	NA	NA
5. P	A2RMT1	Elongation factor Tu	5.55e-06	2.08e-05	NA	NA
5. P	Q2K9N2	Elongation factor Tu 1	4.79e-06	1.96e-03	NA	NA
5. P	Q58657	Translation initiation factor 2 subunit gamma	1.28e-05	2.88e-05	NA	NA
5. P	P42480	Elongation factor Tu	4.88e-06	2.31e-03	NA	NA
5. P	Q5R4R8	Elongation factor 1-alpha 1	7.27e-05	1.90e-02	NA	NA
5. P	B7JUP5	Elongation factor Tu	6.93e-06	1.19e-03	NA	NA
5. P	Q48UK5	Elongation factor Tu	4.76e-06	7.41e-04	NA	NA
5. P	A7GZK6	Elongation factor Tu	6.44e-06	2.82e-04	NA	NA
5. P	A1RXW9	Elongation factor 1-alpha	6.18e-05	8.40e-04	NA	NA
5. P	Q2YSB3	Elongation factor Tu	5.87e-06	6.60e-04	NA	NA
5. P	B1WQY4	Elongation factor Tu	7.10e-06	3.42e-03	NA	NA
5. P	A6YG72	Elongation factor Tu, chloroplastic	6.49e-06	2.79e-03	NA	NA
5. P	P9WNN0	Elongation factor Tu	5.13e-06	3.79e-04	NA	NA
5. P	Q927I6	Elongation factor Tu	5.02e-06	1.97e-04	NA	NA
5. P	Q9ZEU3	Elongation factor Tu	3.36e-06	8.39e-05	NA	NA
5. P	C3K2X8	Elongation factor Tu	6.27e-06	4.98e-04	NA	NA
5. P	P0CT53	Elongation factor 1-alpha-A	5.74e-05	5.08e-03	NA	NA
5. P	B2G6R2	Elongation factor Tu	5.73e-06	6.09e-03	NA	NA
5. P	O26361	Translation initiation factor 2 subunit gamma	8.33e-06	1.80e-05	NA	NA
5. P	A0L5V8	Elongation factor Tu	5.13e-06	2.71e-03	NA	NA
5. P	Q877T5	Elongation factor Tu	5.69e-06	1.79e-04	NA	NA
5. P	Q7ZU42	Obg-like ATPase 1	3.98e-02	2.35e-07	NA	NA
5. P	B1AJG3	Elongation factor Tu	4.76e-06	1.10e-04	NA	NA
5. P	Q4JT41	Elongation factor Tu	6.39e-06	1.95e-05	NA	NA
5. P	P30768	Elongation factor Tu	4.93e-06	7.34e-04	NA	NA
5. P	C1A6Q3	Elongation factor Tu	1.08e-05	5.64e-05	NA	NA
5. P	A7GJ76	Elongation factor Tu	7.03e-06	1.65e-04	NA	NA
5. P	Q63H92	Elongation factor Tu	4.81e-06	1.37e-03	NA	NA
5. P	B1Z7C0	Sulfate adenylyltransferase subunit 1	2.04e-05	2.95e-03	NA	NA
5. P	Q4G342	Elongation factor Tu, chloroplastic	7.17e-06	3.47e-04	NA	NA
5. P	A0LRL8	Elongation factor Tu	5.59e-06	6.05e-04	NA	NA
5. P	Q9CAI1	Developmentally-regulated G-protein 2	1.47e-03	2.82e-03	NA	NA
5. P	A9ISD9	Elongation factor Tu	4.66e-06	1.05e-03	NA	NA
5. P	Q54IK1	Ras-related GTP-binding protein A	9.84e-05	7.90e-05	NA	NA
5. P	Q0HNV1	Elongation factor Tu 1	5.23e-06	6.51e-05	NA	NA
5. P	P0CT54	Elongation factor 1-alpha-B	5.80e-05	4.51e-03	NA	NA
5. P	P07810	Elongation factor 1-alpha	3.41e-05	3.72e-03	NA	NA
5. P	P64030	Elongation factor Tu	4.85e-06	1.21e-03	NA	NA
5. P	Q18EY5	Elongation factor 1-alpha	1.46e-05	4.11e-03	NA	NA
5. P	A1USC1	Elongation factor Tu 1	4.72e-06	4.48e-04	NA	NA
5. P	Q318N5	Elongation factor Tu	5.19e-06	5.60e-04	NA	NA
5. P	B9JB95	Sulfate adenylyltransferase subunit 1	5.45e-05	4.83e-02	NA	NA
5. P	A4FPM7	Elongation factor Tu	5.52e-06	6.29e-04	NA	NA
5. P	A8FKQ5	Elongation factor Tu	6.38e-06	2.99e-04	NA	NA
5. P	Q3SSW8	Elongation factor Tu	5.19e-06	1.28e-04	NA	NA
5. P	Q211E6	Elongation factor Tu	4.96e-06	4.40e-05	NA	NA
5. P	Q727D5	Elongation factor Tu	6.07e-06	3.02e-04	NA	NA
5. P	B7JKB7	Elongation factor Tu	4.90e-06	1.37e-03	NA	NA
5. P	A5D5K0	Elongation factor Tu 1	6.62e-06	1.34e-03	NA	NA
5. P	Q81ZS3	Elongation factor Tu	5.42e-06	1.22e-04	NA	NA
5. P	Q877L9	Elongation factor Tu	5.37e-06	7.85e-04	NA	NA
5. P	Q1H4N9	Elongation factor Tu 2	6.65e-06	1.79e-04	NA	NA
5. P	A0Q874	Elongation factor Tu	6.95e-06	1.65e-04	NA	NA
5. P	P50064	Elongation factor Tu	7.96e-06	3.27e-03	NA	NA
5. P	Q9TJQ8	Elongation factor Tu, plastid	7.11e-06	3.27e-03	NA	NA
5. P	A4WKK8	Elongation factor 1-alpha	3.95e-05	1.59e-03	NA	NA
5. P	Q2KHU8	Eukaryotic translation initiation factor 2 subunit 3	1.24e-03	4.57e-04	NA	NA
5. P	B6JN44	Elongation factor Tu	6.07e-06	1.14e-03	NA	NA
5. P	Q0ANN1	Elongation factor Tu	5.52e-06	1.80e-03	NA	NA
5. P	A6Q1L5	Elongation factor Tu	5.82e-06	7.27e-04	NA	NA
5. P	P08736	Elongation factor 1-alpha 1	7.64e-05	8.90e-04	NA	NA
5. P	P74227	Elongation factor Tu	5.82e-06	9.16e-04	NA	NA
5. P	Q5JFZ4	Elongation factor 1-alpha	8.18e-05	1.97e-05	NA	NA
5. P	A8ABM5	Elongation factor 1-alpha	3.74e-05	5.08e-04	NA	NA
5. P	P0ABU3	Ribosome-binding ATPase YchF	5.45e-02	2.02e-11	NA	NA
5. P	Q7TTF9	Elongation factor Tu	6.49e-06	2.16e-04	NA	NA
5. P	Q464Z4	Elongation factor 1-alpha	1.18e-05	2.29e-03	NA	NA
5. P	P53290	GTP-binding protein GTR2	9.84e-05	1.51e-04	NA	NA
5. P	Q9Z0N1	Eukaryotic translation initiation factor 2 subunit 3, X-linked	1.21e-03	5.88e-04	NA	NA
5. P	P99152	Elongation factor Tu	5.94e-06	6.60e-04	NA	NA
5. P	O66429	Elongation factor Tu	6.46e-06	2.32e-04	NA	NA
5. P	B7J241	Elongation factor Tu	4.10e-06	1.90e-03	NA	NA
5. P	Q39Y08	Elongation factor Tu	5.82e-06	4.26e-04	NA	NA
5. P	Q8ZJB2	Elongation factor Tu-A	6.28e-06	3.57e-04	NA	NA
5. P	Q88QP8	Elongation factor Tu-A	6.28e-06	1.92e-04	NA	NA
5. P	Q3ILP4	Elongation factor Tu 1	5.43e-06	2.18e-04	NA	NA
5. P	A0K3L0	Elongation factor Tu	6.48e-06	7.43e-05	NA	NA
5. P	Q925Y6	Elongation factor Tu	4.69e-06	3.21e-03	NA	NA
5. P	Q3A6R2	Elongation factor Tu 1	6.15e-06	5.41e-03	NA	NA
5. P	P23845	Sulfate adenylyltransferase subunit 1	3.17e-05	1.90e-03	NA	NA
5. P	B1HMZ0	Elongation factor Tu	5.42e-06	1.57e-04	NA	NA
5. P	Q1CCT9	Elongation factor Tu 2	6.66e-06	3.57e-04	NA	NA
5. P	Q7UMZ0	Elongation factor Tu	8.78e-06	1.70e-04	NA	NA
5. P	C4ZZQ5	Sulfate adenylyltransferase subunit 1	2.74e-05	1.90e-03	NA	NA
5. P	Q5FFE6	Elongation factor Tu	7.40e-06	5.41e-05	NA	NA
5. P	Q0TEA7	Sulfate adenylyltransferase subunit 1	2.74e-05	1.90e-03	NA	NA
5. P	P68103	Elongation factor 1-alpha 1	7.06e-05	1.90e-02	NA	NA
5. P	Q1IFW8	Elongation factor Tu	5.84e-06	1.36e-04	NA	NA
5. P	P42475	Elongation factor Tu	6.42e-06	3.37e-04	NA	NA
5. P	P0CN30	Elongation factor 1-alpha	6.23e-05	2.20e-02	NA	NA
5. P	C1AYS3	Elongation factor Tu	4.80e-06	3.15e-04	NA	NA
5. P	A2RFQ4	Elongation factor Tu	4.76e-06	7.41e-04	NA	NA
5. P	B0CH34	Elongation factor Tu	4.52e-06	1.29e-03	NA	NA
5. P	B0BUR2	Elongation factor Tu	5.39e-06	1.39e-03	NA	NA
5. P	B8G1W4	Elongation factor Tu	6.05e-06	1.06e-03	NA	NA
5. P	P25698	Elongation factor 1-alpha	6.32e-05	1.16e-03	NA	NA
5. P	A4XBP8	Elongation factor Tu	5.16e-06	1.89e-05	NA	NA
5. P	B0BBV3	Elongation factor Tu	8.56e-06	4.52e-04	NA	NA
5. P	P41091	Eukaryotic translation initiation factor 2 subunit 3	1.61e-04	5.39e-04	NA	NA
5. P	O59410	Translation initiation factor 2 subunit gamma	1.84e-05	9.20e-05	NA	NA
5. P	Q14HG2	Sulfate adenylyltransferase subunit 1	2.34e-05	3.12e-03	NA	NA
5. P	Q03033	Elongation factor 1-alpha	7.81e-05	4.52e-04	NA	NA
5. P	Q0AUG3	Elongation factor Tu 2	5.68e-06	1.59e-04	NA	NA
5. P	B7IHU4	Elongation factor Tu	4.56e-06	7.24e-03	NA	NA
5. P	P0A6N2	Elongation factor Tu	8.45e-06	2.34e-04	NA	NA
5. P	Q18CE4	Elongation factor Tu	7.25e-06	1.22e-03	NA	NA
5. P	Q06J54	Elongation factor Tu, chloroplastic	7.76e-06	2.27e-03	NA	NA
5. P	P29521	Elongation factor 1-alpha	7.78e-05	2.40e-03	NA	NA
5. P	P41745	Elongation factor 1-alpha	6.27e-05	7.64e-03	NA	NA
5. P	A4VTQ7	Elongation factor Tu	4.79e-06	5.23e-04	NA	NA
5. P	Q83JC4	Elongation factor Tu	7.65e-06	1.77e-04	NA	NA
5. P	Q6FZC0	Elongation factor Tu 1	4.92e-06	5.56e-03	NA	NA
5. P	Q1R7U0	Sulfate adenylyltransferase subunit 1	2.72e-05	2.07e-03	NA	NA
5. P	Q255F3	Elongation factor Tu	8.38e-06	8.08e-04	NA	NA
5. P	Q6LLV5	Elongation factor Tu 2	5.89e-06	3.57e-04	NA	NA
5. P	B1JDW6	Elongation factor Tu	6.32e-06	1.92e-04	NA	NA
5. P	B2UQY9	Elongation factor Tu	5.84e-06	1.80e-05	NA	NA
5. P	A6UQ14	Elongation factor 1-alpha	3.37e-05	1.83e-03	NA	NA
5. P	Q057A2	Elongation factor Tu	4.83e-06	1.77e-04	NA	NA
5. P	A7NEC7	Elongation factor Tu	5.77e-06	1.65e-04	NA	NA
5. P	Q9NTK5	Obg-like ATPase 1	2.09e-02	5.39e-07	NA	NA
5. P	P42476	Elongation factor Tu	7.10e-06	5.99e-04	NA	NA
5. P	A9WSW5	Elongation factor Tu	4.60e-06	3.43e-05	NA	NA
5. P	Q31IY4	Elongation factor Tu	6.63e-06	2.07e-03	NA	NA
5. P	A8GKK1	Elongation factor Tu 2	6.32e-06	4.35e-04	NA	NA
5. P	A9KRZ4	Elongation factor Tu	7.05e-06	1.31e-04	NA	NA
5. P	A1JS52	Elongation factor Tu 2	7.14e-06	3.18e-04	NA	NA
5. P	B5RDQ7	Sulfate adenylyltransferase subunit 1	2.92e-05	4.11e-03	NA	NA
5. P	P26751	Elongation factor 1-alpha	1.04e-04	2.32e-04	NA	NA
5. P	C4Z2R9	Elongation factor Tu	5.89e-06	2.10e-04	NA	NA
5. P	P90519	Elongation factor 1-alpha	3.77e-05	7.27e-04	NA	NA
5. P	A9AAA4	Translation initiation factor 2 subunit gamma	9.85e-06	3.62e-05	NA	NA
5. P	A5F578	Sulfate adenylyltransferase subunit 1	2.44e-05	1.33e-02	NA	NA
5. P	P75088	Ribosome-binding ATPase YchF	9.08e-02	5.28e-08	NA	NA
5. P	Q9P9Q9	Elongation factor Tu	5.22e-06	3.68e-04	NA	NA
5. P	Q05FI3	Elongation factor Tu	5.39e-06	1.99e-03	NA	NA
5. P	A8YUS2	Elongation factor Tu	5.23e-06	1.21e-03	NA	NA
5. P	A8LC58	Elongation factor Tu	4.99e-06	6.17e-04	NA	NA
5. P	B9L7I8	Elongation factor Tu	7.59e-06	2.23e-04	NA	NA
5. P	Q3AW53	Elongation factor Tu	4.83e-06	2.76e-03	NA	NA
5. P	Q8K9V2	Ribosome-binding ATPase YchF	1.20e-02	3.68e-11	NA	NA
5. P	P40911	Elongation factor 1-alpha	6.75e-05	1.00e-02	NA	NA
5. P	A1JJT0	Sulfate adenylyltransferase subunit 1	3.94e-05	7.44e-03	NA	NA
5. P	Q0HNT9	Elongation factor Tu 2	5.73e-06	1.31e-04	NA	NA
5. P	P48864	Elongation factor Tu	6.09e-06	2.29e-04	NA	NA
5. P	P0CY35	Elongation factor 1-alpha 1	5.73e-05	3.65e-03	NA	NA
5. P	C4K2I2	Elongation factor Tu	5.38e-06	1.39e-03	NA	NA
5. P	C4K4F8	Elongation factor Tu	5.21e-06	1.34e-04	NA	NA
5. P	Q8EK70	Elongation factor Tu 2	5.56e-06	1.82e-04	NA	NA
5. P	A1VIP8	Elongation factor Tu	6.11e-06	2.79e-04	NA	NA
5. P	Q6L202	Elongation factor 1-alpha	1.77e-05	4.52e-04	NA	NA
5. P	P18906	Elongation factor Tu	4.62e-06	7.78e-04	NA	NA
5. P	A2BN41	Elongation factor 1-alpha	4.89e-05	2.77e-04	NA	NA
5. P	P81795	Eukaryotic translation initiation factor 2 subunit 3, X-linked	1.22e-03	5.39e-04	NA	NA
5. P	Q2IXR2	Elongation factor Tu	5.27e-06	1.59e-04	NA	NA
5. P	Q5L3Z9	Elongation factor Tu	5.23e-06	4.26e-04	NA	NA
5. P	Q2VIR3	Eukaryotic translation initiation factor 2 subunit 3B	1.59e-03	5.71e-04	NA	NA
5. P	Q73PN3	Elongation factor Tu	5.87e-06	2.43e-04	NA	NA
5. P	Q2GFN6	Elongation factor Tu	9.30e-06	3.65e-05	NA	NA
5. P	Q5YPG4	Elongation factor Tu	4.95e-06	5.44e-04	NA	NA
5. P	Q4QMW6	Elongation factor Tu 1	6.33e-06	2.34e-04	NA	NA
5. P	P68104	Elongation factor 1-alpha 1	6.94e-05	1.90e-02	NA	NA
5. P	Q32CH9	Sulfate adenylyltransferase subunit 1	2.83e-05	2.95e-03	NA	NA
5. P	A6VKH7	Elongation factor Tu	5.03e-06	2.08e-04	NA	NA
5. P	O69303	Elongation factor Tu	5.77e-06	2.99e-04	NA	NA
5. P	Q6GJC0	Elongation factor Tu	6.17e-06	6.60e-04	NA	NA
5. P	P33171	Elongation factor Tu	7.20e-06	1.88e-03	NA	NA
5. P	O24534	Elongation factor 1-alpha	6.15e-05	7.78e-04	NA	NA
5. P	A8ANW5	Sulfate adenylyltransferase subunit 1	2.57e-05	5.56e-03	NA	NA
5. P	P57939	Elongation factor Tu-A	6.25e-06	2.51e-04	NA	NA
5. P	B7NT95	Sulfate adenylyltransferase subunit 1	2.73e-05	1.90e-03	NA	NA
5. P	Q3A9R3	Elongation factor Tu 1	6.27e-06	1.68e-04	NA	NA
5. P	Q3ZXX3	Elongation factor Tu	6.78e-06	1.17e-03	NA	NA
5. P	P50062	Elongation factor Tu	5.27e-06	1.90e-03	NA	NA
5. P	B2GBC2	Elongation factor Tu	6.20e-06	2.31e-03	NA	NA
5. P	A7HWP7	Elongation factor Tu	5.35e-06	1.47e-03	NA	NA
5. P	B7K834	Elongation factor Tu	7.02e-06	2.34e-03	NA	NA
5. P	Q5HAS0	Elongation factor Tu	7.20e-06	5.41e-05	NA	NA
5. P	Q8KHX9	Elongation factor Tu	4.59e-06	2.49e-03	NA	NA
5. P	Q0W8G2	Elongation factor 1-alpha	1.44e-05	4.05e-05	NA	NA
5. P	B9KFF9	Elongation factor Tu	5.96e-06	3.05e-04	NA	NA
5. P	B3DT29	Elongation factor Tu	6.40e-06	2.69e-04	NA	NA
5. P	A5IYA9	Elongation factor Tu	8.80e-06	5.14e-05	NA	NA
5. P	Q4FQG6	Elongation factor Tu	6.46e-06	1.39e-04	NA	NA
5. P	C5D3R5	Elongation factor Tu	5.24e-06	1.28e-04	NA	NA
5. P	Q9MUP0	Elongation factor Tu, chloroplastic	6.77e-06	5.51e-03	NA	NA
5. P	Q2NJ20	Elongation factor Tu	3.28e-06	6.92e-05	NA	NA
5. P	Q5HIC7	Elongation factor Tu	5.45e-06	6.60e-04	NA	NA
5. P	Q4L3K9	Elongation factor Tu	5.99e-06	1.10e-03	NA	NA
5. P	P18668	Elongation factor Tu	7.18e-06	1.88e-03	NA	NA
5. P	Q2A1M0	Elongation factor Tu	5.60e-06	1.65e-04	NA	NA
5. P	B0REJ6	Nucleotide-binding protein CMS1991	2.50e-02	2.49e-02	NA	NA
5. P	A1UBL1	Elongation factor Tu	4.99e-06	4.84e-04	NA	NA
5. P	Q32B27	Elongation factor Tu	8.44e-06	1.77e-04	NA	NA
5. P	B8BBN7	Obg-like ATPase 1	4.53e-02	1.02e-05	NA	NA
5. P	O63930	Elongation factor Tu, chloroplastic (Fragment)	4.68e-05	1.53e-03	NA	NA
5. P	Q83ES6	Elongation factor Tu	5.12e-06	9.20e-05	NA	NA
5. P	Q1AU14	Elongation factor Tu	6.14e-06	3.62e-05	NA	NA
5. P	P17508	Elongation factor 1-alpha, oocyte form	6.52e-05	2.34e-02	NA	NA
5. P	Q9SA73	Obg-like ATPase 1	4.68e-02	2.43e-06	NA	NA
5. P	Q9YIC0	Elongation factor 1-alpha	6.72e-05	1.18e-02	NA	NA
5. P	A3PV96	Elongation factor Tu	5.27e-06	4.84e-04	NA	NA
5. P	A2STF0	Elongation factor 1-alpha	1.57e-05	3.24e-04	NA	NA
5. P	Q826Z7	Elongation factor Tu 2	3.60e-06	4.23e-03	NA	NA
5. P	A2Q0Z0	Elongation factor 1-alpha 1	6.87e-05	2.18e-02	NA	NA
5. P	P0CT32	Elongation factor 1-alpha	6.64e-05	6.09e-03	NA	NA
5. P	Q4MYA4	Elongation factor Tu, apicoplast	6.77e-06	2.84e-03	NA	NA
5. P	B1IVA7	Elongation factor Tu 2	8.11e-06	2.34e-04	NA	NA
5. P	O59153	Elongation factor 1-alpha	6.93e-05	2.16e-04	NA	NA
5. P	Q11HA6	Elongation factor Tu	4.58e-06	9.33e-04	NA	NA
5. P	B3PMU1	Elongation factor Tu	7.67e-06	3.27e-04	NA	NA
5. P	Q0RRS3	Elongation factor Tu	4.93e-06	4.94e-04	NA	NA
5. P	Q88QN7	Elongation factor Tu-B	6.00e-06	1.36e-04	NA	NA
5. P	Q8PC51	Elongation factor Tu-B	5.69e-06	2.14e-04	NA	NA
5. P	Q8EX18	Elongation factor Tu	4.74e-06	8.39e-05	NA	NA
5. P	A4J0Z5	Elongation factor Tu	6.09e-06	1.56e-03	NA	NA
5. P	Q65QG6	Elongation factor Tu	5.56e-06	1.04e-04	NA	NA
5. P	A8G1F0	Elongation factor Tu	5.60e-06	1.72e-04	NA	NA
5. P	Q8KT97	Elongation factor Tu	5.16e-06	4.35e-04	NA	NA
5. P	B2HSL3	Elongation factor Tu	4.83e-06	9.16e-04	NA	NA
5. P	Q0TA85	Elongation factor Tu 2	8.24e-06	2.34e-04	NA	NA
5. P	A8GYW2	Elongation factor Tu	6.49e-06	2.46e-04	NA	NA
5. P	Q1GP97	Elongation factor Tu	6.14e-06	7.74e-05	NA	NA
5. P	Q7M7F1	Elongation factor Tu	5.46e-06	1.80e-03	NA	NA
5. P	B2GIL2	Elongation factor Tu	4.85e-06	2.15e-05	NA	NA
5. P	A0ALY8	Elongation factor Tu	5.17e-06	1.45e-04	NA	NA
5. P	A6GYU7	Elongation factor Tu	5.52e-06	1.20e-03	NA	NA
5. P	B9DKV8	Elongation factor Tu	5.34e-06	8.65e-04	NA	NA
5. P	B0UV21	Elongation factor Tu	6.39e-06	1.20e-04	NA	NA
5. P	B6JET1	Elongation factor Tu	5.20e-06	8.83e-05	NA	NA
5. P	Q8M9W7	Elongation factor Tu, chloroplastic	9.58e-05	1.35e-04	NA	NA
5. P	Q5PEH2	Sulfate adenylyltransferase subunit 1	2.96e-05	3.65e-03	NA	NA
5. P	A5IHR6	Elongation factor Tu	6.10e-06	7.63e-04	NA	NA
5. P	Q21SF0	Elongation factor Tu 1	6.26e-06	2.15e-05	NA	NA
5. P	P94400	Putative metal chaperone YciC	7.38e-02	4.43e-03	NA	NA
5. P	Q8E645	Elongation factor Tu	4.62e-06	5.44e-04	NA	NA
5. P	B3EH93	Elongation factor Tu	8.00e-06	1.51e-04	NA	NA
5. P	P56292	Elongation factor Tu, chloroplastic	7.08e-06	4.51e-03	NA	NA
5. P	P42479	Elongation factor Tu	5.57e-06	2.46e-04	NA	NA
5. P	A6KYK9	Elongation factor Tu	5.67e-06	3.15e-04	NA	NA
5. P	P91917	Obg-like ATPase 1	3.71e-02	1.62e-07	NA	NA
5. P	Q00251	Elongation factor 1-alpha	7.28e-05	7.34e-04	NA	NA
5. P	A5VXN3	Elongation factor Tu	6.13e-06	1.92e-04	NA	NA
5. P	Q4A9G1	Elongation factor Tu	6.29e-06	4.64e-05	NA	NA
5. P	B7N6Y1	Sulfate adenylyltransferase subunit 1	2.73e-05	3.68e-03	NA	NA
5. P	Q6AP86	Elongation factor Tu 1	6.04e-06	2.13e-03	NA	NA
5. P	Q3IUD8	Elongation factor 1-alpha	1.43e-05	4.39e-04	NA	NA
5. P	A5I7K8	Elongation factor Tu	7.08e-06	1.65e-04	NA	NA
5. P	Q8ZMF5	Sulfate adenylyltransferase subunit 1	3.10e-05	2.61e-03	NA	NA
5. P	P26184	Elongation factor Tu	5.24e-06	1.08e-03	NA	NA
5. P	Q8P1W4	Elongation factor Tu	4.94e-06	1.37e-03	NA	NA
5. P	Q1IX70	Elongation factor Tu	7.36e-06	1.99e-04	NA	NA
5. P	Q250N4	Elongation factor Tu	6.11e-06	1.06e-03	NA	NA
5. P	A7FNJ0	Elongation factor Tu 1	6.27e-06	1.22e-03	NA	NA
5. P	Q1D7V1	Elongation factor Tu 1	5.51e-06	3.24e-04	NA	NA
5. P	A7I656	Elongation factor 1-alpha	1.37e-05	2.23e-03	NA	NA
5. P	Q6HPR0	Elongation factor Tu	4.87e-06	1.37e-03	NA	NA
5. P	P06805	Elongation factor 1-alpha	5.52e-05	4.62e-02	NA	NA
5. P	A8G708	Elongation factor Tu	5.10e-06	7.00e-04	NA	NA
5. P	A8HTW6	Elongation factor Tu	5.71e-06	1.45e-04	NA	NA
5. P	B0JSE0	Elongation factor Tu	7.88e-06	2.92e-03	NA	NA
5. P	Q5R1X2	Elongation factor 1-alpha 1	6.55e-05	1.90e-02	NA	NA
5. P	A7WYX6	Elongation factor Tu	5.91e-06	6.60e-04	NA	NA
5. P	B7HQU2	Elongation factor Tu	4.91e-06	2.01e-03	NA	NA
5. P	B9IZJ2	Elongation factor Tu	5.02e-06	2.01e-03	NA	NA
5. P	Q57KJ0	Sulfate adenylyltransferase subunit 1	3.12e-05	2.34e-03	NA	NA
5. P	A8A779	Elongation factor Tu 2	8.84e-06	2.34e-04	NA	NA
5. P	Q1CN86	Elongation factor Tu 1	5.31e-06	7.63e-04	NA	NA
5. P	A6MW28	Elongation factor Tu, chloroplastic	7.47e-06	4.94e-04	NA	NA
5. P	P02991	Elongation factor Tu, chloroplastic	7.10e-06	2.25e-03	NA	NA
5. P	A0JPJ7	Obg-like ATPase 1	3.57e-02	5.97e-07	NA	NA
5. P	Q5L890	Elongation factor Tu	5.42e-06	9.42e-04	NA	NA
5. P	Q3A6P9	Elongation factor Tu 2	6.47e-06	5.66e-03	NA	NA
5. P	Q7MGR1	Elongation factor Tu 2	4.80e-06	8.81e-04	NA	NA
5. P	P34823	Elongation factor 1-alpha	6.30e-05	3.79e-04	NA	NA
5. P	A4JAM5	Elongation factor Tu	6.68e-06	1.77e-04	NA	NA
5. P	Q7UZY7	Elongation factor Tu	5.22e-06	1.45e-03	NA	NA
5. P	A8A3N0	Sulfate adenylyltransferase subunit 1	2.61e-05	2.64e-03	NA	NA
5. P	Q8SWU7	Obg-like ATPase 1	3.87e-02	1.26e-07	NA	NA
5. P	O29663	Translation initiation factor 2 subunit gamma	1.37e-05	2.20e-04	NA	NA
5. P	Q0BUQ2	Elongation factor Tu	5.82e-06	8.06e-05	NA	NA
5. P	P51554	Elongation factor 1-alpha	7.34e-05	1.80e-02	NA	NA
5. P	P51287	Elongation factor Tu, chloroplastic	6.86e-06	1.19e-03	NA	NA
5. P	Q2JFH8	Elongation factor Tu	4.87e-06	5.49e-04	NA	NA
5. P	Q0C1F4	Elongation factor Tu 1	5.29e-06	2.23e-03	NA	NA
5. P	A5DPE3	Elongation factor 1-alpha	5.95e-05	5.72e-03	NA	NA
5. P	A7GK18	Elongation factor Tu	5.40e-06	9.89e-04	NA	NA
5. P	B5E653	Elongation factor Tu	4.87e-06	1.21e-03	NA	NA
5. P	C1ET37	Elongation factor Tu	4.87e-06	1.37e-03	NA	NA
5. P	A4VZZ3	Elongation factor Tu	5.39e-06	5.23e-04	NA	NA
5. P	B6YQ04	Elongation factor Tu	4.96e-06	4.10e-04	NA	NA
5. P	Q6MJ00	Elongation factor Tu	5.63e-06	5.13e-04	NA	NA
5. P	A7HBL7	Elongation factor Tu	5.71e-06	1.15e-02	NA	NA
5. P	B5RM34	Elongation factor Tu	4.52e-06	1.25e-03	NA	NA
5. P	Q33451	Elongation factor Tu, apicoplast	7.20e-06	1.31e-02	NA	NA
5. P	Q9YAV0	Elongation factor 1-alpha	5.19e-05	2.27e-03	NA	NA
5. P	B2VG01	Sulfate adenylyltransferase subunit 1	2.88e-05	7.71e-03	NA	NA
5. P	O96719	Eukaryotic translation initiation factor 2 subunit gamma	9.15e-06	5.41e-05	NA	NA
5. P	Q5ZYP5	Elongation factor Tu	6.16e-06	7.63e-04	NA	NA
5. P	Q5PIW4	Elongation factor Tu	6.68e-06	2.03e-04	NA	NA
5. P	A4YCR6	Elongation factor 1-alpha	4.17e-05	1.35e-04	NA	NA
5. P	P14634	Elongation factor Tu, plastid	8.70e-06	9.23e-03	NA	NA
5. P	Q5R821	Obg-like ATPase 1	3.84e-02	3.27e-07	NA	NA
5. P	P02993	Elongation factor 1-alpha	8.70e-05	6.43e-03	NA	NA
5. P	Q2NVM8	Sulfate adenylyltransferase subunit 1	1.08e-04	8.99e-03	NA	NA
5. P	Q41011	Elongation factor 1-alpha	7.37e-05	8.73e-04	NA	NA
5. P	Q6YQV8	Elongation factor Tu	3.35e-06	7.58e-05	NA	NA
5. P	A6LLL1	Elongation factor Tu	4.44e-06	7.78e-03	NA	NA
5. P	Q62GK3	Elongation factor Tu	6.85e-06	1.22e-04	NA	NA
5. P	Q0ID59	Elongation factor Tu	4.85e-06	3.55e-03	NA	NA
5. P	B5FGJ9	Sulfate adenylyltransferase subunit 1	2.51e-05	9.16e-04	NA	NA
5. P	B8GIQ3	Elongation factor 1-alpha	1.96e-05	8.06e-05	NA	NA
5. P	B0TC54	Elongation factor Tu	6.04e-06	2.36e-03	NA	NA
5. P	A0PXT1	Elongation factor Tu	4.93e-06	3.61e-04	NA	NA
5. P	P0DH99	Elongation factor 1-alpha 1	6.24e-05	1.20e-03	NA	NA
5. P	A6UV43	Elongation factor 1-alpha	2.67e-05	1.17e-03	NA	NA
5. P	A1S204	Elongation factor Tu	5.85e-06	7.90e-05	NA	NA
5. P	O50306	Elongation factor Tu	5.52e-06	4.89e-04	NA	NA
5. P	P13552	Elongation factor Tu	8.80e-06	7.13e-04	NA	NA
5. P	Q5F5Q8	Elongation factor Tu	6.07e-06	1.84e-04	NA	NA
5. P	A4G9U0	Elongation factor Tu	6.36e-06	2.06e-04	NA	NA
5. P	P17507	Elongation factor 1-alpha, oocyte form	6.85e-05	1.07e-02	NA	NA
5. P	B7HJ46	Elongation factor Tu	4.90e-06	1.37e-03	NA	NA
5. P	Q11Q98	Elongation factor Tu	4.94e-06	1.33e-03	NA	NA
5. P	A9MT05	Elongation factor Tu	7.10e-06	2.03e-04	NA	NA
5. P	A1RRJ3	Elongation factor 1-alpha	5.28e-05	5.46e-03	NA	NA
5. P	A7NS01	Elongation factor Tu 2	7.48e-06	3.33e-03	NA	NA
5. P	A4FWW9	Translation initiation factor 2 subunit gamma	5.47e-04	2.82e-05	NA	NA
5. P	Q12SW1	Elongation factor Tu	5.94e-06	4.10e-05	NA	NA
5. P	Q2NQL7	Elongation factor Tu	5.35e-06	1.84e-04	NA	NA
5. P	Q73SD1	Elongation factor Tu	5.09e-06	7.85e-04	NA	NA
5. P	A4SRG8	Sulfate adenylyltransferase subunit 1	4.06e-05	1.97e-03	NA	NA
5. P	A1AIF3	Elongation factor Tu 2	8.33e-06	2.34e-04	NA	NA
5. P	P42471	Elongation factor Tu	5.51e-06	1.49e-05	NA	NA
5. P	Q47JA5	Elongation factor Tu	5.15e-06	2.27e-04	NA	NA
5. P	A7Z0N5	Elongation factor Tu	5.95e-06	5.28e-04	NA	NA
5. P	A4WVL0	Elongation factor Tu	6.38e-06	3.87e-04	NA	NA
5. P	B8I5N8	Elongation factor Tu	5.84e-06	2.19e-05	NA	NA
5. P	A6W5T5	Elongation factor Tu	4.92e-06	3.97e-05	NA	NA
5. P	A9KW88	Elongation factor Tu 1	5.98e-06	1.13e-04	NA	NA
5. P	A3MRT8	Elongation factor Tu	6.56e-06	1.22e-04	NA	NA
5. P	A1KB29	Elongation factor Tu	5.16e-06	2.43e-04	NA	NA
5. P	A9BHA7	Elongation factor Tu	6.39e-06	2.15e-03	NA	NA
5. P	Q8KAH0	Elongation factor Tu	5.78e-06	3.87e-04	NA	NA
5. P	Q3BWY6	Elongation factor Tu	6.02e-06	2.85e-04	NA	NA
5. P	Q6MU81	Elongation factor Tu	4.70e-06	3.72e-04	NA	NA
5. P	Q0I1U9	Elongation factor Tu	6.72e-06	1.20e-04	NA	NA
5. P	Q7U4D1	Elongation factor Tu	5.17e-06	1.14e-03	NA	NA
5. P	A1SNN5	Elongation factor Tu	4.58e-06	5.65e-04	NA	NA
5. P	Q9PK73	Elongation factor Tu	NA	4.98e-04	NA	NA
5. P	Q7VRP0	Elongation factor Tu	5.11e-06	2.97e-04	NA	NA
5. P	Q4K519	Elongation factor Tu	6.51e-06	1.59e-04	NA	NA
5. P	O74824	GTP-binding protein gtr1	2.83e-05	1.63e-04	NA	NA
5. P	B7LEG9	Sulfate adenylyltransferase subunit 1	2.83e-05	3.06e-03	NA	NA
5. P	Q5HRK4	Elongation factor Tu	5.43e-06	2.11e-03	NA	NA
5. P	P49462	Elongation factor Tu, chloroplastic	9.13e-06	1.19e-02	NA	NA
5. P	Q01520	Elongation factor 1-alpha	7.67e-05	8.91e-03	NA	NA
5. P	B6YW69	Translation initiation factor 2 subunit gamma	8.55e-06	2.94e-04	NA	NA
5. P	P19039	Elongation factor 1-alpha	7.17e-05	1.50e-03	NA	NA
5. P	C3PKP2	Elongation factor Tu	6.32e-06	4.31e-04	NA	NA
5. P	Q4URC5	Elongation factor Tu 2	6.42e-06	2.43e-04	NA	NA
5. P	A5GAW4	Elongation factor Tu	5.13e-06	7.27e-04	NA	NA
5. P	A9BCK0	Elongation factor Tu	5.10e-06	8.32e-04	NA	NA
5. P	Q17VM8	Elongation factor Tu	6.22e-06	1.27e-04	NA	NA
5. P	A5USJ1	Elongation factor Tu 1	6.22e-06	2.56e-03	NA	NA
5. P	B7L0X9	Sulfate adenylyltransferase subunit 1	2.22e-05	1.90e-03	NA	NA
5. P	Q3SLQ1	Elongation factor Tu	5.97e-06	2.20e-04	NA	NA
5. P	P17196	Elongation factor 1-alpha	5.27e-05	3.34e-04	NA	NA
5. P	A4IXZ5	Sulfate adenylyltransferase subunit 1	1.63e-03	2.38e-03	NA	NA
5. P	Q7MYE8	Elongation factor Tu 2	5.89e-06	1.22e-04	NA	NA
5. P	Q96WZ1	Elongation factor 1-alpha	6.25e-05	2.60e-02	NA	NA
5. P	A0M3Z6	Elongation factor Tu	6.53e-06	6.05e-04	NA	NA
5. P	A7I3U7	Elongation factor Tu	7.33e-06	1.68e-04	NA	NA
5. P	A3PGI1	Elongation factor Tu	6.31e-06	3.30e-04	NA	NA
5. P	Q5WLR4	Elongation factor Tu	4.93e-06	7.06e-04	NA	NA
5. P	Q3SX43	Ras-related GTP-binding protein A	4.58e-05	1.01e-04	NA	NA
5. P	A6LE88	Elongation factor Tu	6.33e-06	6.67e-04	NA	NA
5. P	A5IQA2	Elongation factor Tu	5.78e-06	6.60e-04	NA	NA
5. P	Q055E6	Elongation factor Tu	7.28e-06	4.64e-05	NA	NA
5. P	C5C0J3	Elongation factor Tu	4.69e-06	3.62e-05	NA	NA
5. P	P60339	Elongation factor Tu-B	8.13e-06	3.54e-04	NA	NA
5. P	O27132	Elongation factor 1-alpha	1.21e-05	4.85e-03	NA	NA
5. P	Q0AF46	Elongation factor Tu 2	5.21e-06	2.71e-04	NA	NA
5. P	A2BYN4	Elongation factor Tu	5.12e-06	1.59e-03	NA	NA
5. P	Q65PA9	Elongation factor Tu	6.33e-06	2.10e-04	NA	NA
5. P	Q31XB3	Sulfate adenylyltransferase subunit 1	2.45e-05	2.69e-03	NA	NA
5. P	Q1BDD3	Elongation factor Tu	4.95e-06	4.84e-04	NA	NA
5. P	A8F4Q9	Elongation factor Tu	5.73e-06	1.14e-03	NA	NA
5. P	A5V604	Elongation factor Tu	5.28e-06	1.45e-04	NA	NA
5. P	B1LQ72	Sulfate adenylyltransferase subunit 1	3.17e-05	1.90e-03	NA	NA
5. P	Q03F25	Elongation factor Tu	5.55e-06	1.53e-03	NA	NA
5. P	Q39KI2	Elongation factor Tu	6.64e-06	7.43e-05	NA	NA
5. P	A1AX82	Elongation factor Tu 2	8.77e-06	9.25e-04	NA	NA
5. P	C5A5P4	Elongation factor 1-alpha	7.16e-05	2.54e-05	NA	NA
5. P	A5GW14	Elongation factor Tu	4.84e-06	1.92e-03	NA	NA
5. P	B8HD11	Elongation factor Tu	4.73e-06	2.51e-05	NA	NA
5. P	B0SUQ7	Elongation factor Tu 1	5.96e-06	8.75e-03	NA	NA
5. P	A2S7F9	Elongation factor Tu	6.03e-06	1.22e-04	NA	NA
5. P	Q8GTY0	Elongation factor 1-alpha 4	7.16e-05	1.20e-03	NA	NA
5. P	P59506	Elongation factor Tu	5.73e-06	9.52e-04	NA	NA
5. P	P57288	Ribosome-binding ATPase YchF	1.43e-02	6.23e-11	NA	NA
5. P	A9M5Q2	Elongation factor Tu	4.49e-06	3.15e-03	NA	NA
5. P	Q2S1P8	Elongation factor Tu	5.36e-06	1.82e-04	NA	NA
5. P	A5ULM5	Elongation factor 1-alpha	1.24e-05	6.73e-03	NA	NA
5. P	Q07KJ2	Elongation factor Tu	4.96e-06	4.10e-05	NA	NA
5. P	O94362	Uncharacterized GTP-binding protein C428.15	4.54e-02	1.53e-08	NA	NA
5. P	Q3AMT6	Elongation factor Tu	4.83e-06	3.52e-03	NA	NA
5. P	P17506	Elongation factor 1-alpha	8.06e-05	6.26e-03	NA	NA
5. P	Q1JMR3	Elongation factor Tu	5.27e-06	7.41e-04	NA	NA
5. P	P43926	Elongation factor Tu	5.94e-06	3.44e-04	NA	NA
5. P	Q4A7K0	Elongation factor Tu	7.75e-06	3.10e-05	NA	NA
5. P	A1R8U9	Elongation factor Tu	4.53e-06	1.87e-05	NA	NA
5. P	Q1QN32	Elongation factor Tu	5.52e-06	8.92e-05	NA	NA
5. P	Q7MPF2	Sulfate adenylyltransferase subunit 1	2.15e-05	5.72e-03	NA	NA
5. P	Q2HJN9	Elongation factor 1-alpha 4	5.71e-05	6.98e-03	NA	NA
5. P	Q976B1	Elongation factor 1-alpha	4.11e-05	1.90e-04	NA	NA
5. P	Q3YRK7	Elongation factor Tu	8.30e-06	2.97e-05	NA	NA
5. P	P64027	Elongation factor Tu	6.15e-06	1.25e-04	NA	NA
5. P	Q2GJ61	Elongation factor Tu	6.47e-06	4.10e-05	NA	NA
5. P	A1ALS6	Elongation factor Tu	5.42e-06	4.11e-03	NA	NA
5. P	Q8DCQ7	Elongation factor Tu 2	5.59e-06	4.52e-04	NA	NA
5. P	B4RTW4	Sulfate adenylyltransferase subunit 1	2.35e-05	1.62e-02	NA	NA
5. P	Q9HM89	Elongation factor 1-alpha	1.43e-05	2.19e-03	NA	NA
5. P	B2SFC9	Elongation factor Tu	5.53e-06	1.65e-04	NA	NA
5. P	A8EZL8	Elongation factor Tu	5.05e-06	1.59e-03	NA	NA
5. P	Q9TLV8	Elongation factor Tu, chloroplastic	7.18e-06	9.89e-04	NA	NA
5. P	P18905	Elongation factor Tu, chloroplastic	9.21e-06	1.70e-03	NA	NA
5. P	Q40034	Elongation factor 1-alpha	6.37e-05	2.25e-03	NA	NA
5. P	Q8D240	Elongation factor Tu	5.12e-06	2.18e-04	NA	NA
5. P	P02994	Elongation factor 1-alpha	7.06e-05	6.55e-03	NA	NA
5. P	Q48D34	Elongation factor Tu	6.80e-06	1.60e-04	NA	NA
5. P	Q6AP73	Elongation factor Tu 2	5.95e-06	3.45e-03	NA	NA
5. P	A5EX84	Elongation factor Tu	5.51e-06	2.23e-04	NA	NA
5. P	B4SBU5	Elongation factor Tu	8.22e-06	4.39e-04	NA	NA
5. P	Q2RQV8	Elongation factor Tu 1	5.31e-06	1.37e-03	NA	NA
5. P	B4TFX1	Sulfate adenylyltransferase subunit 1	3.12e-05	2.82e-03	NA	NA
5. P	Q8Y422	Elongation factor Tu	5.30e-06	1.45e-04	NA	NA
5. P	A5ELM9	Elongation factor Tu	5.28e-06	9.87e-05	NA	NA
5. P	Q04B37	Elongation factor Tu	5.62e-06	2.45e-03	NA	NA
5. P	A5FQQ5	Elongation factor Tu	6.68e-06	1.17e-03	NA	NA
5. P	Q5E830	Sulfate adenylyltransferase subunit 1	2.34e-05	5.49e-04	NA	NA
5. P	Q9KUZ6	Elongation factor Tu-B	5.27e-06	6.57e-05	NA	NA
5. P	A0R8H8	Elongation factor Tu	4.85e-06	1.37e-03	NA	NA
5. P	A1QZR2	Elongation factor Tu	4.33e-06	9.52e-04	NA	NA
5. P	Q30TQ5	Elongation factor Tu	6.84e-06	7.98e-05	NA	NA
5. P	A3NEI1	Elongation factor Tu	6.65e-06	1.22e-04	NA	NA
5. P	Q8UE16	Elongation factor Tu	4.66e-06	1.68e-03	NA	NA
5. P	A4QBH0	Elongation factor Tu	6.91e-06	1.62e-04	NA	NA
5. P	A5VJ92	Elongation factor Tu	5.73e-06	6.09e-03	NA	NA
5. P	Q2W2H3	Elongation factor Tu	5.13e-06	2.97e-04	NA	NA
5. P	A6T3K6	Elongation factor Tu	6.20e-06	6.71e-05	NA	NA
5. P	Q20EU5	Elongation factor Tu, chloroplastic	7.01e-06	2.57e-02	NA	NA
5. P	B0KK53	Elongation factor Tu	6.46e-06	1.92e-04	NA	NA
5. P	F1QGW6	Eukaryotic translation initiation factor 2 subunit 3	1.21e-03	7.48e-04	NA	NA
5. P	C0QVZ4	Elongation factor Tu	1.05e-05	6.92e-05	NA	NA
5. P	A2CC87	Elongation factor Tu	5.31e-06	1.77e-04	NA	NA
5. P	Q67JU1	Elongation factor Tu	4.74e-06	1.77e-04	NA	NA
5. P	A6UPK8	Translation initiation factor 2 subunit gamma	7.32e-04	3.16e-06	NA	NA
5. P	Q21IS6	Sulfate adenylyltransferase subunit 1	2.57e-05	6.61e-03	NA	NA
5. P	Q0TMN0	Elongation factor Tu	5.14e-06	4.27e-05	NA	NA
5. P	A5VR08	Elongation factor Tu	4.66e-06	3.15e-03	NA	NA
5. P	B1MGH7	Elongation factor Tu	5.37e-06	2.23e-04	NA	NA
5. P	C6A4R7	Elongation factor 1-alpha	7.30e-05	1.72e-04	NA	NA
5. P	P25166	Elongation factor 1-alpha	6.16e-05	8.36e-03	NA	NA
5. P	P44681	Ribosome-binding ATPase YchF	2.45e-02	4.98e-11	NA	NA
5. P	Q2G0N0	Elongation factor Tu	5.35e-06	6.60e-04	NA	NA
5. P	Q9Y713	Elongation factor 1-alpha	7.15e-05	1.66e-02	NA	NA
5. P	Q66FQ9	Elongation factor Tu 1	5.40e-06	1.22e-03	NA	NA
5. P	P0A1H5	Elongation factor Tu	7.20e-06	2.03e-04	NA	NA
5. P	P33169	Elongation factor Tu	5.73e-06	2.79e-04	NA	NA
5. P	Q5XD49	Elongation factor Tu	4.50e-06	7.41e-04	NA	NA
5. P	Q8EB10	Sulfate adenylyltransferase subunit 1	3.01e-05	1.10e-02	NA	NA
5. P	P42481	Elongation factor Tu	6.47e-06	1.20e-04	NA	NA
5. P	Q74JU6	Elongation factor Tu	5.78e-06	3.86e-03	NA	NA
5. P	Q2RQU6	Elongation factor Tu 2	5.27e-06	2.45e-03	NA	NA
5. P	Q0TCC0	Elongation factor Tu 1	8.59e-06	1.77e-04	NA	NA
5. P	Q5ZMS3	Eukaryotic translation initiation factor 2 subunit 3	1.24e-03	4.14e-04	NA	NA
5. P	Q8KTA6	Elongation factor Tu	5.66e-06	1.76e-03	NA	NA
5. P	C4LL63	Elongation factor Tu	7.33e-06	7.13e-05	NA	NA
5. P	Q04N79	Elongation factor Tu	4.71e-06	1.21e-03	NA	NA
5. P	B0T2B5	Elongation factor Tu 2	5.48e-06	6.20e-03	NA	NA
5. P	B0B7N8	Elongation factor Tu	8.44e-06	4.52e-04	NA	NA
5. P	A7ZUJ2	Elongation factor Tu 2	7.15e-06	2.43e-04	NA	NA
5. P	Q5PBH1	Elongation factor Tu	7.00e-06	8.92e-05	NA	NA
5. P	B0R8C3	Elongation factor 1-alpha	1.46e-05	2.19e-03	NA	NA
5. P	Q8TRC4	Elongation factor 1-alpha	1.45e-05	5.41e-03	NA	NA
5. P	Q2S8Z8	Elongation factor Tu	5.84e-06	4.22e-04	NA	NA
5. P	B8DLL9	Elongation factor Tu	5.80e-06	1.30e-04	NA	NA
5. P	O74544	GTP-binding protein gtr2	4.15e-05	1.59e-04	NA	NA
5. P	B0R6Y7	Translation initiation factor 2 subunit gamma	8.24e-04	9.31e-06	NA	NA
5. P	O21245	Elongation factor Tu, mitochondrial	6.62e-06	7.63e-04	NA	NA
5. P	Q00080	Elongation factor 1-alpha	4.96e-05	2.23e-03	NA	NA
5. P	P0A6N3	Elongation factor Tu	7.53e-06	2.34e-04	NA	NA
5. P	Q89J82	Elongation factor Tu	5.02e-06	1.42e-04	NA	NA
5. P	B1XI63	Elongation factor Tu	8.00e-06	4.39e-03	NA	NA
5. P	C0ZVT7	Elongation factor Tu	4.95e-06	9.58e-05	NA	NA
5. P	P23568	Elongation factor Tu	4.40e-06	1.84e-04	NA	NA
5. P	A0JZ88	Elongation factor Tu	4.52e-06	7.13e-05	NA	NA
5. P	Q9Z0N2	Eukaryotic translation initiation factor 2 subunit 3, Y-linked	1.20e-03	4.61e-04	NA	NA
5. P	P56003	Elongation factor Tu	5.94e-06	5.08e-04	NA	NA
5. P	Q5VTE0	Putative elongation factor 1-alpha-like 3	6.86e-05	2.22e-02	NA	NA
5. P	Q41803	Elongation factor 1-alpha	7.24e-05	3.15e-04	NA	NA
5. P	B2S0H9	Elongation factor Tu	4.22e-06	1.68e-03	NA	NA
5. P	Q7ZWM6	Obg-like ATPase 1	3.55e-02	1.03e-07	NA	NA
5. P	Q8CQ81	Elongation factor Tu	5.85e-06	2.11e-03	NA	NA
5. P	P37518	Ribosome-binding ATPase YchF	2.88e-02	4.85e-11	NA	NA
5. P	Q0T1I2	Sulfate adenylyltransferase subunit 1	2.84e-05	5.36e-03	NA	NA
5. P	A7HM54	Elongation factor Tu	4.90e-06	8.56e-04	NA	NA
5. P	Q73H85	Elongation factor Tu 2	3.40e-06	3.75e-04	NA	NA
5. P	Q9V0V7	Elongation factor 1-alpha	7.92e-05	1.52e-04	NA	NA
5. P	A3CP09	Elongation factor Tu	4.94e-06	7.63e-04	NA	NA
5. P	Q2JUX4	Elongation factor Tu	7.68e-06	1.24e-02	NA	NA
5. P	P29542	Elongation factor Tu-1	4.82e-06	5.60e-04	NA	NA
5. P	Q87SX9	Sulfate adenylyltransferase subunit 1	2.18e-05	6.32e-03	NA	NA
5. P	Q88VE0	Elongation factor Tu	5.68e-06	6.05e-04	NA	NA
5. P	Q9XD38	Elongation factor Tu	6.66e-06	1.32e-05	NA	NA
5. P	Q03QN5	Elongation factor Tu	5.43e-06	4.35e-03	NA	NA
5. P	Q5M5I8	Elongation factor Tu	5.34e-06	1.50e-03	NA	NA
5. P	B7IT17	Elongation factor Tu	4.90e-06	2.09e-03	NA	NA
5. P	C1KZK6	Elongation factor Tu	5.23e-06	1.45e-04	NA	NA
5. P	Q7TT91	Elongation factor Tu	6.32e-06	1.02e-04	NA	NA
5. P	Q0SY20	Elongation factor Tu 2	8.34e-06	2.34e-04	NA	NA
5. P	A5WGK9	Elongation factor Tu 1	5.65e-06	3.24e-04	NA	NA
5. P	A1ST27	Sulfate adenylyltransferase subunit 1	2.61e-05	1.69e-02	NA	NA
5. P	Q47UU9	Elongation factor Tu	5.94e-06	4.49e-05	NA	NA
5. P	Q7N9B1	Elongation factor Tu 1	5.50e-06	1.79e-04	NA	NA
5. P	B5QW22	Sulfate adenylyltransferase subunit 1	3.31e-05	4.15e-03	NA	NA
5. P	O83217	Elongation factor Tu	6.32e-06	7.27e-04	NA	NA
5. P	A5UHC1	Elongation factor Tu	6.86e-06	3.44e-04	NA	NA
5. P	Q83NT9	Elongation factor Tu	5.10e-06	2.26e-05	NA	NA
5. P	Q9TMM9	Elongation factor Tu, apicoplast	7.13e-06	1.38e-02	NA	NA
5. P	Q2K9L8	Elongation factor Tu 2	4.63e-06	1.15e-02	NA	NA
5. P	C9WPN6	Eukaryotic translation initiation factor 2 subunit 3, Y-linked	1.22e-03	6.60e-04	NA	NA
5. P	A5F3K0	Elongation factor Tu	5.03e-06	6.57e-05	NA	NA
5. P	Q877P8	Elongation factor Tu	5.39e-06	3.68e-04	NA	NA
5. P	Q4URD7	Elongation factor Tu 1	6.14e-06	2.14e-04	NA	NA
5. P	Q99QM0	Elongation factor Tu	5.32e-06	2.25e-03	NA	NA
5. P	Q09069	Elongation factor 1-alpha	8.26e-05	3.06e-03	NA	NA
5. P	A8YZP5	Elongation factor Tu	5.92e-06	6.60e-04	NA	NA
5. P	Q2JMX7	Elongation factor Tu	6.83e-06	2.23e-03	NA	NA
5. P	Q2II78	Elongation factor Tu	5.37e-06	2.95e-03	NA	NA
5. P	P0CE47	Elongation factor Tu 1	8.27e-06	1.77e-04	NA	NA
5. P	B0SSH9	Elongation factor Tu	8.15e-06	3.73e-05	NA	NA
5. P	Q38WR7	Elongation factor Tu	5.22e-06	6.41e-04	NA	NA
5. P	O31298	Elongation factor Tu	6.26e-06	8.01e-04	NA	NA
5. P	B9MQH1	Elongation factor Tu	6.08e-06	1.63e-04	NA	NA
5. P	P0ABU4	Ribosome-binding ATPase YchF	2.88e-02	2.02e-11	NA	NA
5. P	Q2HJN6	Elongation factor 1-alpha 3	6.02e-05	1.59e-02	NA	NA
5. P	P50068	Elongation factor Tu	4.54e-06	1.10e-04	NA	NA
5. P	A4IW92	Elongation factor Tu	5.58e-06	1.65e-04	NA	NA
5. P	Q9ZK19	Elongation factor Tu	5.85e-06	3.68e-04	NA	NA
5. P	Q66RN5	Elongation factor 1-alpha 1	6.92e-05	1.90e-02	NA	NA
5. P	A0KQ95	Elongation factor Tu	6.47e-06	3.47e-05	NA	NA
5. P	Q5GWR8	Elongation factor Tu	5.86e-06	1.55e-04	NA	NA
5. P	Q1XDK1	Elongation factor Tu, chloroplastic	7.08e-06	1.13e-03	NA	NA
5. P	A3M1F6	Elongation factor Tu	5.62e-06	1.06e-03	NA	NA
5. P	O49169	Elongation factor 1-alpha	7.48e-05	3.06e-03	NA	NA
5. P	Q8KT95	Elongation factor Tu	4.95e-06	2.82e-04	NA	NA
5. P	O50293	Elongation factor Tu	6.30e-06	2.69e-04	NA	NA
5. P	Q2G8Y2	Elongation factor Tu	7.00e-06	7.13e-04	NA	NA
5. P	Q5L5H6	Elongation factor Tu	8.29e-06	5.28e-04	NA	NA
5. P	Q71WB9	Elongation factor Tu	5.36e-06	1.45e-04	NA	NA
5. P	A9ETD1	Elongation factor Tu	1.18e-05	2.18e-04	NA	NA
5. P	P72231	Elongation factor Tu	5.88e-06	9.31e-06	NA	NA
5. P	A1V8A5	Elongation factor Tu	6.57e-06	1.22e-04	NA	NA
5. P	A8F2E9	Elongation factor Tu	4.97e-06	8.65e-04	NA	NA
5. P	C1CLI6	Elongation factor Tu	4.78e-06	1.21e-03	NA	NA
5. P	A6W394	Elongation factor Tu	1.22e-05	3.98e-04	NA	NA
5. P	A7MKI5	Elongation factor Tu	6.13e-06	1.88e-04	NA	NA
5. P	A6WHR4	Elongation factor Tu	6.00e-06	1.06e-04	NA	NA
5. P	B2TZI0	Sulfate adenylyltransferase subunit 1	2.97e-05	2.03e-03	NA	NA
5. P	Q5R797	Eukaryotic translation initiation factor 2 subunit 3	1.21e-03	4.79e-04	NA	NA
5. P	Q15NP2	Elongation factor Tu	5.42e-06	1.23e-04	NA	NA
5. P	P34824	Elongation factor 1-alpha	7.37e-05	1.16e-03	NA	NA
5. P	Q9CZ30	Obg-like ATPase 1	2.10e-02	7.40e-07	NA	NA
5. P	A7NR65	Elongation factor Tu 1	7.73e-06	3.21e-03	NA	NA
5. P	Q981F7	Elongation factor Tu	4.71e-06	1.50e-03	NA	NA
5. P	A7ZSL4	Elongation factor Tu 1	8.23e-06	1.77e-04	NA	NA
5. P	Q2GD83	Elongation factor Tu	1.54e-05	3.17e-02	NA	NA
5. P	Q8X7X7	Sulfate adenylyltransferase subunit 1	2.64e-05	1.62e-03	NA	NA
5. P	Q46WC7	Elongation factor Tu	6.21e-06	1.14e-04	NA	NA
5. P	Q98QG1	Elongation factor Tu	6.48e-06	8.65e-05	NA	NA
5. P	A9NAK7	Elongation factor Tu	5.19e-06	9.20e-05	NA	NA
5. P	A3DBA0	Elongation factor Tu 2	6.04e-06	1.06e-04	NA	NA
5. P	Q6GBT9	Elongation factor Tu	5.82e-06	6.60e-04	NA	NA
5. P	C3LRM1	Sulfate adenylyltransferase subunit 1	2.76e-05	1.02e-02	NA	NA
5. P	Q58728	Uncharacterized GTP-binding protein MJ1332	1.63e-02	4.13e-10	NA	NA
5. P	Q8PUR8	Elongation factor 1-alpha	1.10e-05	4.81e-03	NA	NA
5. P	P50373	Elongation factor Tu, chloroplastic	6.98e-06	2.98e-03	NA	NA
5. P	A0T100	Elongation factor Tu, chloroplastic	6.89e-06	3.82e-03	NA	NA
5. P	P29520	Elongation factor 1-alpha	8.04e-05	3.39e-03	NA	NA
5. P	P64029	Elongation factor Tu	5.61e-06	6.60e-04	NA	NA
5. P	P0CN31	Elongation factor 1-alpha	6.50e-05	2.20e-02	NA	NA
5. P	Q15VB8	Sulfate adenylyltransferase subunit 1	4.81e-05	4.19e-03	NA	NA
5. P	Q73IX6	Elongation factor Tu 1	3.44e-06	2.46e-04	NA	NA
5. P	Q72NF9	Elongation factor Tu	6.51e-06	1.32e-05	NA	NA
5. P	Q79G84	Elongation factor Tu	7.04e-06	1.02e-04	NA	NA
5. P	A5U071	Elongation factor Tu	5.24e-06	3.79e-04	NA	NA
5. P	A6VGV6	Elongation factor 1-alpha	2.92e-05	3.33e-03	NA	NA
5. P	C5CC66	Elongation factor Tu	4.80e-06	1.16e-04	NA	NA
5. P	Q8XFP8	Elongation factor Tu	5.13e-06	4.27e-05	NA	NA
5. P	Q72GW4	Elongation factor Tu	8.26e-06	1.30e-03	NA	NA
5. P	B8HVR7	Elongation factor Tu	8.01e-06	1.14e-02	NA	NA
5. P	Q5P334	Elongation factor Tu	6.28e-06	9.87e-05	NA	NA
5. P	Q1JCT6	Elongation factor Tu	7.78e-06	6.93e-04	NA	NA
5. P	B3QZH5	Elongation factor Tu	3.57e-06	4.27e-05	NA	NA
5. P	Q975N8	Translation initiation factor 2 subunit gamma	4.87e-04	2.08e-04	NA	NA
5. P	A5IM81	Elongation factor Tu	6.34e-06	2.36e-03	NA	NA
5. P	B8DUH4	Nucleotide-binding protein BLA_1368	2.45e-02	2.74e-02	NA	NA
5. P	P19457	Elongation factor Tu, chloroplastic	6.73e-06	1.94e-04	NA	NA
5. P	A0QS98	Elongation factor Tu	5.39e-06	3.37e-04	NA	NA
5. P	Q6FF97	Elongation factor Tu	6.05e-06	5.03e-04	NA	NA
5. P	B9E8Q0	Elongation factor Tu	5.32e-06	7.20e-04	NA	NA
5. P	B7GU46	Elongation factor Tu	6.44e-06	2.66e-04	NA	NA
5. P	Q5SHN6	Elongation factor Tu-A	7.91e-06	8.16e-04	NA	NA
5. P	C5BQ44	Elongation factor Tu	1.36e-05	1.75e-04	NA	NA
5. P	B8ZSC1	Elongation factor Tu	5.11e-06	7.34e-04	NA	NA
5. P	P64028	Elongation factor Tu	5.77e-06	6.60e-04	NA	NA
5. P	B7LWK4	Sulfate adenylyltransferase subunit 1	2.63e-05	1.41e-03	NA	NA
5. P	Q3K1U4	Elongation factor Tu	4.63e-06	5.44e-04	NA	NA
5. P	Q24208	Eukaryotic translation initiation factor 2 subunit 3	1.63e-03	7.71e-03	NA	NA
5. P	Q8KTA1	Elongation factor Tu	5.90e-06	4.84e-04	NA	NA
5. P	Q661E5	Elongation factor Tu	4.11e-06	4.90e-03	NA	NA
5. P	P42478	Elongation factor Tu (Fragment)	3.14e-06	5.36e-03	NA	NA
5. P	Q1C2U1	Elongation factor Tu 1	5.69e-06	3.57e-04	NA	NA
5. P	P41752	Elongation factor 1-alpha	6.86e-05	6.92e-03	NA	NA
5. P	Q839G8	Elongation factor Tu	6.17e-06	2.54e-03	NA	NA
5. P	Q089Q6	Elongation factor Tu 2	6.02e-06	1.52e-04	NA	NA
5. P	Q0P3M7	Elongation factor Tu, chloroplastic	7.02e-06	4.47e-03	NA	NA
5. P	B1IUS8	Sulfate adenylyltransferase subunit 1	2.62e-05	1.90e-03	NA	NA
5. P	P33168	Elongation factor Tu	7.55e-06	4.18e-04	NA	NA
5. P	Q28UW7	Elongation factor Tu	5.49e-06	1.04e-03	NA	NA
5. P	A6VGE8	Translation initiation factor 2 subunit gamma	6.11e-04	2.04e-05	NA	NA
5. P	Q0SFF4	Elongation factor Tu	4.73e-06	3.15e-04	NA	NA
5. P	Q9Z9A7	Elongation factor Tu	7.82e-06	1.78e-03	NA	NA
5. P	A0RUM4	Elongation factor 1-alpha	6.59e-05	4.35e-04	NA	NA
5. P	B5Z8K3	Elongation factor Tu	5.99e-06	5.99e-04	NA	NA
5. P	A5GIP0	Elongation factor Tu	4.78e-06	6.73e-04	NA	NA
5. P	Q2YM08	Elongation factor Tu	4.58e-06	3.15e-03	NA	NA
5. P	Q02WY9	Elongation factor Tu	5.44e-06	2.08e-05	NA	NA
5. P	A0RQJ3	Elongation factor Tu	6.68e-06	1.82e-04	NA	NA
5. P	Q3APH1	Elongation factor Tu	7.54e-06	6.17e-04	NA	NA
5. P	Q6LM69	Sulfate adenylyltransferase subunit 1	2.58e-05	4.39e-03	NA	NA
5. P	Q83JX8	Sulfate adenylyltransferase subunit 1	2.85e-05	5.66e-03	NA	NA
5. P	Q12WT3	Elongation factor 1-alpha	1.18e-05	2.74e-03	NA	NA
5. P	Q14JU2	Elongation factor Tu	5.75e-06	1.35e-04	NA	NA
5. P	Q6LXY6	Translation initiation factor 2 subunit gamma	5.61e-04	1.06e-05	NA	NA
5. P	Q5NID9	Elongation factor Tu	6.06e-06	1.35e-04	NA	NA
5. P	B7MZ52	Sulfate adenylyltransferase subunit 1	2.55e-05	1.90e-03	NA	NA
5. P	A1A1N5	Nucleotide-binding protein BAD_0837	3.75e-02	3.11e-02	NA	NA
5. P	B6ELP3	Sulfate adenylyltransferase subunit 1	2.73e-05	5.66e-03	NA	NA
5. P	B1YGU8	Elongation factor Tu	5.71e-06	7.13e-05	NA	NA
5. P	Q0BKB8	Elongation factor Tu	5.63e-06	1.65e-04	NA	NA
5. P	P40174	Elongation factor Tu-1	4.77e-06	4.54e-05	NA	NA
5. P	A0PM42	Elongation factor Tu	4.91e-06	9.16e-04	NA	NA
5. P	Q1J7N4	Elongation factor Tu	4.83e-06	7.41e-04	NA	NA
5. P	Q00582	GTP-binding protein GTR1	5.94e-05	4.68e-05	NA	NA
5. P	A5FZW7	Elongation factor Tu	3.98e-06	3.90e-04	NA	NA
5. P	P33167	Elongation factor Tu	6.56e-06	1.45e-04	NA	NA
5. P	A5CCA0	Elongation factor Tu 1	5.29e-06	9.48e-05	NA	NA
5. P	A7H4R3	Elongation factor Tu	6.30e-06	2.99e-04	NA	NA
5. P	Q3JMP6	Elongation factor Tu	6.66e-06	1.22e-04	NA	NA
5. P	A9WFP3	Elongation factor Tu	7.08e-06	9.89e-04	NA	NA
5. P	P17786	Elongation factor 1-alpha	6.80e-05	1.35e-03	NA	NA
5. P	A6TZ25	Elongation factor Tu	5.91e-06	6.60e-04	NA	NA
5. P	B8ZL95	Elongation factor Tu	4.90e-06	1.21e-03	NA	NA
5. P	A4W5A0	Elongation factor Tu	6.26e-06	2.14e-04	NA	NA
5. P	C4LAG3	Sulfate adenylyltransferase subunit 1	1.71e-05	1.04e-03	NA	NA
5. P	Q53871	Elongation factor Tu-1	4.68e-06	1.79e-04	NA	NA
5. P	A9NEN4	Elongation factor Tu	5.01e-06	9.78e-05	NA	NA
5. P	Q01SX2	Elongation factor Tu	6.65e-06	6.23e-04	NA	NA
5. P	Q2L2G6	Elongation factor Tu	6.46e-06	1.51e-04	NA	NA
5. P	Q03YI2	Elongation factor Tu	5.87e-06	4.36e-05	NA	NA
5. P	A5WH42	Elongation factor Tu 2	5.73e-06	2.66e-04	NA	NA
5. P	Q8W4H7	Elongation factor 1-alpha 2	5.42e-05	1.20e-03	NA	NA
5. P	P33166	Elongation factor Tu	6.01e-06	9.25e-04	NA	NA
5. P	Q5M101	Elongation factor Tu	5.50e-06	1.50e-03	NA	NA
5. P	Q8TVE5	Translation initiation factor 2 subunit gamma	7.63e-04	4.83e-06	NA	NA
5. P	A8A5E6	Elongation factor Tu 1	8.36e-06	1.77e-04	NA	NA
5. P	B1IPW0	Elongation factor Tu 1	8.17e-06	1.77e-04	NA	NA
5. P	C4KZP9	Elongation factor Tu	5.09e-06	1.36e-05	NA	NA
5. P	P17245	Elongation factor Tu, cyanelle	9.21e-06	1.71e-03	NA	NA
5. P	A9KWA0	Elongation factor Tu 2	6.09e-06	1.06e-04	NA	NA
5. P	P75022	Elongation factor Tu	4.33e-06	1.94e-03	NA	NA
5. P	A3MV69	Elongation factor 1-alpha	3.59e-05	2.09e-03	NA	NA
5. P	A5U9R1	Elongation factor Tu	6.44e-06	3.44e-04	NA	NA
5. P	Q3A9P8	Elongation factor Tu 2	6.46e-06	2.06e-04	NA	NA
5. P	P28295	Elongation factor 1-alpha	6.46e-05	5.93e-03	NA	NA
5. P	Q8G5B7	Elongation factor Tu	6.24e-06	2.69e-04	NA	NA
5. P	Q3J8Q0	Elongation factor Tu	4.68e-06	9.70e-04	NA	NA
5. P	A1USL2	Elongation factor Tu 2	4.53e-06	1.59e-03	NA	NA
5. P	Q9KP20	Sulfate adenylyltransferase subunit 1	1.98e-05	1.02e-02	NA	NA
5. P	B4TTW5	Sulfate adenylyltransferase subunit 1	2.80e-05	2.09e-03	NA	NA
5. P	Q6KI66	Elongation factor Tu	6.45e-06	6.71e-05	NA	NA
5. P	B0RU96	Elongation factor Tu 2	6.11e-06	2.43e-04	NA	NA
5. P	C1CF71	Elongation factor Tu	4.90e-06	1.21e-03	NA	NA
5. P	A9MF24	Sulfate adenylyltransferase subunit 1	2.75e-05	2.84e-03	NA	NA
5. P	P48865	Elongation factor Tu	5.00e-06	8.73e-04	NA	NA
5. P	A4XZ92	Elongation factor Tu	6.20e-06	3.68e-04	NA	NA
5. P	Q09130	Eukaryotic translation initiation factor 2 subunit gamma	9.56e-05	2.12e-04	NA	NA
5. P	B4U3U1	Elongation factor Tu	4.89e-06	5.18e-04	NA	NA
5. P	B7UHH0	Sulfate adenylyltransferase subunit 1	2.52e-05	2.27e-03	NA	NA
5. P	Q0VSL7	Elongation factor Tu	5.47e-06	2.34e-04	NA	NA
5. P	A1T4L6	Elongation factor Tu	5.24e-06	7.43e-05	NA	NA
5. P	A6QEK0	Elongation factor Tu	6.01e-06	6.60e-04	NA	NA
5. P	Q1GDV0	Elongation factor Tu	5.11e-06	1.57e-04	NA	NA
5. P	Q6F0J5	Elongation factor Tu	4.49e-06	6.71e-05	NA	NA
5. P	Q1LI13	Elongation factor Tu	6.66e-06	9.20e-05	NA	NA
5. P	Q92GW4	Elongation factor Tu	5.11e-06	1.38e-03	NA	NA
5. P	C1AL18	Elongation factor Tu	5.20e-06	3.79e-04	NA	NA
5. P	B5FTS9	Sulfate adenylyltransferase subunit 1	3.01e-05	2.34e-03	NA	NA
5. P	Q04FQ4	Elongation factor Tu	5.22e-06	5.18e-04	NA	NA
5. P	A7MJ69	Sulfate adenylyltransferase subunit 1	3.00e-05	1.26e-02	NA	NA
5. P	Q8FEJ1	Sulfate adenylyltransferase subunit 1	2.56e-05	2.07e-03	NA	NA
5. P	Q30X13	Elongation factor Tu	7.08e-06	5.88e-04	NA	NA
5. P	Q0SZX8	Elongation factor Tu 1	7.05e-06	1.59e-04	NA	NA
5. P	Q134S7	Elongation factor Tu 1	5.08e-06	1.65e-04	NA	NA
5. P	Q01765	Elongation factor 1-alpha	9.10e-05	1.55e-02	NA	NA
5. P	Q6B8Y0	Elongation factor Tu, chloroplastic	7.22e-06	2.07e-03	NA	NA
5. P	P86934	Elongation factor 1-alpha 1	6.47e-05	4.19e-03	NA	NA
5. P	B2J5B1	Elongation factor Tu	8.01e-06	8.59e-03	NA	NA
5. P	A0QL35	Elongation factor Tu	5.07e-06	7.85e-04	NA	NA
5. P	A4T1R2	Elongation factor Tu	4.86e-06	2.69e-04	NA	NA
5. P	A2BT83	Elongation factor Tu	5.18e-06	5.82e-04	NA	NA
5. P	A1B002	Elongation factor Tu	5.90e-06	9.52e-04	NA	NA
5. P	Q7VJ74	Elongation factor Tu	6.16e-06	1.99e-03	NA	NA
5. P	Q5X873	Elongation factor Tu	6.14e-06	7.63e-04	NA	NA
5. P	A9W4X1	Sulfate adenylyltransferase subunit 1	2.69e-05	2.52e-03	NA	NA
5. P	P19486	Elongation factor 1-alpha	1.64e-05	2.15e-03	NA	NA
5. P	Q8ZAN8	Elongation factor Tu-B	5.72e-06	1.22e-03	NA	NA
5. P	P64025	Elongation factor Tu	4.55e-06	3.15e-03	NA	NA
5. P	Q47LJ1	Elongation factor Tu	7.19e-06	2.62e-05	NA	NA
5. P	Q978W8	Translation initiation factor 2 subunit gamma	6.79e-04	3.09e-06	NA	NA
5. P	Q1LSY4	Elongation factor Tu	5.18e-06	9.11e-05	NA	NA
5. P	Q0AIJ7	Elongation factor Tu 1	5.45e-06	2.79e-04	NA	NA
5. P	A8Z5T8	Elongation factor Tu	5.27e-06	2.69e-03	NA	NA
5. P	P42942	Uncharacterized GTP-binding protein YGR210C	1.87e-02	1.32e-08	NA	NA
5. P	Q7MH43	Elongation factor Tu 1	4.72e-06	3.24e-04	NA	NA
5. P	P42477	Elongation factor Tu	6.24e-06	1.14e-02	NA	NA
5. P	P29544	Elongation factor Tu-3	4.31e-06	2.18e-02	NA	NA
5. P	A1TYJ5	Elongation factor Tu	5.95e-06	2.95e-03	NA	NA
5. P	A1AGM6	Elongation factor Tu 1	7.40e-06	1.77e-04	NA	NA
5. P	B7LXG3	Sulfate adenylyltransferase subunit 1	2.58e-05	3.06e-03	NA	NA
5. P	Q1Q8P2	Elongation factor Tu	5.91e-06	2.43e-04	NA	NA
5. P	Q9TKZ5	Elongation factor Tu, chloroplastic	7.23e-06	1.50e-03	NA	NA
5. P	P35149	Stage IV sporulation protein A	3.27e-04	2.57e-05	NA	NA
5. P	P64024	Elongation factor Tu	4.57e-06	3.15e-03	NA	NA
5. P	A4TS36	Elongation factor Tu 2	5.88e-06	1.22e-03	NA	NA
5. P	Q1QUF9	Sulfate adenylyltransferase subunit 1	3.09e-05	1.21e-02	NA	NA
5. P	B5F415	Sulfate adenylyltransferase subunit 1	2.80e-05	2.09e-03	NA	NA
5. P	Q8XGZ0	Elongation factor Tu	6.53e-06	8.57e-05	NA	NA
5. P	A6X0A2	Elongation factor Tu	4.78e-06	1.38e-03	NA	NA
5. P	B9K884	Elongation factor Tu	6.89e-06	2.36e-03	NA	NA
5. P	Q8R7V2	Elongation factor Tu-A	5.40e-06	4.84e-04	NA	NA
5. P	Q74MI6	Elongation factor 1-alpha	1.31e-05	7.30e-03	NA	NA
5. P	B1KMH4	Sulfate adenylyltransferase subunit 1	2.82e-05	2.91e-02	NA	NA
5. P	Q9HNK9	Translation initiation factor 2 subunit gamma	7.19e-04	9.31e-06	NA	NA
5. P	Q5WZL4	Elongation factor Tu	6.31e-06	8.32e-04	NA	NA
5. P	Q9LQK0	Developmentally-regulated G-protein 1	3.99e-03	3.82e-03	NA	NA
5. P	P38746	Obg-like ATPase homolog	2.39e-02	2.27e-07	NA	NA
5. P	Q8U082	Translation initiation factor 2 subunit gamma	1.21e-05	1.22e-04	NA	NA
5. P	Q89AR6	Ribosome-binding ATPase YchF	1.12e-02	4.81e-10	NA	NA
5. P	Q63PZ6	Elongation factor Tu	6.60e-06	1.22e-04	NA	NA
5. P	A3P0B5	Elongation factor Tu	6.80e-06	1.22e-04	NA	NA
5. P	Q8KTA3	Elongation factor Tu	3.91e-06	4.66e-04	NA	NA
5. P	Q81VT2	Elongation factor Tu	4.89e-06	1.37e-03	NA	NA
5. P	Q2SU25	Elongation factor Tu	6.60e-06	1.22e-04	NA	NA
5. P	Q31VV0	Elongation factor Tu	8.30e-06	1.77e-04	NA	NA
5. P	B7VKY2	Sulfate adenylyltransferase subunit 1	2.34e-05	2.82e-03	NA	NA
5. P	Q9KV37	Elongation factor Tu-A	5.42e-06	5.75e-05	NA	NA
5. P	P29543	Elongation factor Tu-2	6.05e-06	1.79e-04	NA	NA
5. P	A8M531	Elongation factor Tu	5.88e-06	3.47e-05	NA	NA
5. P	A5CW32	Elongation factor Tu	7.51e-06	5.39e-04	NA	NA
5. P	Q79GC6	Elongation factor Tu	6.44e-06	1.02e-04	NA	NA
5. P	Q0BYB2	Elongation factor Tu 2	5.31e-06	4.23e-03	NA	NA
5. P	C4ZB99	Elongation factor Tu	5.00e-06	2.23e-04	NA	NA
5. P	Q4A597	Elongation factor Tu	5.37e-06	5.81e-05	NA	NA
5. P	Q814C4	Elongation factor Tu	4.86e-06	1.37e-03	NA	NA
5. P	Q0A6G2	Nucleotide-binding protein Mlg_2233	1.88e-02	3.22e-02	NA	NA
5. P	B8J1A0	Elongation factor Tu	6.55e-06	1.88e-04	NA	NA
5. P	Q2SSW8	Elongation factor Tu	4.64e-06	3.72e-04	NA	NA
5. P	P64026	Elongation factor Tu	6.22e-06	1.25e-04	NA	NA
5. P	A8LLG2	Elongation factor Tu	6.34e-06	5.23e-04	NA	NA
5. P	O29325	Elongation factor 1-alpha	1.46e-05	1.10e-04	NA	NA
5. P	Q9V1G0	Translation initiation factor 2 subunit gamma	1.39e-05	9.87e-05	NA	NA
5. P	B4S5M9	Elongation factor Tu	8.55e-06	4.10e-04	NA	NA
6. F	Q8F9P7	Probable GTP-binding protein EngB	2.20e-07	NA	NA	0.7315
6. F	Q0VL48	Probable GTP-binding protein EngB	2.46e-11	NA	NA	0.7398
6. F	Q6F1A9	Probable GTP-binding protein EngB	1.73e-10	NA	NA	0.7291
6. F	C6BUE5	Probable GTP-binding protein EngB	3.88e-11	NA	NA	0.791
6. F	Q1GJX8	Probable GTP-binding protein EngB	2.36e-12	NA	NA	0.7221
6. F	Q8KAK5	Probable GTP-binding protein EngB	5.17e-14	NA	NA	0.8043
6. F	C4K8N5	Probable GTP-binding protein EngB	4.83e-11	NA	NA	0.7464
6. F	Q04XC3	Probable GTP-binding protein EngB	8.25e-08	NA	NA	0.6784
6. F	Q04W49	Probable GTP-binding protein EngB	1.56e-07	NA	NA	0.6981
6. F	Q1H4T4	Probable GTP-binding protein EngB	1.74e-11	NA	NA	0.7215
6. F	P47577	Probable GTP-binding protein EngB	2.90e-12	NA	NA	0.7181
6. F	B8GTD2	Probable GTP-binding protein EngB	1.67e-11	NA	NA	0.6994
6. F	Q2LVW9	Probable GTP-binding protein EngB	4.59e-11	NA	NA	0.7181
6. F	Q5GVY6	Probable GTP-binding protein EngB	4.61e-10	NA	NA	0.6771
6. F	A1K9D3	Probable GTP-binding protein EngB	2.66e-11	NA	NA	0.6932
6. F	Q21B49	Probable GTP-binding protein EngB	6.14e-12	NA	NA	0.7624
6. F	B9JZK9	Probable GTP-binding protein EngB	2.58e-10	NA	NA	0.7153
6. F	B2SNS8	Probable GTP-binding protein EngB	4.97e-10	NA	NA	0.6774
6. F	Q0TQK6	Probable GTP-binding protein EngB	2.37e-11	NA	NA	0.7204
6. F	B4S596	Probable GTP-binding protein EngB	2.48e-13	NA	NA	0.7731
6. F	Q14II7	Probable GTP-binding protein EngB	1.99e-12	NA	NA	0.7503
6. F	Q8E8J7	Probable GTP-binding protein EngB	1.96e-07	NA	NA	0.7592
6. F	C1D5Q6	Probable GTP-binding protein EngB	5.83e-08	NA	NA	0.7335
6. F	C4L4J3	Probable GTP-binding protein EngB	7.06e-12	NA	NA	0.7021
6. F	Q8PPG1	Probable GTP-binding protein EngB	9.43e-11	NA	NA	0.661
6. F	Q3BXK1	Probable GTP-binding protein EngB	4.40e-10	NA	NA	0.6816
6. F	Q98QW3	Elongation factor 4	1.34e-03	NA	NA	0.6728
6. F	Q72W11	Probable GTP-binding protein EngB	9.94e-11	NA	NA	0.7262
6. F	Q2KD28	Probable GTP-binding protein EngB	4.85e-10	NA	NA	0.6894
6. F	B6JJN9	Probable GTP-binding protein EngB	4.83e-12	NA	NA	0.7639
6. F	A6WUH1	Probable GTP-binding protein EngB	1.51e-07	NA	NA	0.7288
6. F	Q98D85	Probable GTP-binding protein EngB	2.26e-10	NA	NA	0.7466
6. F	Q65GJ7	Probable GTP-binding protein EngB	3.38e-13	NA	NA	0.7683
6. F	Q2NZ59	Probable GTP-binding protein EngB	4.61e-10	NA	NA	0.678
6. F	Q89BP9	Probable GTP-binding protein EngB	3.73e-10	NA	NA	0.7428
6. F	P38424	Probable GTP-binding protein EngB	3.86e-13	NA	NA	0.7317
6. F	B2FTY5	Probable GTP-binding protein EngB	4.45e-11	NA	NA	0.6983
6. F	A1AVN1	Probable GTP-binding protein EngB	3.18e-10	NA	NA	0.6884
6. F	Q71ZB0	Probable GTP-binding protein EngB	1.23e-13	NA	NA	0.7471
6. F	Q3IYY4	Probable GTP-binding protein EngB	2.95e-10	NA	NA	0.6942
6. F	A5CXJ4	Probable GTP-binding protein EngB	4.98e-10	NA	NA	0.7307
6. F	B0XZZ2	Translation factor guf1, mitochondrial	1.97e-03	NA	NA	0.4878
6. F	Q0ASI7	Probable GTP-binding protein EngB	5.26e-11	NA	NA	0.7325
6. F	Q7W2C4	Probable GTP-binding protein EngB	1.74e-12	NA	NA	0.7223
6. F	Q8P5E4	Probable GTP-binding protein EngB	4.12e-10	NA	NA	0.6857
6. F	B8CVL3	Probable GTP-binding protein EngB	5.71e-09	NA	NA	0.7454
6. F	D2VRR7	Translation factor GUF1 homolog, mitochondrial	1.29e-03	NA	NA	0.5266
6. F	P75303	Probable GTP-binding protein EngB	1.62e-12	NA	NA	0.6998
6. F	B3L3C9	Translation factor GUF1 homolog, mitochondrial	1.45e-02	NA	NA	0.6749
6. F	A3CYM5	Probable GTP-binding protein EngB	1.77e-07	NA	NA	0.7198
6. F	Q8UIB4	Probable GTP-binding protein EngB	8.45e-11	NA	NA	0.724
6. F	A9NFM5	Probable GTP-binding protein EngB	2.02e-10	NA	NA	0.6558
6. F	A5K6I6	Translation factor GUF1 homolog, mitochondrial	2.58e-02	NA	NA	0.5328
6. F	Q4UYM8	Probable GTP-binding protein EngB	4.88e-10	NA	NA	0.6806
6. F	Q07TY1	Probable GTP-binding protein EngB	2.82e-12	NA	NA	0.7818
6. F	Q5LW13	Probable GTP-binding protein EngB	2.13e-12	NA	NA	0.7284
6. F	Q7NPV7	Probable GTP-binding protein EngB	6.36e-11	NA	NA	0.7303
6. F	B0SJA9	Probable GTP-binding protein EngB	4.71e-10	NA	NA	0.6281
6. F	Q7VTA1	Probable GTP-binding protein EngB	2.56e-12	NA	NA	0.7353
6. F	B8DHJ0	Probable GTP-binding protein EngB	9.20e-14	NA	NA	0.7581
6. F	Q4WYV0	Translation factor guf1, mitochondrial	1.97e-03	NA	NA	0.4889
6. F	A8GYP3	Probable GTP-binding protein EngB	7.96e-08	NA	NA	0.7399
6. F	Q28UR1	Probable GTP-binding protein EngB	4.12e-12	NA	NA	0.7158
6. F	Q87DM6	Probable GTP-binding protein EngB	5.77e-11	NA	NA	0.7106
6. F	Q0AWF4	Probable GTP-binding protein EngB	2.24e-10	NA	NA	0.6771
6. F	Q2SN75	Probable GTP-binding protein EngB	1.56e-10	NA	NA	0.7422
6. F	Q3SMA6	Probable GTP-binding protein EngB	8.59e-11	NA	NA	0.7009
6. F	Q9PDE9	Probable GTP-binding protein EngB	5.38e-11	NA	NA	0.7144
6. F	Q7WR92	Probable GTP-binding protein EngB	2.45e-12	NA	NA	0.7175
6. F	Q8D338	Probable GTP-binding protein EngB	3.58e-10	NA	NA	0.6657
7. B	A6Q4R8	GTPase Der	7.58e-07	NA	2.11e-10	NA
7. B	A7H4G2	Probable GTP-binding protein EngB	7.63e-12	NA	0.010	NA
7. B	Q8DDI1	tRNA modification GTPase MnmE	1.14e-04	NA	3.67e-06	NA
7. B	Q98RC1	GTPase Der	9.74e-07	NA	1.06e-11	NA
7. B	Q7VFY6	GTPase Der	4.10e-06	NA	1.88e-08	NA
7. B	A8GQ55	GTPase Obg	4.41e-06	NA	0.002	NA
7. B	Q5M5A9	Probable GTP-binding protein EngB	4.77e-13	NA	4.84e-04	NA
7. B	Q8CX13	tRNA modification GTPase MnmE	3.59e-04	NA	2.85e-07	NA
7. B	Q11CN2	tRNA modification GTPase MnmE	3.12e-04	NA	1.25e-07	NA
7. B	Q5EBA0	GTPase Era, mitochondrial	0.00e+00	NA	8.56e-09	NA
7. B	A8Z5X0	tRNA modification GTPase MnmE	2.65e-04	NA	4.18e-07	NA
7. B	Q9PIZ1	Translation initiation factor IF-2	2.06e-02	NA	0.016	NA
7. B	Q5WSF0	tRNA modification GTPase MnmE	2.61e-04	NA	1.55e-05	NA
7. B	B3CR58	GTPase Der	1.26e-06	NA	6.43e-05	NA
7. B	Q07VS7	tRNA modification GTPase MnmE	2.45e-04	NA	3.31e-05	NA
7. B	Q73HQ3	GTPase Obg	3.14e-04	NA	0.024	NA
7. B	P43730	tRNA modification GTPase MnmE	3.67e-04	NA	9.33e-06	NA
7. B	Q72SI0	Fe(2+) transporter FeoB	4.06e-03	NA	0.023	NA
7. B	A7ZBS1	GTPase Der	2.96e-07	NA	7.86e-08	NA
7. B	P0C8P1	tRNA modification GTPase MnmE	1.39e-04	NA	4.46e-04	NA
7. B	B0UJI9	tRNA modification GTPase MnmE	1.09e-03	NA	8.68e-06	NA
7. B	A5I816	tRNA modification GTPase MnmE	5.33e-04	NA	3.19e-07	NA
7. B	Q8D3I9	tRNA modification GTPase MnmE	1.77e-04	NA	0.003	NA
7. B	B1L9N6	tRNA modification GTPase MnmE	1.93e-04	NA	7.72e-10	NA
7. B	C0R5N5	GTPase Obg	1.53e-05	NA	0.027	NA
7. B	Q5M4H3	tRNA modification GTPase MnmE	4.38e-04	NA	4.40e-08	NA
7. B	Q2SR47	tRNA modification GTPase MnmE	5.20e-04	NA	1.92e-07	NA
7. B	A1AXX6	tRNA modification GTPase MnmE	2.71e-03	NA	2.10e-05	NA
7. B	Q8P161	tRNA modification GTPase MnmE	3.80e-04	NA	1.09e-07	NA
7. B	O81283	Translocase of chloroplast 159, chloroplastic	1.10e-01	NA	0.016	NA
7. B	Q48U21	Probable GTP-binding protein EngB	3.91e-13	NA	0.001	NA
7. B	A5CFM7	tRNA modification GTPase MnmE	7.25e-04	NA	4.40e-04	NA
7. B	A1UQU6	tRNA modification GTPase MnmE	7.42e-05	NA	3.17e-04	NA
7. B	A9WHH9	GTPase Der	7.07e-07	NA	4.39e-15	NA
7. B	Q2GC37	tRNA modification GTPase MnmE	1.15e-03	NA	1.66e-05	NA
7. B	Q8DYL0	GTPase Obg	7.43e-03	NA	0.033	NA
7. B	C5D8U8	Ribosome biogenesis GTPase A	1.01e-02	NA	0.001	NA
7. B	Q9PQM5	Probable GTP-binding protein EngB	4.84e-08	NA	6.36e-04	NA
7. B	A7NCL5	tRNA modification GTPase MnmE	1.93e-03	NA	1.59e-04	NA
7. B	Q8XH30	tRNA modification GTPase MnmE	5.26e-04	NA	1.14e-05	NA
7. B	Q8P340	tRNA modification GTPase MnmE	1.19e-04	NA	5.28e-05	NA
7. B	A8EZV9	tRNA modification GTPase MnmE	6.81e-04	NA	2.04e-05	NA
7. B	Q601N0	tRNA modification GTPase MnmE	7.44e-04	NA	3.74e-05	NA
7. B	A9IZY1	tRNA modification GTPase MnmE	2.45e-04	NA	0.001	NA
7. B	A3QJT0	tRNA modification GTPase MnmE	2.68e-04	NA	2.02e-05	NA
7. B	Q8FBV3	tRNA modification GTPase MnmE	2.26e-04	NA	1.13e-06	NA
7. B	B1IX32	tRNA modification GTPase MnmE	1.91e-04	NA	1.09e-06	NA
7. B	A4SGR9	tRNA modification GTPase MnmE	1.63e-04	NA	3.45e-07	NA
7. B	B5Z7J9	GTPase Der	2.51e-07	NA	8.58e-08	NA
7. B	B0S3Z4	GTPase Obg	2.04e-03	NA	8.60e-05	NA
7. B	Q1XDN0	Translation initiation factor IF-2, chloroplastic	5.36e-03	NA	0.016	NA
7. B	B4SYB2	tRNA modification GTPase MnmE	3.22e-04	NA	1.28e-06	NA
7. B	B3PS53	tRNA modification GTPase MnmE	8.11e-04	NA	1.03e-04	NA
7. B	A1BCU6	tRNA modification GTPase MnmE	1.30e-04	NA	8.52e-07	NA
7. B	Q3YT72	tRNA modification GTPase MnmE	6.05e-03	NA	6.34e-10	NA
7. B	B1YGA8	tRNA modification GTPase MnmE	1.95e-04	NA	1.16e-09	NA
7. B	Q4A5B4	Probable GTP-binding protein EngB	2.33e-12	NA	0.046	NA
7. B	Q2GK25	GTPase Obg	3.03e-03	NA	0.001	NA
7. B	A4XN51	tRNA modification GTPase MnmE	1.44e-04	NA	5.09e-13	NA
7. B	Q1G7Z4	tRNA modification GTPase MnmE	2.41e-03	NA	3.38e-09	NA
7. B	Q72D51	tRNA modification GTPase MnmE	4.07e-04	NA	0.009	NA
7. B	Q3SF39	tRNA modification GTPase MnmE	2.05e-04	NA	4.97e-08	NA
7. B	Q7MVZ2	tRNA modification GTPase MnmE	1.33e-04	NA	8.20e-08	NA
7. B	A3N2D8	tRNA modification GTPase MnmE	2.12e-04	NA	8.36e-07	NA
7. B	Q8E465	GTPase Obg	4.50e-03	NA	0.033	NA
7. B	B1ZWP5	tRNA modification GTPase MnmE	2.38e-04	NA	5.80e-08	NA
7. B	Q28VZ6	tRNA modification GTPase MnmE	6.58e-04	NA	8.62e-06	NA
7. B	A6U2E1	Probable GTP-binding protein EngB	2.87e-13	NA	3.85e-05	NA
7. B	Q38WT4	GTPase Obg	1.45e-03	NA	0.004	NA
7. B	Q2FG63	Probable GTP-binding protein EngB	2.98e-13	NA	3.85e-05	NA
7. B	B1JRQ1	tRNA modification GTPase MnmE	3.58e-04	NA	3.67e-06	NA
7. B	B3Q9V3	GTPase Der	1.35e-06	NA	9.79e-09	NA
7. B	Q4L2Z2	tRNA modification GTPase MnmE	2.64e-04	NA	1.02e-08	NA
7. B	Q1LTV8	tRNA modification GTPase MnmE	2.26e-04	NA	2.61e-05	NA
7. B	Q04Q90	GTPase Obg	1.19e-03	NA	0.025	NA
7. B	Q8PEH9	tRNA modification GTPase MnmE	2.27e-04	NA	5.25e-05	NA
7. B	C0QXH9	tRNA modification GTPase MnmE	1.11e-04	NA	0.015	NA
7. B	A0RLR2	tRNA modification GTPase MnmE	3.63e-05	NA	2.14e-08	NA
7. B	B0CJG2	tRNA modification GTPase MnmE	3.65e-04	NA	0.002	NA
7. B	A4Y199	tRNA modification GTPase MnmE	7.44e-04	NA	2.24e-07	NA
7. B	B1LL33	tRNA modification GTPase MnmE	2.57e-04	NA	1.13e-06	NA
7. B	Q7VSR5	tRNA modification GTPase MnmE	4.09e-04	NA	3.96e-04	NA
7. B	Q2YTB6	Probable GTP-binding protein EngB	2.58e-13	NA	3.85e-05	NA
7. B	Q8Z9U2	tRNA modification GTPase MnmE	2.96e-04	NA	4.17e-06	NA
7. B	B1AJ22	GTPase Der	2.24e-07	NA	7.26e-09	NA
7. B	A5ITJ8	Probable GTP-binding protein EngB	7.17e-13	NA	3.85e-05	NA
7. B	Q21CM0	tRNA modification GTPase MnmE	4.90e-03	NA	2.59e-05	NA
7. B	B1IHR9	tRNA modification GTPase MnmE	5.54e-04	NA	3.19e-07	NA
7. B	B3QVU6	GTPase Obg	5.76e-04	NA	0.004	NA
7. B	Q5LR04	GTPase Der	1.86e-06	NA	1.30e-07	NA
7. B	Q9HT07	tRNA modification GTPase MnmE	6.87e-04	NA	2.97e-07	NA
7. B	Q30ZZ9	Probable GTP-binding protein EngB	7.98e-12	NA	1.02e-04	NA
7. B	Q6MFA3	tRNA modification GTPase MnmE	3.30e-04	NA	4.46e-06	NA
7. B	P47254	tRNA modification GTPase MnmE	7.17e-03	NA	6.10e-06	NA
7. B	Q2JSU8	tRNA modification GTPase MnmE	1.66e-04	NA	3.58e-07	NA
7. B	B6JM65	GTPase Der	1.84e-07	NA	1.06e-07	NA
7. B	P0A175	tRNA modification GTPase MnmE	5.36e-04	NA	4.19e-07	NA
7. B	Q02VP7	tRNA modification GTPase MnmE	3.98e-03	NA	1.54e-06	NA
7. B	Q1GXL7	tRNA modification GTPase MnmE	6.12e-05	NA	2.49e-06	NA
7. B	Q5FHQ5	tRNA modification GTPase MnmE	3.15e-04	NA	6.51e-07	NA
7. B	P97043	tRNA modification GTPase MnmE	8.36e-04	NA	5.29e-05	NA
7. B	B1AI04	tRNA modification GTPase MnmE	1.19e-03	NA	1.58e-10	NA
7. B	A5FMX0	GTPase Obg	1.02e-06	NA	5.89e-05	NA
7. B	Q1J154	tRNA modification GTPase MnmE	7.19e-04	NA	2.04e-07	NA
7. B	Q8DGG4	GTPase Obg	7.87e-06	NA	0.008	NA
7. B	Q8CMN5	tRNA modification GTPase MnmE	3.10e-05	NA	3.14e-10	NA
7. B	P73839	tRNA modification GTPase MnmE	1.51e-03	NA	3.07e-10	NA
7. B	Q0I0Z2	tRNA modification GTPase MnmE	4.08e-04	NA	4.35e-06	NA
7. B	A5G169	tRNA modification GTPase MnmE	4.65e-04	NA	1.35e-06	NA
7. B	Q92G19	GTPase Obg	3.93e-06	NA	0.006	NA
7. B	Q7U344	tRNA modification GTPase MnmE	3.53e-04	NA	2.21e-05	NA
7. B	Q2JIE6	tRNA modification GTPase MnmE	1.57e-04	NA	4.30e-08	NA
7. B	Q1J740	Probable GTP-binding protein EngB	5.22e-13	NA	0.001	NA
7. B	A5GD29	GTPase Obg	1.60e-05	NA	0.007	NA
7. B	Q1QS99	tRNA modification GTPase MnmE	1.67e-04	NA	2.72e-04	NA
7. B	A7FW89	GTPase Der	5.17e-07	NA	2.22e-11	NA
7. B	P64071	Probable GTP-binding protein EngB	2.92e-13	NA	3.85e-05	NA
7. B	B5BIL9	tRNA modification GTPase MnmE	2.82e-04	NA	1.62e-06	NA
7. B	B9L7G9	GTPase Der	4.77e-07	NA	1.92e-11	NA
7. B	B0BR82	tRNA modification GTPase MnmE	1.61e-04	NA	7.92e-07	NA
7. B	B7NF24	tRNA modification GTPase MnmE	3.38e-04	NA	1.04e-06	NA
7. B	A1RQE8	tRNA modification GTPase MnmE	2.08e-04	NA	3.03e-05	NA
7. B	Q603B5	GTPase Der	4.20e-07	NA	1.17e-09	NA
7. B	Q9SHS8	GTPase LSG1-1	1.55e-01	NA	0.005	NA
7. B	Q6LW56	tRNA modification GTPase MnmE	2.77e-04	NA	4.69e-06	NA
7. B	Q88RX5	tRNA modification GTPase MnmE	3.57e-04	NA	3.81e-08	NA
7. B	Q3MCS7	GTPase Obg	1.28e-03	NA	0.003	NA
7. B	A4GAN2	tRNA modification GTPase MnmE	1.82e-04	NA	0.004	NA
7. B	P25522	tRNA modification GTPase MnmE	3.52e-04	NA	1.09e-06	NA
7. B	Q7URR0	Translation initiation factor IF-2	3.98e-02	NA	0.009	NA
7. B	Q5HX70	GTPase Obg	9.09e-06	NA	0.033	NA
7. B	Q07UP2	tRNA modification GTPase MnmE	1.77e-03	NA	4.45e-07	NA
7. B	B6JD21	GTPase Obg	3.38e-04	NA	0.024	NA
7. B	Q0ATU5	tRNA modification GTPase MnmE	1.89e-04	NA	5.44e-08	NA
7. B	Q5GTT5	tRNA modification GTPase MnmE	1.69e-04	NA	3.82e-05	NA
7. B	Q4FPR8	tRNA modification GTPase MnmE	4.14e-04	NA	2.47e-04	NA
7. B	A8FL71	Probable GTP-binding protein EngB	1.92e-11	NA	0.046	NA
7. B	Q3IYH3	tRNA modification GTPase MnmE	6.42e-04	NA	1.09e-05	NA
7. B	Q16CZ5	tRNA modification GTPase MnmE	1.70e-03	NA	3.61e-09	NA
7. B	Q2S3C0	GTPase Obg	2.60e-04	NA	0.011	NA
7. B	B2UX10	Probable GTP-binding protein EngB	1.52e-10	NA	0.018	NA
7. B	B2RIY7	GTPase Obg	1.93e-03	NA	4.69e-06	NA
7. B	A5N451	tRNA modification GTPase MnmE	7.15e-04	NA	3.47e-06	NA
7. B	A4WVZ0	tRNA modification GTPase MnmE	1.23e-03	NA	1.10e-05	NA
7. B	Q8CX54	tRNA modification GTPase MnmE	7.84e-04	NA	5.05e-10	NA
7. B	B3EFY1	GTPase Der	4.81e-07	NA	1.59e-08	NA
7. B	B2IJQ3	tRNA modification GTPase MnmE	6.56e-04	NA	6.37e-07	NA
7. B	B7N211	tRNA modification GTPase MnmE	1.69e-04	NA	1.13e-06	NA
7. B	Q3K0K1	Probable GTP-binding protein EngB	2.77e-13	NA	0.005	NA
7. B	Q03F28	Probable GTP-binding protein EngB	9.03e-13	NA	3.69e-04	NA
7. B	Q058F5	tRNA modification GTPase MnmE	5.88e-04	NA	1.87e-05	NA
7. B	Q814F6	tRNA modification GTPase MnmE	2.18e-04	NA	2.51e-08	NA
7. B	P75309	GTPase Der	3.73e-07	NA	1.22e-15	NA
7. B	Q6MEP0	Probable GTP-binding protein EngB	3.45e-11	NA	5.04e-05	NA
7. B	Q8R6K8	tRNA modification GTPase MnmE	5.06e-04	NA	1.19e-07	NA
7. B	B5YXB0	tRNA modification GTPase MnmE	2.09e-04	NA	1.10e-06	NA
7. B	Q2RFI8	tRNA modification GTPase MnmE	2.47e-04	NA	2.07e-08	NA
7. B	B2SUV8	tRNA modification GTPase MnmE	1.87e-04	NA	6.32e-05	NA
7. B	Q54WT4	Developmentally-regulated GTP-binding protein 2 homolog	2.30e-04	NA	0.012	NA
7. B	Q1JLA1	GTPase Obg	6.49e-03	NA	0.002	NA
7. B	Q9ZCI1	tRNA modification GTPase MnmE	4.46e-03	NA	4.47e-06	NA
7. B	Q9PIB6	GTPase Der	3.57e-07	NA	5.63e-07	NA
7. B	C0MA50	Probable GTP-binding protein EngB	9.06e-13	NA	5.21e-04	NA
7. B	C1KWN7	GTPase Der	2.32e-07	NA	2.82e-11	NA
7. B	Q4UK70	tRNA modification GTPase MnmE	8.95e-04	NA	1.43e-06	NA
7. B	Q04ZS1	GTPase Der	9.40e-07	NA	2.26e-06	NA
7. B	A8YTQ7	tRNA modification GTPase MnmE	3.25e-04	NA	6.70e-09	NA
7. B	A1RHQ7	GTPase Der	6.22e-07	NA	3.73e-13	NA
7. B	B8J030	Probable GTP-binding protein EngB	3.82e-12	NA	7.49e-04	NA
7. B	Q1JC92	Probable GTP-binding protein EngB	6.58e-13	NA	8.01e-04	NA
7. B	A8EV95	tRNA modification GTPase MnmE	2.93e-04	NA	6.80e-07	NA
7. B	K7UTH7	GTPase ERA1, chloroplastic	0.00e+00	NA	5.13e-53	NA
7. B	A6M3M5	tRNA modification GTPase MnmE	3.77e-04	NA	8.86e-07	NA
7. B	A6TXE5	tRNA modification GTPase MnmE	3.03e-04	NA	4.68e-06	NA
7. B	Q9X1H7	Probable GTP-binding protein EngB	5.72e-12	NA	2.01e-12	NA
7. B	Q8KH12	GTPase Der	4.03e-07	NA	4.30e-11	NA
7. B	Q9K8F7	Probable GTP-binding protein EngB	3.70e-13	NA	3.03e-04	NA
7. B	Q5LZW3	tRNA modification GTPase MnmE	3.49e-04	NA	4.52e-08	NA
7. B	A5IIK3	tRNA modification GTPase MnmE	2.10e-04	NA	8.47e-06	NA
7. B	B9KRT2	GTPase Der	1.63e-06	NA	1.67e-07	NA
7. B	A1U7J3	tRNA modification GTPase MnmE	3.53e-04	NA	4.69e-06	NA
7. B	Q820T0	tRNA modification GTPase MnmE	4.34e-04	NA	4.17e-10	NA
7. B	B4RRB9	tRNA modification GTPase MnmE	1.11e-04	NA	1.25e-07	NA
7. B	B0TAB6	tRNA modification GTPase MnmE	3.42e-04	NA	3.79e-06	NA
7. B	A0LCZ3	GTPase Obg	6.04e-04	NA	7.96e-04	NA
7. B	A8GPN6	tRNA modification GTPase MnmE	9.04e-04	NA	2.08e-05	NA
7. B	Q3ANQ3	tRNA modification GTPase MnmE	8.70e-05	NA	8.19e-08	NA
7. B	Q8RHA2	tRNA modification GTPase MnmE	2.43e-04	NA	6.20e-06	NA
7. B	Q83PL3	tRNA modification GTPase MnmE	2.32e-04	NA	1.08e-06	NA
7. B	Q9RVL1	tRNA modification GTPase MnmE	1.17e-03	NA	1.31e-06	NA
7. B	Q6GD92	tRNA modification GTPase MnmE	1.63e-04	NA	4.90e-09	NA
7. B	A1AHP0	tRNA modification GTPase MnmE	1.96e-04	NA	1.13e-06	NA
7. B	Q31LL9	Translation initiation factor IF-2	3.25e-02	NA	0.027	NA
7. B	Q1MA18	tRNA modification GTPase MnmE	7.78e-04	NA	9.63e-05	NA
7. B	Q02DE1	tRNA modification GTPase MnmE	6.16e-04	NA	2.84e-07	NA
7. B	Q72WU3	tRNA modification GTPase MnmE	3.16e-05	NA	2.93e-08	NA
7. B	Q5FUL2	GTPase Obg	1.67e-06	NA	0.044	NA
7. B	Q8Y5W8	GTPase Der	3.09e-07	NA	2.82e-11	NA
7. B	Q30T75	tRNA modification GTPase MnmE	6.84e-04	NA	2.91e-07	NA
7. B	A5UD71	tRNA modification GTPase MnmE	2.05e-04	NA	4.27e-06	NA
7. B	B8GW34	tRNA modification GTPase MnmE	8.99e-04	NA	2.06e-04	NA
7. B	Q5FF19	tRNA modification GTPase MnmE	4.65e-03	NA	9.62e-08	NA
7. B	A8FM10	tRNA modification GTPase MnmE	2.22e-04	NA	8.55e-09	NA
7. B	Q1J6U1	tRNA modification GTPase MnmE	3.60e-04	NA	3.64e-07	NA
7. B	Q8Y3H5	tRNA modification GTPase MnmE	8.82e-05	NA	1.42e-04	NA
7. B	B0S6U7	GTPase Era, mitochondrial	0.00e+00	NA	1.37e-19	NA
7. B	Q5FS11	tRNA modification GTPase MnmE	6.96e-04	NA	4.85e-07	NA
7. B	Q5FKR5	Probable GTP-binding protein EngB	9.61e-14	NA	0.017	NA
7. B	B0JVV0	tRNA modification GTPase MnmE	2.74e-04	NA	1.14e-09	NA
7. B	B0K5N4	tRNA modification GTPase MnmE	3.26e-04	NA	2.79e-09	NA
7. B	A4YCM1	tRNA modification GTPase MnmE	2.57e-04	NA	3.05e-05	NA
7. B	A8FJG0	tRNA modification GTPase MnmE	3.74e-04	NA	1.76e-10	NA
7. B	A1WSU0	tRNA modification GTPase MnmE	7.26e-05	NA	1.56e-06	NA
7. B	A9M9E5	tRNA modification GTPase MnmE	3.99e-04	NA	0.002	NA
7. B	Q8P0I6	GTPase Obg	4.45e-03	NA	0.002	NA
7. B	B9LZU0	Probable GTP-binding protein EngB	4.43e-11	NA	0.003	NA
7. B	Q65CN1	tRNA modification GTPase MnmE	3.43e-04	NA	5.85e-10	NA
7. B	B9KFN5	GTPase Der	4.53e-07	NA	3.34e-07	NA
7. B	A5VT20	tRNA modification GTPase MnmE	3.75e-04	NA	0.002	NA
7. B	Q6AK07	GTPase Obg	8.63e-04	NA	4.75e-04	NA
7. B	Q9A088	Probable GTP-binding protein EngB	4.15e-12	NA	7.86e-04	NA
7. B	A2RGB0	GTPase Der	4.83e-07	NA	4.43e-11	NA
7. B	Q5LYR4	GTPase Obg	6.09e-03	NA	0.014	NA
7. B	A2SD36	GTPase Obg	1.54e-04	NA	0.044	NA
7. B	Q1D7Z0	Probable GTP-binding protein EngB	5.87e-12	NA	9.17e-05	NA
7. B	Q253F8	GTPase Obg	2.24e-06	NA	0.004	NA
7. B	B7JVH9	GTPase Obg	1.85e-06	NA	0.007	NA
7. B	Q2STM2	tRNA modification GTPase MnmE	5.21e-05	NA	7.94e-06	NA
7. B	Q7M901	tRNA modification GTPase MnmE	4.68e-04	NA	1.19e-09	NA
7. B	Q68VZ0	tRNA modification GTPase MnmE	2.68e-03	NA	1.32e-07	NA
7. B	Q4FNR7	tRNA modification GTPase MnmE	3.67e-04	NA	6.15e-08	NA
7. B	A0M2N6	tRNA modification GTPase MnmE	8.86e-05	NA	1.42e-07	NA
7. B	Q181S7	tRNA modification GTPase MnmE	2.35e-04	NA	8.88e-08	NA
7. B	A8G2J5	tRNA modification GTPase MnmE	1.18e-04	NA	2.50e-07	NA
7. B	A6LMN4	tRNA modification GTPase MnmE	1.55e-04	NA	4.43e-12	NA
7. B	P75678	Uncharacterized protein YkfA	7.56e-08	NA	4.97e-04	NA
7. B	Q931E1	tRNA modification GTPase MnmE	1.76e-04	NA	4.34e-08	NA
7. B	Q5GSS9	Probable GTP-binding protein EngB	2.20e-12	NA	0.015	NA
7. B	Q5HF99	Probable GTP-binding protein EngB	2.55e-13	NA	3.85e-05	NA
7. B	Q5RA07	Guanine nucleotide-binding protein-like 1	7.43e-02	NA	0.002	NA
7. B	Q8DKI1	GTPase Der	1.24e-07	NA	1.66e-09	NA
7. B	B9DSH7	GTPase Obg	5.26e-03	NA	0.013	NA
7. B	Q9KVY5	tRNA modification GTPase MnmE	2.80e-04	NA	2.36e-06	NA
7. B	B5XZP4	tRNA modification GTPase MnmE	3.21e-04	NA	1.34e-06	NA
7. B	Q4QLQ9	tRNA modification GTPase MnmE	4.01e-04	NA	4.89e-06	NA
7. B	Q746Q3	tRNA modification GTPase MnmE	1.67e-04	NA	3.80e-07	NA
7. B	Q0SMZ9	GTPase Der	9.86e-06	NA	1.20e-08	NA
7. B	A8A6G8	tRNA modification GTPase MnmE	3.15e-04	NA	1.10e-06	NA
7. B	Q4A7S3	Probable GTP-binding protein EngB	4.95e-13	NA	0.001	NA
7. B	A1KW66	tRNA modification GTPase MnmE	1.10e-04	NA	1.13e-06	NA
7. B	B1KQ64	tRNA modification GTPase MnmE	2.27e-04	NA	1.18e-05	NA
7. B	Q7M7W8	GTPase Der	4.31e-07	NA	2.17e-09	NA
7. B	A9BK05	GTPase Obg	3.20e-04	NA	1.29e-04	NA
7. B	Q49YA5	Probable GTP-binding protein EngB	6.62e-13	NA	1.68e-04	NA
7. B	Q5NFF3	tRNA modification GTPase MnmE	7.33e-03	NA	1.57e-04	NA
7. B	A7GN41	GTPase Der	1.84e-07	NA	2.15e-10	NA
7. B	B1X9T5	tRNA modification GTPase MnmE	2.34e-04	NA	1.09e-06	NA
7. B	Q661B2	GTPase Der	4.55e-06	NA	3.36e-08	NA
7. B	A4STS4	tRNA modification GTPase MnmE	1.07e-04	NA	1.85e-05	NA
7. B	Q49UI4	tRNA modification GTPase MnmE	2.43e-04	NA	1.56e-08	NA
7. B	B2S3Y1	GTPase Obg	4.63e-03	NA	2.06e-04	NA
7. B	A8Z631	GTPase Obg	1.12e-04	NA	2.09e-05	NA
7. B	A1V9V1	GTPase Der	1.46e-06	NA	2.44e-07	NA
7. B	Q2NX54	tRNA modification GTPase MnmE	1.70e-04	NA	3.86e-05	NA
7. B	A2RF16	Probable GTP-binding protein EngB	4.61e-13	NA	0.001	NA
7. B	Q5QZJ5	tRNA modification GTPase MnmE	2.36e-04	NA	3.04e-07	NA
7. B	Q3AQ22	GTPase Der	4.53e-07	NA	5.00e-09	NA
7. B	B2TPB6	Probable GTP-binding protein EngB	8.36e-11	NA	0.020	NA
7. B	Q58859	Uncharacterized GTP-binding protein MJ1464	1.78e-02	NA	0.004	NA
7. B	Q04H41	Probable GTP-binding protein EngB	3.94e-11	NA	0.028	NA
7. B	B8I8N7	Probable GTP-binding protein EngB	1.43e-11	NA	0.020	NA
7. B	Q5KWK2	Probable GTP-binding protein EngB	6.42e-13	NA	0.003	NA
7. B	A8FKH3	GTPase Der	4.97e-07	NA	8.15e-07	NA
7. B	Q0BW92	tRNA modification GTPase MnmE	4.27e-04	NA	3.04e-06	NA
7. B	B0BVJ1	GTPase Obg	4.28e-06	NA	0.003	NA
7. B	A6U595	tRNA modification GTPase MnmE	2.63e-04	NA	4.90e-09	NA
7. B	Q21DG1	tRNA modification GTPase MnmE	1.37e-04	NA	1.14e-05	NA
7. B	A8GUF3	tRNA modification GTPase MnmE	7.35e-04	NA	1.97e-05	NA
7. B	A8LPC2	tRNA modification GTPase MnmE	1.21e-03	NA	1.21e-06	NA
7. B	A6QKK2	tRNA modification GTPase MnmE	1.83e-04	NA	4.01e-09	NA
7. B	B0BV57	tRNA modification GTPase MnmE	5.53e-04	NA	6.55e-07	NA
7. B	Q3K046	GTPase Obg	6.26e-03	NA	0.033	NA
7. B	Q8EPM2	Probable GTP-binding protein EngB	8.02e-13	NA	0.025	NA
7. B	B3EMI7	GTPase Der	7.67e-07	NA	4.94e-09	NA
7. B	B6I3T9	tRNA modification GTPase MnmE	3.05e-04	NA	1.09e-06	NA
7. B	B9KZ43	GTPase Der	6.20e-07	NA	5.52e-09	NA
7. B	A7H4Z1	GTPase Der	4.32e-07	NA	1.68e-06	NA
7. B	Q12HM9	tRNA modification GTPase MnmE	1.87e-04	NA	1.50e-05	NA
7. B	Q1JHC1	Probable GTP-binding protein EngB	5.89e-13	NA	8.01e-04	NA
7. B	B0K8N3	GTPase Der	5.11e-07	NA	3.54e-12	NA
7. B	A5WBB6	tRNA modification GTPase MnmE	5.40e-04	NA	4.19e-07	NA
7. B	Q1IHC2	tRNA modification GTPase MnmE	3.05e-04	NA	1.38e-05	NA
7. B	Q6KH82	tRNA modification GTPase MnmE	5.22e-04	NA	2.13e-06	NA
7. B	B4RD04	tRNA modification GTPase MnmE	1.43e-03	NA	4.70e-08	NA
7. B	Q0PC41	GTPase Obg	8.52e-04	NA	0.031	NA
7. B	A6LD68	GTPase Obg	1.46e-02	NA	2.65e-07	NA
7. B	Q05FY9	tRNA modification GTPase MnmE	6.76e-04	NA	0.003	NA
7. B	Q4UJV1	GTPase Obg	3.45e-06	NA	1.10e-04	NA
7. B	Q11Z03	GTPase Obg	6.22e-04	NA	0.003	NA
7. B	B2USZ4	GTPase Der	1.82e-07	NA	3.59e-07	NA
7. B	Q9PHL7	Probable GTP-binding protein EngB	5.48e-10	NA	0.008	NA
7. B	A6W3V0	tRNA modification GTPase MnmE	7.49e-04	NA	7.06e-06	NA
7. B	A1AT81	GTPase Obg	3.40e-05	NA	0.022	NA
7. B	Q2KTI2	tRNA modification GTPase MnmE	5.02e-04	NA	3.84e-05	NA
7. B	Q46HI4	tRNA modification GTPase MnmE	5.89e-05	NA	6.32e-06	NA
7. B	Q7MAX1	tRNA modification GTPase MnmE	2.80e-04	NA	1.21e-06	NA
7. B	Q11TG8	tRNA modification GTPase MnmE	4.61e-04	NA	8.62e-05	NA
7. B	C0R5M1	Probable GTP-binding protein EngB	3.17e-12	NA	0.003	NA
7. B	A1WWE4	tRNA modification GTPase MnmE	9.42e-05	NA	1.08e-04	NA
7. B	B3ETH9	tRNA modification GTPase MnmE	3.02e-04	NA	1.25e-06	NA
7. B	Q03W10	Probable GTP-binding protein EngB	3.05e-13	NA	0.005	NA
7. B	Q99Z94	GTPase Obg	3.75e-03	NA	0.001	NA
7. B	Q5PQQ1	tRNA modification GTPase GTPBP3, mitochondrial	8.82e-04	NA	0.018	NA
7. B	Q82S94	Probable GTP-binding protein EngB	3.47e-09	NA	0.036	NA
7. B	Q2SSN1	Probable GTP-binding protein EngB	5.80e-13	NA	0.002	NA
7. B	Q6G5W4	tRNA modification GTPase MnmE	1.94e-04	NA	4.68e-09	NA
7. B	Q44633	tRNA modification GTPase MnmE	1.20e-04	NA	3.49e-04	NA
7. B	P96128	GTPase Der	2.46e-07	NA	1.38e-08	NA
7. B	B7MGC8	tRNA modification GTPase MnmE	3.50e-04	NA	1.13e-06	NA
7. B	Q8KPU2	tRNA modification GTPase MnmE	1.16e-04	NA	4.11e-07	NA
7. B	A7FPC2	tRNA modification GTPase MnmE	3.24e-04	NA	1.92e-05	NA
7. B	Q663S6	tRNA modification GTPase MnmE	3.06e-04	NA	3.98e-06	NA
7. B	Q57AJ6	tRNA modification GTPase MnmE	3.45e-04	NA	0.002	NA
7. B	A8I264	tRNA modification GTPase MnmE	6.77e-03	NA	1.32e-05	NA
7. B	Q9JWB7	tRNA modification GTPase MnmE	1.64e-04	NA	2.79e-07	NA
7. B	Q9SJF1	GTPase LSG1-2	2.83e-01	NA	0.005	NA
7. B	A0KR31	tRNA modification GTPase MnmE	2.04e-04	NA	6.41e-06	NA
7. B	A9MX84	tRNA modification GTPase MnmE	2.38e-04	NA	1.28e-06	NA
7. B	Q040F3	tRNA modification GTPase MnmE	2.24e-03	NA	2.38e-06	NA
7. B	Q11RJ8	Probable GTP-binding protein EngB	6.66e-12	NA	0.009	NA
7. B	P64065	GTPase Der	4.64e-07	NA	1.30e-11	NA
7. B	Q58330	Uncharacterized protein MJ0920	4.91e-10	NA	0.008	NA
7. B	B3E2D1	Probable GTP-binding protein EngB	9.45e-12	NA	0.017	NA
7. B	A1VZ10	Probable GTP-binding protein EngB	4.18e-12	NA	0.009	NA
7. B	Q9UTE7	tRNA modification GTPase mss1, mitochondrial	1.63e-04	NA	0.004	NA
7. B	P75215	GTPase Obg	1.34e-02	NA	0.010	NA
7. B	Q17WL7	GTPase Der	2.25e-07	NA	1.38e-06	NA
7. B	P47571	GTPase Der	2.46e-07	NA	7.34e-13	NA
7. B	Q30YQ7	tRNA modification GTPase MnmE	7.71e-05	NA	2.26e-06	NA
7. B	Q5GTG3	GTPase Obg	3.21e-05	NA	0.005	NA
7. B	D5DJL5	Ribosome biogenesis GTPase A	2.61e-02	NA	0.009	NA
7. B	Q73AZ1	GTPase Der	1.74e-07	NA	3.66e-10	NA
7. B	Q0HPE7	tRNA modification GTPase MnmE	1.81e-04	NA	6.13e-06	NA
7. B	C0Q2L4	tRNA modification GTPase MnmE	1.70e-04	NA	1.28e-06	NA
7. B	Q74H94	tRNA modification GTPase MnmE	2.35e-03	NA	1.11e-05	NA
7. B	B2UPK5	tRNA modification GTPase MnmE	5.05e-04	NA	3.75e-04	NA
7. B	P0DA92	Probable GTP-binding protein EngB	5.11e-13	NA	0.002	NA
7. B	A1JT87	tRNA modification GTPase MnmE	3.22e-04	NA	2.43e-06	NA
7. B	Q31CZ2	tRNA modification GTPase MnmE	8.60e-05	NA	1.60e-07	NA
7. B	Q13SH7	tRNA modification GTPase MnmE	4.67e-05	NA	8.20e-05	NA
7. B	Q2WBH0	tRNA modification GTPase MnmE	6.51e-04	NA	8.36e-05	NA
7. B	Q725L9	GTPase Der	6.67e-07	NA	2.50e-07	NA
7. B	Q31CE7	GTPase Der	1.87e-07	NA	3.33e-09	NA
7. B	P64070	Probable GTP-binding protein EngB	3.57e-13	NA	3.85e-05	NA
7. B	A3CNB0	tRNA modification GTPase MnmE	3.76e-03	NA	7.97e-07	NA
7. B	Q72VY6	tRNA modification GTPase MnmE	3.84e-04	NA	5.59e-05	NA
7. B	Q9UTE0	Protein sey1	2.03e-02	NA	0.019	NA
7. B	B4SED0	GTPase Der	4.54e-07	NA	4.69e-08	NA
7. B	Q9L6G1	Probable GTP-binding protein EngB	4.85e-13	NA	3.25e-05	NA
7. B	B8GAY7	GTPase Der	5.77e-07	NA	1.49e-13	NA
7. B	Q3IK56	tRNA modification GTPase MnmE	2.68e-04	NA	1.53e-05	NA
7. B	Q8DZ11	Probable GTP-binding protein EngB	2.98e-13	NA	0.005	NA
7. B	B5Y805	GTPase Obg	3.24e-04	NA	0.006	NA
7. B	C6C0G0	GTPase Der	1.54e-07	NA	1.02e-08	NA
7. B	Q92KW1	tRNA modification GTPase MnmE	9.04e-04	NA	0.002	NA
7. B	Q3MBM5	tRNA modification GTPase MnmE	1.98e-04	NA	2.81e-06	NA
7. B	Q2IXA7	GTPase Der	2.03e-06	NA	6.93e-09	NA
7. B	B0S3V2	tRNA modification GTPase MnmE	3.28e-04	NA	1.95e-05	NA
7. B	A3DHY8	tRNA modification GTPase MnmE	5.93e-05	NA	7.11e-07	NA
7. B	A1VYA6	GTPase Der	4.53e-07	NA	8.00e-07	NA
7. B	Q3AG56	tRNA modification GTPase MnmE	2.68e-04	NA	3.30e-06	NA
7. B	A0E2L1	Protein SEY1 homolog 2	1.01e-02	NA	0.005	NA
7. B	Q5XCL9	Probable GTP-binding protein EngB	4.69e-13	NA	0.001	NA
7. B	O78489	Translation initiation factor IF-2, chloroplastic	2.55e-03	NA	0.002	NA
7. B	Q2LSF6	tRNA modification GTPase MnmE	7.85e-05	NA	6.08e-07	NA
7. B	A4ITX1	tRNA modification GTPase MnmE	2.65e-04	NA	1.10e-09	NA
7. B	Q1MPF1	tRNA modification GTPase MnmE	6.12e-05	NA	1.38e-05	NA
7. B	A5GW82	tRNA modification GTPase MnmE	2.06e-04	NA	2.04e-07	NA
7. B	Q4K396	tRNA modification GTPase MnmE	4.73e-04	NA	7.55e-09	NA
7. B	Q24VA2	GTPase Der	2.44e-07	NA	7.02e-11	NA
7. B	Q3A4Q5	GTPase Der	2.90e-07	NA	5.55e-09	NA
7. B	A7N0X8	tRNA modification GTPase MnmE	1.65e-04	NA	4.68e-06	NA
7. B	P32559	tRNA modification GTPase MSS1, mitochondrial	1.35e-04	NA	3.55e-07	NA
7. B	Q87TS2	tRNA modification GTPase MnmE	6.85e-04	NA	5.21e-07	NA
7. B	Q9CGE5	Probable GTP-binding protein EngB	3.55e-13	NA	1.10e-05	NA
7. B	Q5N638	tRNA modification GTPase MnmE	1.09e-04	NA	3.02e-06	NA
7. B	A5IXJ1	tRNA modification GTPase MnmE	9.88e-04	NA	1.75e-06	NA
7. B	Q72PQ1	GTPase Der	1.21e-06	NA	8.50e-07	NA
7. B	Q1LH94	tRNA modification GTPase MnmE	1.06e-04	NA	7.72e-05	NA
7. B	Q4A9N9	Probable GTP-binding protein EngB	9.86e-13	NA	0.002	NA
7. B	C4ZD63	GTPase Der	4.70e-07	NA	3.13e-10	NA
7. B	A5CDT2	GTPase Der	4.50e-07	NA	2.77e-05	NA
7. B	B0S9A3	GTPase Obg	8.38e-06	NA	0.039	NA
7. B	A2RE30	GTPase Obg	5.75e-03	NA	0.003	NA
7. B	Q2NQ72	tRNA modification GTPase MnmE	4.07e-04	NA	5.10e-05	NA
7. B	B0TQH0	tRNA modification GTPase MnmE	1.77e-04	NA	5.07e-06	NA
7. B	A4VWD1	tRNA modification GTPase MnmE	5.10e-04	NA	8.78e-08	NA
7. B	Q03KR8	tRNA modification GTPase MnmE	3.51e-04	NA	4.52e-08	NA
7. B	A7GVP7	tRNA modification GTPase MnmE	2.94e-04	NA	1.20e-07	NA
7. B	Q1JM76	Probable GTP-binding protein EngB	4.89e-13	NA	8.01e-04	NA
7. B	Q8KAF0	GTPase Obg	1.63e-03	NA	4.75e-04	NA
7. B	Q0SPQ3	tRNA modification GTPase MnmE	4.71e-04	NA	5.17e-05	NA
7. B	Q5NKZ8	tRNA modification GTPase MnmE	6.98e-04	NA	5.20e-08	NA
7. B	Q73IC3	Probable GTP-binding protein EngB	3.08e-12	NA	0.003	NA
7. B	Q2QZ37	Probable GTP-binding protein OBGM, mitochondrial	1.33e-04	NA	0.012	NA
7. B	A7X395	Probable GTP-binding protein EngB	2.57e-13	NA	3.85e-05	NA
7. B	Q879S5	tRNA modification GTPase MnmE	3.10e-04	NA	4.88e-06	NA
7. B	Q57986	Fe(2+) transporter FeoB	5.95e-03	NA	0.009	NA
7. B	A9IK66	GTPase Der	1.62e-07	NA	3.48e-07	NA
7. B	Q039G4	GTPase Der	3.98e-07	NA	1.71e-11	NA
7. B	Q3K429	tRNA modification GTPase MnmE	4.88e-04	NA	9.80e-07	NA
7. B	Q5WAG3	tRNA modification GTPase MnmE	2.33e-04	NA	1.94e-11	NA
7. B	A5FP49	GTPase Obg	5.48e-03	NA	0.001	NA
7. B	A0RQK2	GTPase Der	3.45e-07	NA	2.46e-08	NA
7. B	Q0HD65	tRNA modification GTPase MnmE	1.77e-04	NA	5.80e-06	NA
7. B	Q5RDW1	Mitochondrial ribosome-associated GTPase 2	2.06e-05	NA	0.005	NA
7. B	A5IWD7	tRNA modification GTPase MnmE	2.97e-04	NA	4.90e-09	NA
7. B	A9B567	GTPase Der	8.27e-07	NA	1.50e-09	NA
7. B	A4WUI6	GTPase Der	1.46e-06	NA	1.60e-07	NA
7. B	Q8XB41	tRNA modification GTPase MnmE	2.25e-04	NA	1.10e-06	NA
7. B	Q58803	Uncharacterized protein MJ1408	8.85e-05	NA	0.003	NA
7. B	Q9Z768	tRNA modification GTPase MnmE	5.12e-04	NA	6.23e-05	NA
7. B	Q64X55	tRNA modification GTPase MnmE	3.93e-05	NA	1.05e-04	NA
7. B	Q04KR8	tRNA modification GTPase MnmE	3.74e-03	NA	1.12e-07	NA
7. B	Q7NAR6	Probable GTP-binding protein EngB	3.43e-12	NA	0.007	NA
7. B	A4WGH1	tRNA modification GTPase MnmE	2.48e-04	NA	1.41e-06	NA
7. B	Q2N6I9	tRNA modification GTPase MnmE	1.93e-03	NA	1.22e-04	NA
7. B	P0DA93	Probable GTP-binding protein EngB	5.06e-13	NA	0.002	NA
7. B	B8FLF0	Probable GTP-binding protein EngB	6.23e-11	NA	0.006	NA
7. B	B2TUS2	tRNA modification GTPase MnmE	2.47e-04	NA	1.09e-06	NA
7. B	P36916	Guanine nucleotide-binding protein-like 1	1.27e-01	NA	0.001	NA
7. B	Q0I6N5	tRNA modification GTPase MnmE	1.50e-04	NA	1.08e-06	NA
7. B	O82653	GTP-binding protein ERG	0.00e+00	NA	1.70e-21	NA
7. B	A6VQS6	tRNA modification GTPase MnmE	1.58e-04	NA	2.49e-06	NA
7. B	C4Z0C8	GTPase Der	4.16e-07	NA	1.41e-08	NA
7. B	Q5P9B1	tRNA modification GTPase MnmE	7.16e-04	NA	6.30e-10	NA
7. B	A3PJF0	GTPase Der	1.53e-06	NA	1.67e-07	NA
7. B	A0Q7G4	tRNA modification GTPase MnmE	1.27e-02	NA	1.59e-04	NA
7. B	B3ES13	Probable GTP-binding protein EngB	9.84e-11	NA	0.004	NA
7. B	Q8F332	Fe(2+) transporter FeoB	4.42e-03	NA	0.023	NA
7. B	A1VUS4	tRNA modification GTPase MnmE	6.02e-05	NA	2.48e-06	NA
7. B	A7MN03	tRNA modification GTPase MnmE	2.56e-04	NA	1.18e-06	NA
7. B	A4J9S1	tRNA modification GTPase MnmE	3.03e-04	NA	1.40e-08	NA
7. B	Q1JBB7	GTPase Obg	6.09e-03	NA	0.002	NA
7. B	Q1Q7V4	tRNA modification GTPase MnmE	2.55e-04	NA	2.61e-04	NA
7. B	A4J7I9	GTPase Obg	1.79e-03	NA	2.29e-04	NA
7. B	A2REM7	tRNA modification GTPase MnmE	3.59e-03	NA	1.09e-07	NA
7. B	A5CY46	tRNA modification GTPase MnmE	1.37e-03	NA	1.28e-10	NA
7. B	B2A470	tRNA modification GTPase MnmE	2.00e-04	NA	2.12e-09	NA
7. B	B7KHD2	GTPase Der	1.78e-07	NA	1.84e-16	NA
7. B	A8F2P7	tRNA modification GTPase MnmE	7.01e-04	NA	9.31e-07	NA
7. B	Q89Z26	tRNA modification GTPase MnmE	6.17e-05	NA	8.82e-04	NA
7. B	P36915	Guanine nucleotide-binding protein-like 1	7.48e-02	NA	0.002	NA
7. B	Q97ID7	GTPase Der	3.86e-07	NA	4.40e-08	NA
7. B	Q5TM59	Guanine nucleotide-binding protein-like 1	7.37e-02	NA	0.002	NA
7. B	Q58722	Uncharacterized GTP-binding protein MJ1326	2.38e-04	NA	0.008	NA
7. B	Q6ND14	tRNA modification GTPase MnmE	2.76e-03	NA	8.12e-06	NA
7. B	Q2FYG0	GTPase Der	3.79e-07	NA	1.65e-10	NA
7. B	Q7VE01	tRNA modification GTPase MnmE	9.94e-05	NA	3.38e-05	NA
7. B	Q9CNS4	GTPase Obg	1.07e-02	NA	0.008	NA
7. B	A5UID5	tRNA modification GTPase MnmE	4.49e-04	NA	4.27e-06	NA
7. B	A2BUJ6	GTPase Obg	3.08e-06	NA	0.025	NA
7. B	B7GGD6	Ribosome biogenesis GTPase A	1.47e-02	NA	0.003	NA
7. B	B5RFY2	tRNA modification GTPase MnmE	3.21e-04	NA	1.39e-06	NA
7. B	O51830	tRNA modification GTPase MnmE	8.22e-05	NA	7.69e-04	NA
7. B	Q97R24	tRNA modification GTPase MnmE	3.19e-03	NA	2.31e-07	NA
7. B	Q07LA7	GTPase Der	1.68e-06	NA	2.41e-08	NA
7. B	Q4ZL12	tRNA modification GTPase MnmE	6.38e-04	NA	5.45e-07	NA
7. B	A2SMI8	tRNA modification GTPase MnmE	1.06e-04	NA	3.80e-04	NA
7. B	Q1CVG4	tRNA modification GTPase MnmE	1.83e-04	NA	3.77e-05	NA
7. B	Q64XA5	GTPase Obg	3.73e-04	NA	7.51e-07	NA
7. B	Q2GI42	tRNA modification GTPase MnmE	5.77e-03	NA	1.13e-10	NA
7. B	Q7U3V6	tRNA modification GTPase MnmE	8.54e-05	NA	1.14e-08	NA
7. B	C4K7P4	tRNA modification GTPase MnmE	2.86e-04	NA	2.08e-07	NA
7. B	Q5L4W4	GTPase Der	8.21e-07	NA	5.63e-09	NA
7. B	A5IZG5	GTPase Der	3.10e-07	NA	6.63e-10	NA
7. B	B2IYX1	GTPase Obg	2.95e-05	NA	9.80e-06	NA
7. B	Q5E8Z9	tRNA modification GTPase MnmE	3.44e-04	NA	7.22e-06	NA
7. B	A6T4D6	tRNA modification GTPase MnmE	2.00e-04	NA	0.001	NA
7. B	B5XL04	Probable GTP-binding protein EngB	4.04e-13	NA	8.01e-04	NA
7. B	Q8EWH6	GTPase Der	4.17e-06	NA	9.91e-07	NA
7. B	A4YJT5	tRNA modification GTPase MnmE	3.45e-03	NA	4.14e-05	NA
7. B	Q5M0S3	Probable GTP-binding protein EngB	4.84e-13	NA	4.84e-04	NA
7. B	Q72K85	tRNA modification GTPase MnmE	6.85e-04	NA	1.77e-07	NA
7. B	Q0BLL9	tRNA modification GTPase MnmE	7.92e-03	NA	1.54e-04	NA
7. B	Q81JD9	tRNA modification GTPase MnmE	3.71e-05	NA	2.51e-08	NA
7. B	Q8Z2N8	tRNA modification GTPase MnmE	3.23e-04	NA	1.55e-06	NA
7. B	Q0KFG6	tRNA modification GTPase MnmE	2.31e-04	NA	1.27e-04	NA
7. B	A3CMV2	Probable GTP-binding protein EngB	2.87e-13	NA	2.01e-04	NA
7. B	B8HSJ3	tRNA modification GTPase MnmE	1.59e-04	NA	6.39e-07	NA
7. B	A5VJK4	GTPase Der	4.66e-07	NA	1.43e-12	NA
7. B	Q02A42	tRNA modification GTPase MnmE	7.25e-04	NA	5.76e-05	NA
7. B	Q600K7	Probable GTP-binding protein EngB	7.98e-13	NA	0.001	NA
7. B	A1AV43	tRNA modification GTPase MnmE	3.38e-04	NA	1.68e-08	NA
7. B	P66972	tRNA modification GTPase MnmE	1.59e-04	NA	4.90e-09	NA
7. B	Q8DTT8	tRNA modification GTPase MnmE	3.21e-04	NA	8.91e-08	NA
7. B	B8I442	GTPase Der	4.07e-07	NA	6.22e-10	NA
7. B	Q135K8	GTPase Der	1.44e-06	NA	3.44e-09	NA
7. B	B7IE34	GTPase Der	5.88e-06	NA	1.38e-10	NA
7. B	Q3YS22	Probable GTP-binding protein EngB	6.48e-13	NA	0.006	NA
7. B	Q89MZ0	GTPase Der	1.40e-06	NA	1.18e-07	NA
7. B	B1M0E0	tRNA modification GTPase MnmE	7.54e-04	NA	5.06e-05	NA
7. B	Q5F5D9	GTPase Obg	1.19e-03	NA	0.040	NA
7. B	A1VER5	tRNA modification GTPase MnmE	3.36e-04	NA	0.009	NA
7. B	A8MKR9	tRNA modification GTPase MnmE	3.58e-04	NA	4.58e-07	NA
7. B	B4F0U0	tRNA modification GTPase MnmE	1.37e-04	NA	1.43e-06	NA
7. B	Q3AGU7	tRNA modification GTPase MnmE	9.58e-05	NA	2.17e-08	NA
7. B	B2K868	tRNA modification GTPase MnmE	3.20e-04	NA	3.98e-06	NA
7. B	Q9ZE46	Probable GTP-binding protein EngB	2.12e-11	NA	0.034	NA
7. B	B8EQH4	GTPase Obg	5.52e-04	NA	0.001	NA
7. B	Q8E4L9	Probable GTP-binding protein EngB	4.83e-13	NA	0.007	NA
7. B	Q73GH3	tRNA modification GTPase MnmE	1.63e-02	NA	0.003	NA
7. B	P0DB52	GTPase Obg	4.74e-03	NA	0.004	NA
7. B	B4TN11	tRNA modification GTPase MnmE	1.91e-04	NA	1.28e-06	NA
7. B	Q7YR35	Guanine nucleotide-binding protein-like 1	7.61e-02	NA	0.002	NA
7. B	B1GYZ9	tRNA modification GTPase MnmE	1.10e-04	NA	0.001	NA
7. B	O75616	GTPase Era, mitochondrial	0.00e+00	NA	3.22e-16	NA
7. B	Q7V395	tRNA modification GTPase MnmE	1.02e-04	NA	0.006	NA
7. B	Q3J6L9	tRNA modification GTPase MnmE	1.91e-04	NA	1.27e-07	NA
7. B	A6QAL0	tRNA modification GTPase MnmE	3.58e-04	NA	2.31e-08	NA
7. B	B0T6E0	tRNA modification GTPase MnmE	2.90e-04	NA	7.82e-06	NA
7. B	Q039K2	Probable GTP-binding protein EngB	5.66e-13	NA	0.004	NA
7. B	Q5XBM1	GTPase Obg	6.34e-03	NA	0.002	NA
7. B	O67030	tRNA modification GTPase MnmE	3.36e-04	NA	1.61e-10	NA
7. B	A7HSK9	tRNA modification GTPase MnmE	7.47e-04	NA	6.72e-05	NA
7. B	B3PN57	Probable GTP-binding protein EngB	2.70e-11	NA	0.024	NA
7. B	A0M5P1	GTPase Der	8.57e-07	NA	7.83e-06	NA
7. B	Q9ZL09	GTPase Der	2.23e-07	NA	2.29e-07	NA
7. B	B0SJ24	tRNA modification GTPase MnmE	3.56e-04	NA	1.63e-05	NA
7. B	O67749	GTPase Der	4.81e-07	NA	1.21e-09	NA
7. B	A7ZAW1	tRNA modification GTPase MnmE	9.84e-04	NA	1.71e-11	NA
7. B	Q6S5G3	Translocase of chloroplast 90, chloroplastic	1.21e-02	NA	0.019	NA
7. B	A6GZB7	GTPase Obg	2.28e-06	NA	7.46e-06	NA
7. B	A1VXL9	Translation initiation factor IF-2	2.02e-02	NA	0.034	NA
7. B	Q047F9	tRNA modification GTPase MnmE	2.73e-03	NA	3.38e-09	NA
7. B	Q97CW2	tRNA modification GTPase MnmE	9.24e-04	NA	5.67e-09	NA
7. B	Q7MW55	GTPase Obg	1.68e-03	NA	4.69e-06	NA
7. B	Q6FZ15	Probable GTP-binding protein EngB	8.36e-11	NA	0.003	NA
7. B	Q8KAS1	tRNA modification GTPase MnmE	2.30e-04	NA	1.38e-06	NA
7. B	A5IKF4	tRNA modification GTPase MnmE	2.04e-04	NA	4.71e-10	NA
7. B	A8G7P7	tRNA modification GTPase MnmE	2.77e-04	NA	2.49e-06	NA
7. B	A8FJU1	Translation initiation factor IF-2	1.90e-02	NA	0.012	NA
7. B	B2A1E8	Probable GTP-binding protein EngB	1.90e-10	NA	3.06e-04	NA
7. B	Q1RGV9	GTPase Obg	3.39e-06	NA	0.011	NA
7. B	B9FI63	GTPase ERA-like, chloroplastic	0.00e+00	NA	2.60e-52	NA
7. B	A0M5C6	GTPase Obg	3.47e-06	NA	2.51e-04	NA
7. B	Q8YQT0	GTPase Obg	1.25e-03	NA	6.90e-04	NA
7. B	Q1JLX3	tRNA modification GTPase MnmE	4.15e-04	NA	4.17e-07	NA
7. B	C0R405	tRNA modification GTPase MnmE	1.98e-03	NA	0.003	NA
7. B	Q9CDH8	tRNA modification GTPase MnmE	3.26e-03	NA	1.47e-06	NA
7. B	Q3SWH5	tRNA modification GTPase MnmE	2.77e-04	NA	1.38e-06	NA
7. B	Q65VC3	tRNA modification GTPase MnmE	5.69e-04	NA	2.41e-06	NA
7. B	Q15MS9	tRNA modification GTPase MnmE	2.54e-04	NA	2.42e-06	NA
7. B	B1MXT9	Probable GTP-binding protein EngB	9.46e-13	NA	4.51e-05	NA
7. B	Q6G1K8	tRNA modification GTPase MnmE	2.79e-04	NA	1.33e-05	NA
7. B	Q926U7	tRNA modification GTPase MnmE	2.02e-04	NA	1.27e-08	NA
7. B	Q3IU04	Probable GTP-binding protein EngB	5.30e-08	NA	0.011	NA
7. B	O67679	Probable GTP-binding protein EngB	1.03e-11	NA	9.52e-06	NA
7. B	Q49Y82	GTPase Obg	5.26e-03	NA	0.035	NA
7. B	Q7W6Q0	GTPase Der	3.98e-07	NA	5.69e-08	NA
7. B	A2BUG6	tRNA modification GTPase MnmE	7.90e-05	NA	6.19e-06	NA
7. B	B7UMH3	tRNA modification GTPase MnmE	3.24e-04	NA	1.09e-06	NA
7. B	B1I6S2	tRNA modification GTPase MnmE	2.00e-04	NA	7.85e-08	NA
7. B	Q4A8F6	tRNA modification GTPase MnmE	7.01e-04	NA	3.64e-05	NA
7. B	P66973	tRNA modification GTPase MnmE	2.78e-04	NA	4.90e-09	NA
7. B	Q6F2A3	tRNA modification GTPase MnmE	6.26e-04	NA	1.41e-04	NA
7. B	Q7VWL4	GTPase Der	3.18e-07	NA	5.69e-08	NA
7. B	B1AJA2	GTPase Obg	2.21e-03	NA	0.011	NA
7. B	Q3YWA7	tRNA modification GTPase MnmE	3.46e-04	NA	1.08e-06	NA
7. B	A5G964	Probable GTP-binding protein EngB	2.45e-10	NA	0.014	NA
7. B	B1ZGG9	tRNA modification GTPase MnmE	8.79e-04	NA	9.78e-08	NA
7. B	A6UEE9	tRNA modification GTPase MnmE	7.53e-04	NA	0.001	NA
7. B	A0AMD2	tRNA modification GTPase MnmE	2.06e-04	NA	1.35e-08	NA
7. B	A9KWW9	GTPase Der	5.47e-07	NA	5.06e-13	NA
7. B	B2S3S8	GTPase Der	2.76e-07	NA	1.38e-08	NA
7. B	A1T0N0	tRNA modification GTPase MnmE	1.90e-04	NA	1.59e-06	NA
7. B	Q7VGJ2	Probable GTP-binding protein EngB	3.78e-09	NA	0.032	NA
7. B	A8GTM1	tRNA modification GTPase MnmE	7.01e-04	NA	6.55e-07	NA
7. B	Q02Z21	Probable GTP-binding protein EngB	3.84e-13	NA	3.25e-05	NA
7. B	B4S5P1	GTPase Obg	6.91e-06	NA	0.001	NA
7. B	A7FPM0	tRNA modification GTPase MnmE	5.45e-04	NA	3.19e-07	NA
7. B	A9NBA7	tRNA modification GTPase MnmE	1.89e-04	NA	4.33e-05	NA
7. B	A8F5A0	Translation initiation factor IF-2	5.98e-03	NA	0.012	NA
7. B	Q92GE8	tRNA modification GTPase MnmE	7.02e-04	NA	7.77e-07	NA
7. B	Q5LLM7	tRNA modification GTPase MnmE	1.99e-03	NA	8.01e-05	NA
7. B	Q256D0	tRNA modification GTPase MnmE	3.88e-04	NA	0.018	NA
7. B	B8FVH0	Probable GTP-binding protein EngB	5.96e-10	NA	0.014	NA
7. B	Q821L2	tRNA modification GTPase MnmE	3.40e-04	NA	0.026	NA
7. B	C6DK97	tRNA modification GTPase MnmE	3.27e-04	NA	1.79e-06	NA
7. B	P0DB53	GTPase Obg	5.52e-03	NA	0.004	NA
7. B	B8DBY9	GTPase Der	2.48e-07	NA	2.82e-11	NA
7. B	B2GBC5	Probable GTP-binding protein EngB	4.16e-11	NA	0.004	NA
7. B	A5GPA1	tRNA modification GTPase MnmE	7.28e-05	NA	5.58e-07	NA
7. B	O83724	GTPase Obg	2.21e-04	NA	2.06e-04	NA
7. B	Q38WS0	Probable GTP-binding protein EngB	4.35e-12	NA	0.003	NA
7. B	Q6FYB8	tRNA modification GTPase MnmE	9.67e-05	NA	0.003	NA
7. B	Q5M3C8	GTPase Obg	2.08e-03	NA	0.014	NA
7. B	Q8Y3M4	tRNA modification GTPase MnmE	2.28e-04	NA	1.39e-08	NA
7. B	Q9PQA7	GTPase Der	3.15e-07	NA	7.26e-09	NA
7. B	Q4R8D2	Guanine nucleotide-binding protein-like 1	7.63e-02	NA	0.002	NA
7. B	A8FP41	tRNA modification GTPase MnmE	2.29e-04	NA	2.45e-06	NA
7. B	A6Q3D6	tRNA modification GTPase MnmE	9.56e-04	NA	1.81e-06	NA
7. B	A5EY43	tRNA modification GTPase MnmE	2.38e-04	NA	1.18e-05	NA
7. B	Q03LM9	Probable GTP-binding protein EngB	3.77e-13	NA	0.001	NA
7. B	A1BJ56	GTPase Obg	1.37e-03	NA	0.026	NA
7. B	A6TG09	tRNA modification GTPase MnmE	3.45e-04	NA	2.10e-06	NA
7. B	A9MJT6	tRNA modification GTPase MnmE	2.41e-04	NA	8.61e-07	NA
7. B	B9KG03	Probable GTP-binding protein EngB	1.02e-11	NA	0.003	NA
7. B	Q5HCD7	tRNA modification GTPase MnmE	3.97e-03	NA	5.26e-06	NA
7. B	Q477Q5	tRNA modification GTPase MnmE	1.45e-04	NA	4.07e-07	NA
7. B	B0BAF8	GTPase Der	1.92e-04	NA	4.16e-08	NA
7. B	Q7VJY2	tRNA modification GTPase MnmE	3.20e-04	NA	2.11e-05	NA
7. B	Q04AY6	GTPase Der	3.21e-07	NA	4.30e-11	NA
7. B	A7GWZ2	GTPase Der	2.99e-07	NA	4.13e-09	NA
7. B	Q3BLZ9	tRNA modification GTPase MnmE	1.49e-04	NA	5.00e-05	NA
7. B	Q8DUH9	Probable GTP-binding protein EngB	9.68e-13	NA	3.87e-04	NA
7. B	Q5LGG9	GTPase Obg	2.07e-04	NA	7.54e-07	NA
7. B	Q1JH22	tRNA modification GTPase MnmE	4.27e-04	NA	1.09e-07	NA
7. B	Q0BWA8	tRNA modification GTPase MnmE	7.08e-04	NA	0.003	NA
7. B	Q9SVA6	Developmentally-regulated G-protein 3	2.65e-04	NA	0.004	NA
7. B	C1F4C3	Probable GTP-binding protein EngB	6.06e-07	NA	7.75e-06	NA
7. B	Q47U36	tRNA modification GTPase MnmE	1.62e-04	NA	3.53e-05	NA
7. B	B0SAE4	tRNA modification GTPase MnmE	3.49e-04	NA	1.63e-05	NA
7. B	Q3A0Y0	Probable GTP-binding protein EngB	3.26e-11	NA	0.004	NA
7. B	Q3K1I2	tRNA modification GTPase MnmE	2.82e-03	NA	2.85e-07	NA
7. B	B7NR09	tRNA modification GTPase MnmE	2.94e-04	NA	1.02e-06	NA
7. B	P0DG22	tRNA modification GTPase MnmE	3.94e-03	NA	1.08e-07	NA
7. B	B3ER55	GTPase Obg	7.21e-06	NA	5.04e-06	NA
7. B	Q8VZ74	GTPase ERA-like, chloroplastic	0.00e+00	NA	5.08e-46	NA
7. B	Q0C441	GTPase Der	8.78e-05	NA	3.68e-10	NA
7. B	B1HPM3	tRNA modification GTPase MnmE	1.42e-04	NA	2.07e-08	NA
7. B	A1APR9	GTPase Der	2.73e-07	NA	1.52e-08	NA
7. B	Q04TV4	GTPase Der	9.73e-07	NA	2.26e-06	NA
7. B	Q1I2H5	tRNA modification GTPase MnmE	4.78e-04	NA	2.57e-07	NA
7. B	Q1JGD5	GTPase Obg	4.31e-03	NA	0.003	NA
7. B	A0RNG2	tRNA modification GTPase MnmE	2.30e-04	NA	2.95e-07	NA
7. B	Q49X54	Translation initiation factor IF-2	7.67e-03	NA	0.020	NA
7. B	Q5LG80	tRNA modification GTPase MnmE	3.83e-05	NA	1.10e-04	NA
7. B	Q3ZAJ2	GTPase Obg	4.52e-03	NA	1.93e-04	NA
7. B	A4T0N1	tRNA modification GTPase MnmE	2.95e-04	NA	1.94e-05	NA
7. B	A2C018	tRNA modification GTPase MnmE	6.21e-05	NA	5.83e-06	NA
7. B	P25811	tRNA modification GTPase MnmE	9.84e-04	NA	1.30e-11	NA
7. B	Q630B8	tRNA modification GTPase MnmE	4.06e-05	NA	2.15e-08	NA
7. B	Q2GGM7	Probable GTP-binding protein EngB	1.09e-11	NA	0.005	NA
7. B	B1IBH5	tRNA modification GTPase MnmE	3.56e-03	NA	1.16e-07	NA
7. B	Q98RJ5	tRNA modification GTPase MnmE	2.99e-04	NA	1.08e-06	NA
7. B	Q03JJ8	GTPase Obg	6.03e-03	NA	0.014	NA
7. B	Q3J2Y1	GTPase Der	2.71e-06	NA	1.67e-07	NA
7. B	A5FGE0	tRNA modification GTPase MnmE	6.53e-05	NA	1.00e-05	NA
7. B	Q5SJS7	tRNA modification GTPase MnmE	7.29e-04	NA	4.81e-07	NA
7. B	Q2GIJ8	tRNA modification GTPase MnmE	7.79e-04	NA	6.60e-05	NA
7. B	Q9PQ29	GTPase Obg	5.89e-03	NA	0.011	NA
7. B	Q0AKE8	tRNA modification GTPase MnmE	9.59e-04	NA	0.001	NA
7. B	Q1CCJ3	tRNA modification GTPase MnmE	3.18e-04	NA	4.02e-06	NA
7. B	Q2YZB8	tRNA modification GTPase MnmE	2.04e-04	NA	4.72e-09	NA
7. B	B0SRT7	GTPase Obg	7.12e-06	NA	0.039	NA
7. B	Q5X0M3	tRNA modification GTPase MnmE	2.33e-04	NA	1.06e-05	NA
7. B	A7I145	tRNA modification GTPase MnmE	4.10e-04	NA	6.73e-07	NA
7. B	Q2FDE8	tRNA modification GTPase MnmE	1.79e-04	NA	4.01e-09	NA
7. B	A8YUS5	Probable GTP-binding protein EngB	1.65e-13	NA	0.044	NA
7. B	B7L851	tRNA modification GTPase MnmE	2.95e-04	NA	1.10e-06	NA
7. B	A9M0N5	tRNA modification GTPase MnmE	9.80e-05	NA	7.46e-07	NA
7. B	B0V5S5	tRNA modification GTPase MnmE	6.09e-04	NA	5.06e-04	NA
7. B	A8GTZ9	GTPase Obg	2.83e-06	NA	0.003	NA
7. B	B8HQE1	GTPase Der	3.39e-07	NA	6.14e-11	NA
7. B	Q5F529	tRNA modification GTPase MnmE	9.51e-05	NA	1.25e-07	NA
7. B	Q5XCB7	tRNA modification GTPase MnmE	4.52e-04	NA	2.04e-07	NA
7. B	A4W2N6	tRNA modification GTPase MnmE	3.43e-03	NA	8.78e-08	NA
7. B	Q8YJS6	tRNA modification GTPase MnmE	3.72e-04	NA	0.002	NA
7. B	C0QT02	GTPase Der	7.38e-07	NA	1.74e-10	NA
7. B	A9IJ97	tRNA modification GTPase MnmE	5.08e-04	NA	3.13e-05	NA
7. B	Q602M5	tRNA modification GTPase MnmE	2.52e-04	NA	4.46e-07	NA
7. B	Q9RCA7	tRNA modification GTPase MnmE	3.31e-03	NA	3.25e-09	NA
7. B	B1Y0F6	tRNA modification GTPase MnmE	7.88e-05	NA	1.84e-05	NA
7. B	C0MDB4	GTPase Obg	3.20e-03	NA	0.002	NA
7. B	C0MBS1	GTPase Obg	4.51e-03	NA	0.001	NA
7. B	Q6MG06	Guanine nucleotide-binding protein-like 1	7.12e-02	NA	0.002	NA
7. B	Q1C0B3	tRNA modification GTPase MnmE	3.28e-04	NA	4.02e-06	NA
7. B	Q24SK9	Probable GTP-binding protein EngB	3.01e-10	NA	0.014	NA
7. B	A8FEL8	GTPase Der	2.23e-07	NA	2.61e-10	NA
7. B	Q1GP64	tRNA modification GTPase MnmE	9.18e-04	NA	0.003	NA
7. B	Q62EM6	tRNA modification GTPase MnmE	5.10e-05	NA	7.32e-06	NA
7. B	C1D6H7	tRNA modification GTPase MnmE	1.89e-04	NA	1.55e-07	NA
7. B	Q71VV0	tRNA modification GTPase MnmE	2.15e-04	NA	1.35e-08	NA
7. B	B3ETF1	GTPase Der	8.71e-07	NA	7.88e-08	NA
7. B	Q89WP4	tRNA modification GTPase MnmE	1.09e-02	NA	4.91e-05	NA
7. B	B5YFX9	GTPase Der	5.82e-07	NA	5.33e-09	NA
7. B	P0CAX2	tRNA modification GTPase MnmE	1.36e-03	NA	2.06e-04	NA
7. B	Q73K17	Probable GTP-binding protein EngB	2.55e-11	NA	0.032	NA
7. B	P64064	GTPase Der	3.59e-07	NA	1.30e-11	NA
7. B	A1S1G4	tRNA modification GTPase MnmE	2.60e-04	NA	3.64e-06	NA
7. B	Q5HVC1	Probable GTP-binding protein EngB	5.02e-10	NA	0.005	NA
7. B	A8LHW1	GTPase Der	1.43e-06	NA	1.40e-07	NA
7. B	Q2JJ90	GTPase Obg	1.01e-05	NA	0.002	NA
7. B	A7H1H0	GTPase Obg	7.41e-06	NA	0.002	NA
7. B	Q6GG32	Probable GTP-binding protein EngB	2.85e-13	NA	3.85e-05	NA
7. B	A8F063	GTPase Obg	3.17e-06	NA	0.008	NA
7. B	A5E8G7	tRNA modification GTPase MnmE	2.32e-03	NA	1.67e-04	NA
7. B	A8ACL8	tRNA modification GTPase MnmE	3.22e-04	NA	1.27e-06	NA
7. B	B5XLZ0	GTPase Obg	5.51e-03	NA	0.007	NA
7. B	A4XHX9	GTPase Der	4.29e-07	NA	6.90e-09	NA
7. B	Q8CX52	tRNA modification GTPase MnmE	1.99e-04	NA	3.28e-05	NA
7. B	B2UVJ7	tRNA modification GTPase MnmE	1.31e-04	NA	7.09e-09	NA
7. B	P94612	tRNA modification GTPase MnmE	1.67e-04	NA	4.33e-05	NA
7. B	P73182	Fe(2+) transporter FeoB	2.82e-03	NA	0.030	NA
7. B	Q48BF3	tRNA modification GTPase MnmE	8.41e-04	NA	4.80e-07	NA
7. B	Q8KBK3	GTPase Der	5.99e-07	NA	3.67e-09	NA
7. B	A3M8Y8	tRNA modification GTPase MnmE	6.71e-04	NA	4.80e-04	NA
7. B	A9R5S1	tRNA modification GTPase MnmE	3.09e-04	NA	4.02e-06	NA
7. B	A7GJN9	tRNA modification GTPase MnmE	7.94e-04	NA	6.60e-08	NA
7. B	A8YYS1	tRNA modification GTPase MnmE	2.09e-04	NA	4.01e-09	NA
7. B	A3PAQ7	tRNA modification GTPase MnmE	7.98e-05	NA	1.69e-06	NA
7. B	A7H1L5	Translation initiation factor IF-2	1.82e-02	NA	0.011	NA
7. B	A9NE34	tRNA modification GTPase MnmE	3.72e-04	NA	5.95e-07	NA
7. B	Q2S6H2	tRNA modification GTPase MnmE	4.30e-04	NA	1.30e-07	NA
7. B	Q2Y5A9	tRNA modification GTPase MnmE	1.73e-04	NA	3.10e-09	NA
7. B	B0K8H9	tRNA modification GTPase MnmE	3.26e-04	NA	3.00e-09	NA
7. B	Q1QRZ0	tRNA modification GTPase MnmE	9.34e-04	NA	1.04e-05	NA
7. B	A5G692	GTPase Der	2.97e-07	NA	5.09e-10	NA
7. B	Q0A4L6	tRNA modification GTPase MnmE	8.11e-04	NA	0.006	NA
7. B	A7H372	tRNA modification GTPase MnmE	2.05e-04	NA	3.35e-09	NA
7. B	A9CHB2	tRNA modification GTPase MnmE	1.74e-04	NA	2.37e-07	NA
7. B	Q7NPT9	tRNA modification GTPase MnmE	7.06e-05	NA	2.87e-06	NA
7. B	B1JFV3	tRNA modification GTPase MnmE	6.94e-04	NA	9.71e-07	NA
7. B	A6VF44	tRNA modification GTPase MnmE	6.91e-04	NA	3.16e-07	NA
7. B	Q7V368	GTPase Obg	2.52e-06	NA	0.030	NA
7. B	Q39T85	GTPase Der	2.68e-07	NA	1.05e-09	NA
7. B	B5QUQ5	tRNA modification GTPase MnmE	2.50e-04	NA	1.28e-06	NA
7. B	A9KBS9	tRNA modification GTPase MnmE	1.35e-04	NA	4.33e-05	NA
7. B	A6LT31	Probable GTP-binding protein EngB	8.65e-11	NA	0.002	NA
7. B	Q121L2	tRNA modification GTPase MnmE	1.76e-04	NA	7.15e-06	NA
7. B	Q3AVY3	tRNA modification GTPase MnmE	1.20e-04	NA	1.29e-08	NA
7. B	B2VCE7	tRNA modification GTPase MnmE	1.64e-04	NA	1.59e-06	NA
7. B	Q6MTV5	Probable GTP-binding protein EngB	5.86e-13	NA	0.002	NA
7. B	A8Z608	GTPase Der	6.99e-07	NA	2.60e-13	NA
7. B	Q5P4P5	tRNA modification GTPase MnmE	8.46e-05	NA	8.35e-07	NA
7. B	B0RMM4	tRNA modification GTPase MnmE	2.18e-04	NA	5.00e-05	NA
7. B	A6L6E8	tRNA modification GTPase MnmE	6.39e-05	NA	0.001	NA
7. B	A9HE16	tRNA modification GTPase MnmE	9.34e-04	NA	4.02e-05	NA
7. B	Q55C52	tRNA modification GTPase gtpbp3, mitochondrial	7.70e-04	NA	4.31e-04	NA
7. B	B5ZBV6	GTPase Obg	5.08e-03	NA	0.022	NA
7. B	P59569	tRNA modification GTPase MnmE	1.15e-04	NA	0.016	NA
7. B	Q2NIG1	tRNA modification GTPase MnmE	1.86e-04	NA	1.48e-06	NA
7. B	B5EEM1	Probable GTP-binding protein EngB	7.23e-11	NA	0.003	NA
7. B	A2BNY4	tRNA modification GTPase MnmE	8.96e-05	NA	1.28e-06	NA
7. B	P46198	Translation initiation factor IF-2, mitochondrial	2.25e-03	NA	0.039	NA
7. B	B0URU2	tRNA modification GTPase MnmE	1.98e-04	NA	4.31e-06	NA
7. B	A6WUK3	tRNA modification GTPase MnmE	2.48e-04	NA	2.42e-05	NA
7. B	Q8ZKY3	tRNA modification GTPase MnmE	3.10e-04	NA	1.29e-06	NA
7. B	Q39ZT0	tRNA modification GTPase MnmE	2.64e-04	NA	1.50e-09	NA
7. B	Q8H1F6	DAR GTPase 3, chloroplastic	1.56e-02	NA	0.003	NA
7. B	O51461	GTPase Der	1.08e-05	NA	4.37e-08	NA
7. B	Q8CY34	tRNA modification GTPase MnmE	3.74e-03	NA	0.003	NA
7. B	A5WI36	tRNA modification GTPase MnmE	1.09e-03	NA	5.80e-04	NA
7. B	Q1WVH7	tRNA modification GTPase MnmE	3.76e-03	NA	3.30e-08	NA
7. B	A3DAS7	tRNA modification GTPase MnmE	2.24e-04	NA	2.49e-05	NA
7. B	Q494C0	tRNA modification GTPase MnmE	4.76e-04	NA	0.037	NA
7. B	C0MEW6	Probable GTP-binding protein EngB	3.83e-13	NA	4.79e-04	NA
7. B	Q39PQ9	tRNA modification GTPase MnmE	1.78e-04	NA	6.54e-07	NA
7. B	B5ZBM9	GTPase Der	2.60e-07	NA	1.42e-08	NA
7. B	Q5HS36	tRNA modification GTPase MnmE	1.71e-04	NA	3.14e-10	NA
7. B	Q1CT35	GTPase Der	2.16e-07	NA	7.17e-08	NA
7. B	A8GUG0	GTPase Obg	2.71e-06	NA	0.011	NA
7. B	Q82XA1	tRNA modification GTPase MnmE	2.03e-04	NA	5.15e-08	NA
7. B	Q7W2J0	tRNA modification GTPase MnmE	4.05e-04	NA	3.86e-04	NA
7. B	Q1R4M8	tRNA modification GTPase MnmE	2.75e-04	NA	1.13e-06	NA
7. B	Q24M98	tRNA modification GTPase MnmE	2.25e-04	NA	8.50e-10	NA
7. B	Q48TS5	tRNA modification GTPase MnmE	3.76e-04	NA	8.42e-07	NA
7. B	Q9WZM6	Ribosome biogenesis GTPase A	3.49e-02	NA	0.010	NA
7. B	B8G2P9	GTPase Der	2.66e-07	NA	6.41e-11	NA
7. B	Q03D59	tRNA modification GTPase MnmE	3.72e-04	NA	7.47e-10	NA
7. B	Q0VKU8	tRNA modification GTPase MnmE	4.42e-04	NA	8.40e-07	NA
7. B	O67849	GTPase Obg	1.40e-05	NA	0.018	NA
7. B	A9KX19	tRNA modification GTPase MnmE	2.27e-04	NA	2.58e-05	NA
7. B	Q9PRC7	tRNA modification GTPase MnmE	1.76e-03	NA	1.58e-10	NA
7. B	A3PNS7	tRNA modification GTPase MnmE	1.11e-03	NA	1.15e-05	NA
7. B	Q13E22	tRNA modification GTPase MnmE	1.57e-02	NA	9.86e-06	NA
7. B	B7M559	tRNA modification GTPase MnmE	1.92e-04	NA	1.09e-06	NA
7. B	Q92A71	GTPase Der	2.75e-07	NA	3.39e-11	NA
7. B	Q46VM0	tRNA modification GTPase MnmE	1.69e-04	NA	0.002	NA
7. B	A1TWI4	tRNA modification GTPase MnmE	2.99e-04	NA	5.79e-06	NA
7. B	Q1RKJ6	tRNA modification GTPase MnmE	6.34e-04	NA	1.90e-05	NA
7. B	A8F2Y3	GTPase Obg	2.92e-06	NA	0.002	NA
7. B	Q6N586	GTPase Der	1.54e-06	NA	9.79e-09	NA
7. B	B0KRC0	tRNA modification GTPase MnmE	1.19e-03	NA	4.98e-07	NA
7. B	Q48SX8	GTPase Obg	6.02e-03	NA	7.50e-04	NA
7. B	Q8F6K1	GTPase Der	1.18e-06	NA	2.96e-07	NA
7. B	A0KQZ6	tRNA modification GTPase MnmE	1.81e-04	NA	6.18e-06	NA
7. B	A6TM67	Probable GTP-binding protein EngB	1.51e-11	NA	0.021	NA
7. B	A5FIR0	GTPase Der	1.52e-06	NA	1.56e-05	NA
7. B	Q5HP70	GTPase Der	3.75e-07	NA	4.30e-12	NA
7. B	A8HAH9	tRNA modification GTPase MnmE	2.82e-04	NA	3.91e-06	NA
7. B	Q67J33	tRNA modification GTPase MnmE	4.73e-05	NA	1.55e-04	NA
7. B	A0M537	Probable GTP-binding protein EngB	7.81e-13	NA	0.033	NA
7. B	Q89ZI9	GTPase Obg	3.31e-04	NA	2.04e-07	NA
7. B	Q5KU57	tRNA modification GTPase MnmE	3.13e-04	NA	7.12e-10	NA
7. B	A8FJQ1	GTPase Obg	7.99e-06	NA	0.022	NA
7. B	B4U3Q7	GTPase Obg	5.16e-03	NA	0.002	NA
7. B	P0DG23	tRNA modification GTPase MnmE	3.70e-04	NA	1.08e-07	NA
7. B	A6LDT9	tRNA modification GTPase MnmE	2.00e-04	NA	0.001	NA
7. B	Q65S59	GTPase Obg	1.11e-02	NA	0.050	NA
7. B	P0C8N9	tRNA modification GTPase MnmE	1.95e-04	NA	4.46e-04	NA
7. B	Q6MUE7	tRNA modification GTPase MnmE	6.88e-04	NA	4.79e-08	NA
7. B	B3CMJ7	tRNA modification GTPase MnmE	1.42e-02	NA	0.001	NA
7. B	Q8EUV6	tRNA modification GTPase MnmE	3.37e-04	NA	2.80e-08	NA
7. B	P0A6P5	GTPase Der	4.76e-07	NA	3.69e-14	NA
7. B	O25505	GTPase Der	1.88e-07	NA	1.72e-07	NA
7. B	Q8NW73	Probable GTP-binding protein EngB	2.98e-13	NA	3.96e-05	NA
7. B	B4RQP4	GTPase Obg	1.11e-03	NA	0.040	NA
7. B	Q85FG3	Probable tRNA modification GTPase MnmE	3.36e-04	NA	1.38e-05	NA
7. B	B6YQB9	GTPase Der	8.36e-07	NA	2.77e-07	NA
7. B	B3Q039	Probable GTP-binding protein EngB	3.11e-10	NA	0.001	NA
7. B	Q0AE55	tRNA modification GTPase MnmE	6.19e-05	NA	3.55e-08	NA
7. B	B1XKC3	tRNA modification GTPase MnmE	8.08e-04	NA	1.30e-07	NA
7. B	Q256C5	GTPase Der	7.79e-07	NA	2.42e-09	NA
7. B	Q9RL97	tRNA modification GTPase MnmE	3.19e-04	NA	2.73e-06	NA
7. B	Q0SYP6	tRNA modification GTPase MnmE	3.46e-04	NA	1.08e-06	NA
7. B	A2RP37	tRNA modification GTPase MnmE	4.90e-03	NA	1.68e-06	NA
7. B	Q969Y2	tRNA modification GTPase GTPBP3, mitochondrial	4.16e-04	NA	0.022	NA
7. B	Q899S2	tRNA modification GTPase MnmE	2.52e-04	NA	5.37e-07	NA
7. B	B3Q8A8	tRNA modification GTPase MnmE	2.70e-03	NA	7.49e-06	NA
7. B	B5YEQ1	GTPase Obg	7.90e-03	NA	6.84e-04	NA
7. B	Q2YR11	tRNA modification GTPase MnmE	3.93e-04	NA	0.002	NA
7. B	Q04W28	tRNA modification GTPase MnmE	2.79e-04	NA	1.21e-04	NA
7. B	B3WE42	Probable GTP-binding protein EngB	7.45e-13	NA	0.004	NA
7. B	Q5HX30	Translation initiation factor IF-2	2.02e-02	NA	0.015	NA
7. B	B5ZB76	Probable GTP-binding protein EngB	5.41e-08	NA	1.55e-05	NA
7. B	Q68VS1	GTPase Obg	2.69e-06	NA	0.007	NA
7. B	A3DE77	GTPase Der	7.01e-07	NA	3.24e-11	NA
7. B	Q7WDI4	tRNA modification GTPase MnmE	4.77e-04	NA	3.93e-04	NA
7. B	Q5ZR82	tRNA modification GTPase MnmE	5.77e-04	NA	9.35e-06	NA
7. B	A5CVJ3	tRNA modification GTPase MnmE	6.40e-04	NA	5.65e-04	NA
7. B	Q2SRV9	GTPase Obg	5.09e-03	NA	0.018	NA
7. B	Q04XE4	tRNA modification GTPase MnmE	3.32e-04	NA	1.21e-04	NA
7. B	Q821L7	GTPase Der	1.20e-06	NA	1.75e-10	NA
7. B	Q329B1	tRNA modification GTPase MnmE	3.17e-04	NA	1.10e-06	NA
7. B	B3CNP2	GTPase Obg	5.42e-04	NA	0.004	NA
7. B	Q31DJ0	tRNA modification GTPase MnmE	1.53e-04	NA	8.58e-07	NA
7. B	Q8E5T7	tRNA modification GTPase MnmE	2.13e-03	NA	2.58e-07	NA
7. B	Q21QM5	tRNA modification GTPase MnmE	1.35e-04	NA	1.46e-05	NA
7. B	Q5HCI3	tRNA modification GTPase MnmE	1.79e-04	NA	4.01e-09	NA
7. B	A4IRG9	Probable GTP-binding protein EngB	4.63e-13	NA	0.003	NA
7. B	Q1GN74	Probable GTP-binding protein EngB	6.20e-11	NA	0.002	NA
7. B	Q98DZ0	tRNA modification GTPase MnmE	2.62e-04	NA	0.003	NA
7. B	Q6F6L1	tRNA modification GTPase MnmE	8.44e-04	NA	2.12e-05	NA
7. B	Q31UW0	tRNA modification GTPase MnmE	2.68e-04	NA	1.09e-06	NA
7. B	Q2A342	tRNA modification GTPase MnmE	1.13e-02	NA	1.59e-04	NA
7. B	Q2RN77	tRNA modification GTPase MnmE	1.34e-03	NA	0.002	NA
7. B	Q4UNL0	tRNA modification GTPase MnmE	1.61e-04	NA	5.28e-05	NA
7. B	A7ZTR2	tRNA modification GTPase MnmE	3.29e-04	NA	1.03e-06	NA
7. B	Q0TLZ4	tRNA modification GTPase MnmE	4.84e-04	NA	1.14e-05	NA
7. B	Q824F3	GTPase Obg	1.73e-06	NA	0.013	NA
7. B	Q8DPZ8	tRNA modification GTPase MnmE	3.81e-03	NA	1.12e-07	NA
7. B	C6E8C5	Probable GTP-binding protein EngB	2.39e-11	NA	0.004	NA
7. B	Q1J652	GTPase Obg	3.99e-03	NA	0.003	NA
7. B	Q4AAC5	tRNA modification GTPase MnmE	1.89e-03	NA	3.84e-05	NA
7. B	Q033L0	tRNA modification GTPase MnmE	1.36e-03	NA	9.74e-09	NA
7. B	A7X7A8	tRNA modification GTPase MnmE	2.29e-04	NA	4.34e-08	NA
7. B	Q6CYQ9	tRNA modification GTPase MnmE	3.70e-04	NA	3.36e-06	NA
7. B	A4IX14	tRNA modification GTPase MnmE	2.16e-03	NA	1.59e-04	NA
7. B	A4VS81	tRNA modification GTPase MnmE	4.69e-04	NA	3.86e-07	NA
7. B	Q2S6M6	tRNA modification GTPase MnmE	5.34e-04	NA	1.28e-06	NA
7. B	A2CDC4	tRNA modification GTPase MnmE	1.10e-04	NA	1.38e-07	NA
7. B	B6YRA6	GTPase Obg	7.51e-04	NA	0.001	NA
7. B	Q2GD53	tRNA modification GTPase MnmE	3.46e-03	NA	8.19e-11	NA
7. B	Q87TR6	tRNA modification GTPase MnmE	2.80e-04	NA	4.55e-06	NA
7. B	B0K3E4	GTPase Der	4.50e-07	NA	2.17e-12	NA
7. B	Q1MS56	GTPase Der	2.70e-07	NA	4.10e-11	NA
7. B	Q6MGL5	tRNA modification GTPase MnmE	1.62e-04	NA	1.82e-06	NA
7. B	Q9ZLF3	Fe(2+) transporter FeoB	4.02e-03	NA	0.014	NA
7. B	B7LK49	tRNA modification GTPase MnmE	3.11e-04	NA	1.13e-06	NA
7. B	A8AXP0	tRNA modification GTPase MnmE	3.89e-04	NA	2.55e-07	NA
7. B	B3WE80	GTPase Der	4.87e-07	NA	2.92e-11	NA
7. B	A6WX76	tRNA modification GTPase MnmE	8.23e-04	NA	1.24e-04	NA
7. B	A6L100	GTPase Obg	4.46e-04	NA	2.85e-08	NA
7. B	Q14GV5	tRNA modification GTPase MnmE	3.22e-03	NA	1.57e-04	NA
7. B	Q2FUQ2	tRNA modification GTPase MnmE	2.39e-04	NA	4.90e-09	NA
7. B	Q9CLQ1	tRNA modification GTPase MnmE	3.93e-04	NA	8.90e-07	NA
7. B	B6JW87	Mitochondrial GTPase 1	1.59e-02	NA	0.044	NA
7. B	A6GXB2	tRNA modification GTPase MnmE	1.09e-04	NA	1.10e-06	NA
7. B	P9WNL3	GTPase Der	4.51e-07	NA	3.22e-06	NA
7. B	Q8K9G1	GTPase Obg	2.29e-06	NA	0.041	NA
7. B	B9DU74	Probable GTP-binding protein EngB	3.82e-13	NA	0.003	NA
7. B	P0DA90	GTPase Der	4.50e-07	NA	1.09e-11	NA
7. B	Q7NB30	GTPase Obg	1.71e-02	NA	0.014	NA
7. B	Q6HAF2	tRNA modification GTPase MnmE	4.46e-05	NA	2.51e-08	NA
7. B	Q3AAU6	GTPase Der	2.60e-07	NA	2.24e-15	NA
7. B	A5F485	tRNA modification GTPase MnmE	1.69e-04	NA	2.30e-06	NA
7. B	Q5GTQ0	tRNA modification GTPase MnmE	1.51e-03	NA	4.57e-04	NA
7. B	Q1GCM0	tRNA modification GTPase MnmE	1.55e-03	NA	9.95e-07	NA
7. B	Q2FXQ8	Probable GTP-binding protein EngB	2.88e-13	NA	3.85e-05	NA
7. B	B4RXT8	Translation initiation factor IF-2	1.21e-02	NA	0.011	NA
7. B	C5CDZ4	Translation initiation factor IF-2	5.44e-03	NA	0.029	NA
7. B	A1VXH9	GTPase Obg	3.23e-04	NA	0.025	NA
7. B	B3EHE6	GTPase Obg	5.92e-04	NA	0.006	NA
7. B	Q9KCD4	GTPase Der	2.52e-07	NA	5.96e-12	NA
7. B	Q6APY7	tRNA modification GTPase MnmE	1.89e-04	NA	2.62e-05	NA
7. B	Q9JXL4	tRNA modification GTPase MnmE	8.84e-05	NA	1.49e-06	NA
7. B	B9LBT6	GTPase Der	7.52e-07	NA	4.39e-15	NA
7. B	A0LLH5	tRNA modification GTPase MnmE	3.40e-04	NA	2.52e-06	NA
7. B	Q5PKU1	tRNA modification GTPase MnmE	2.97e-04	NA	1.72e-06	NA
7. B	Q3ZW89	GTPase Obg	6.71e-03	NA	0.001	NA
7. B	B0TFW3	GTPase Der	3.16e-07	NA	1.68e-10	NA
7. B	Q8P1C8	Probable GTP-binding protein EngB	4.46e-13	NA	0.001	NA
7. B	C4ZYY4	tRNA modification GTPase MnmE	3.19e-04	NA	1.09e-06	NA
7. B	B0TYD1	tRNA modification GTPase MnmE	2.47e-02	NA	8.23e-05	NA
7. B	C0ZCB6	GTPase Der	2.28e-07	NA	1.18e-11	NA
7. B	Q9CZU4	GTPase Era, mitochondrial	0.00e+00	NA	9.38e-09	NA
7. B	B8E0B2	GTPase Obg	4.32e-03	NA	8.59e-05	NA
7. B	A9VTM0	tRNA modification GTPase MnmE	2.07e-04	NA	2.58e-08	NA
7. B	Q7NHT3	tRNA modification GTPase MnmE	3.53e-04	NA	6.70e-06	NA
7. B	B3QRD8	GTPase Obg	1.36e-03	NA	0.001	NA
7. B	A5VA82	tRNA modification GTPase MnmE	1.07e-03	NA	0.002	NA
7. B	B2GC35	GTPase Der	3.50e-07	NA	8.45e-11	NA
7. B	A1AXR3	tRNA modification GTPase MnmE	2.75e-04	NA	1.97e-04	NA
7. B	Q99ZU0	tRNA modification GTPase MnmE	4.31e-04	NA	9.80e-08	NA
7. B	C1AB49	Probable GTP-binding protein EngB	3.70e-10	NA	0.004	NA
7. B	A1AU48	Probable GTP-binding protein EngB	8.69e-11	NA	9.25e-05	NA
7. B	A9BHV0	Probable GTP-binding protein EngB	2.57e-12	NA	1.24e-06	NA
7. B	Q48V63	GTPase Der	4.65e-07	NA	1.34e-11	NA
7. B	A9BHZ7	tRNA modification GTPase MnmE	1.71e-04	NA	6.76e-08	NA
7. B	Q7MQK6	tRNA modification GTPase MnmE	2.81e-04	NA	3.64e-06	NA
7. B	Q2J357	tRNA modification GTPase MnmE	2.80e-03	NA	6.93e-07	NA
7. B	Q0TB01	tRNA modification GTPase MnmE	2.48e-04	NA	1.13e-06	NA
7. B	Q9P9U3	tRNA modification GTPase MnmE	3.12e-04	NA	5.29e-06	NA
7. B	A4SDB8	GTPase Der	4.53e-07	NA	1.33e-07	NA
7. B	A1WDB4	tRNA modification GTPase MnmE	3.34e-04	NA	3.09e-06	NA
7. B	A0PX77	tRNA modification GTPase MnmE	4.67e-04	NA	6.23e-06	NA
7. B	P75104	tRNA modification GTPase MnmE	1.03e-03	NA	0.002	NA
7. B	Q57HZ6	tRNA modification GTPase MnmE	2.95e-04	NA	1.28e-06	NA
7. B	Q054P6	GTPase Obg	2.30e-03	NA	0.025	NA
7. B	P0A176	tRNA modification GTPase MnmE	8.01e-04	NA	4.19e-07	NA
7. B	A4TSL0	tRNA modification GTPase MnmE	3.65e-04	NA	4.02e-06	NA
7. B	Q38UE9	tRNA modification GTPase MnmE	4.28e-04	NA	5.77e-08	NA
7. B	Q03N64	tRNA modification GTPase MnmE	2.44e-04	NA	5.97e-09	NA
7. B	Q2K2S0	tRNA modification GTPase MnmE	5.28e-04	NA	0.005	NA