Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54770.1
JCVISYN3A_0406

DNA primase.
M. mycoides homolog: Q6MTE3.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 10
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 2

Total Homologs: 76
Unique PROST Homologs: 0
Unique BLAST Homologs: 4
Unique Foldseek Homologs: 7

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: dnaG; DNA primase
Zhang et al. [4]: GO:0016779|nucleotidyltransferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P33655 (DNA primase) with a FATCAT P-Value: 0 and RMSD of 2.76 angstrom. The sequence alignment identity is 30.3%.
Structural alignment shown in left. Query protein AVX54770.1 colored as red in alignment, homolog P33655 colored as blue. Query protein AVX54770.1 is also shown in right top, homolog P33655 showed in right bottom. They are colored based on secondary structures. 

  AVX54770.1 M--VYISNE---KINEIISQVSIVDVISSYLHLIKK-GSNYLAICPFHNDSNPSLTISPEKRIYTCFSCKASGNVINFV---KDFEHVEFLTALKTVCDK 91
      P33655 MECLIIAEDIIQKVKDL--N-DIVDIVSEKVKL-KRTGRNYSGLCPFHHEKTPSFSVSQDKQIYKCFGCGEAGNVITFVMKTKNFSFVE---AVKYLADK 93

  AVX54770.1 ANISLDEFKN-YNQPIKDLEAETIFKLNSEANNIFKTTLFSNL--GIQALEYLKSRNITIEQIKKFEIGFASDK-TNLVQKLLDKNYNSLDIEKANLGII 187
      P33655 VNITIDDNKDKYYAKNKE-KYDKLYSMNVEAARYF----FRNLDSNSKAKKYFLDRGINQKTMRRFGLGYAKDDWRQLLSFMKSKGYTELELIEA--GLI 186

  AVX54770.1 T--NS--YTKDYFINRIIFPIKDENNQVIGFSGRSFTKDNEPKYLNTKENKVFKK-SHLAYNIASALK--ISKSLKKIIVLEGFMDVISLSKIDINNTIA 280
      P33655 VQKNKAVY--DRFRNRVIFPVFDYKGKVIGFGGR-VLDDSKPKYLNSPETKIFKKGTNL-YGLNFAVKNNIGDT---IIIVEGYMDCISLHQYGINNVVA 279

  AVX54770.1 LMGTSLSNYHLNLFKRHNLDVLLFLDGDDPGIQANIKISHQLLKE---KINVLVI-DNQTNNDPDELV--NNNVEYLKQIINQPIHPVNYLIEKLWNKVD 374
      P33655 SLGTALTKDQAKLLKRYASKVVISYDADTAGQAATLR-GFDILREAGFDIKIIKIPDGK---DPDEFVRKNGKEAFMR-LVENAVSIIDYRINRAFENVN 374

  AVX54770.1 INNPNQIENFIKKVLNFIFDLNNEILVET-TINKLVELTKISEQT-IKNNLI-ELKKQSKPNNSFNKNSTTQVFKTNTQTNKVNKQQSKSKPNDFIKKEY 471
      P33655 LKDS---ESVIK----YVKDI-SEIIEELDPVEKDVYIKKISDKTGIREQAIYDL-------------ISTDIQKSGNNIEKMNK-NSNYGQNLYVESAH 452

  AVX54770.1 INAERRIFISLLI--SD--QFLD-KIAANVDKMIHPDIKHATINLINLYNKKIYQ--GN--DINKAFDLLKEYNLTGF-----D--KKQEEII----NNS 551
      P33655 VKSERYL-LRLMIEHKDIRSYIESKISA--D-----D-------LIMESHKKIYNIILNFED-NLSSDLKSKF---GFIESRCDDGESSSEIVKIEEQNI 533

  AVX54770.1 LLTSIKIRESEIDDAFSKLDSYHNDTEISNLKKL-LVESKNKTERFQIWNGI------D-TLKNKKKKR----------- 612
      P33655 MLS-----ENNVKDL---VDDF-----ITNIKKFRLEESKKKIMS-EI-KGLEEKGLFDETI--ELIKRMEEIQNQLDNL 596

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0003677 DNA binding
1. PBF GO:0008270 zinc ion binding
1. PBF GO:0003678 DNA helicase activity
1. PBF GO:1990077 primosome complex
1. PBF GO:0003896 DNA primase activity
1. PBF GO:0006269 DNA replication, synthesis of RNA primer
3. BF GO:0008143 poly(A) binding
3. BF GO:0000178 exosome (RNase complex)
6. F GO:0006264 mitochondrial DNA replication
6. F GO:0043139 5'-3' DNA helicase activity

Uniprot GO Annotations

GO Description
GO:0016740 transferase activity
GO:0016779 nucleotidyltransferase activity
GO:0003677 DNA binding
GO:0006260 DNA replication
GO:0008270 zinc ion binding
GO:1990077 primosome complex
GO:0006269 DNA replication, synthesis of RNA primer
GO:0046872 metal ion binding
GO:0003896 DNA primase activity
GO:0000428 DNA-directed RNA polymerase complex

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P71481 DNA primase 7.88e-15 4.96e-54 5.99e-60 0.4983
1. PBF P9WNW0 DNA primase 6.44e-15 1.14e-51 1.26e-40 0.5081
1. PBF O67465 DNA primase 1.90e-14 4.04e-28 1.18e-56 0.5436
1. PBF P0ABS7 DNA primase 5.18e-12 7.71e-50 1.97e-57 0.5469
1. PBF Q9PM37 DNA primase 2.03e-12 1.35e-71 4.57e-57 0.5186
1. PBF Q6GGD7 DNA primase 1.11e-16 1.39e-64 8.69e-69 0.52
1. PBF O52200 DNA primase 8.10e-15 4.97e-50 5.11e-39 0.5337
1. PBF Q8FDG5 DNA primase 3.76e-12 8.12e-50 1.36e-57 0.5514
1. PBF O51653 DNA primase 0.00e+00 4.76e-26 5.99e-58 0.5631
1. PBF Q9PLC9 DNA primase 9.77e-15 3.19e-68 1.13e-52 0.5592
1. PBF Q6G904 DNA primase 2.00e-15 1.76e-66 9.84e-71 0.5206
1. PBF O84799 DNA primase 3.33e-16 6.61e-70 9.53e-53 0.5614
1. PBF Q9S1N4 DNA primase 2.11e-14 1.38e-57 1.29e-38 0.5647
1. PBF Q92BQ5 DNA primase 0.00e+00 3.14e-65 4.06e-67 0.5354
1. PBF Q9X4D0 DNA primase 0.00e+00 1.98e-66 1.34e-60 0.5862
1. PBF Q9CLI9 DNA primase 3.99e-12 1.26e-48 3.86e-48 0.4799
1. PBF O05338 DNA primase 6.55e-15 4.65e-67 5.53e-69 0.5194
1. PBF Q9RWR5 DNA primase 4.77e-15 6.81e-57 5.09e-57 0.4922
1. PBF P50070 DNA primase 4.00e-15 3.70e-73 1.43e-50 0.4985
1. PBF P75426 DNA primase 2.47e-11 1.06e-65 8.54e-44 0.4764
1. PBF Q08346 DNA primase 1.03e-14 1.04e-54 1.52e-52 0.5137
1. PBF P05096 DNA primase 0.00e+00 3.01e-61 3.23e-68 0.58
1. PBF P74143 DNA primase 1.11e-16 4.72e-64 8.96e-49 0.5092
1. PBF Q9Z6W4 DNA primase 3.33e-16 3.43e-64 2.95e-47 0.5631
1. PBF Q9KD44 DNA primase 0.00e+00 9.35e-69 1.33e-62 0.5765
1. PBF Q4UJT0 DNA primase 1.05e-12 1.24e-58 1.72e-50 0.5265
1. PBF P57029 DNA primase 7.39e-13 1.16e-49 4.34e-53 0.5392
1. PBF Q9PPZ6 DNA primase 5.28e-14 4.73e-62 2.21e-55 0.525
1. PBF P63965 DNA primase 2.66e-15 2.73e-67 6.13e-69 0.5214
1. PBF Q9CCG2 DNA primase 3.03e-14 1.47e-49 3.17e-37 0.5168
1. PBF P30103 DNA primase 2.63e-12 1.08e-57 2.65e-51 0.5235
1. PBF P57164 DNA primase 5.55e-15 5.90e-56 9.17e-47 0.4903
1. PBF Q1RKH8 DNA primase 2.93e-14 3.46e-58 7.24e-51 0.5512
1. PBF Q92FZ7 DNA primase 1.42e-13 6.00e-59 3.73e-51 0.5215
1. PBF Q5HNY6 DNA primase 9.99e-16 3.35e-62 1.67e-66 0.5133
1. PBF Q9X1G3 DNA primase 7.77e-16 3.78e-61 1.33e-53 0.5215
1. PBF P32000 DNA primase 0.00e+00 1.74e-53 2.82e-50 0.4825
1. PBF P33655 DNA primase 0.00e+00 1.78e-71 1.53e-63 0.5159
1. PBF P47492 DNA primase 1.35e-10 5.54e-58 1.69e-32 0.4848
1. PBF Q8CP23 DNA primase 1.11e-15 3.35e-62 1.67e-66 0.5207
1. PBF P47762 DNA primase 0.00e+00 2.63e-65 7.15e-69 0.5339
1. PBF P63964 DNA primase 6.66e-16 2.73e-67 6.13e-69 0.5181
1. PBF Q98QB3 DNA primase 3.33e-16 2.63e-65 9.76e-55 0.5683
1. PBF Q9ZN49 DNA primase 2.22e-16 2.28e-64 1.15e-60 0.5696
1. PBF P74893 DNA primase 0.00e+00 2.28e-52 5.58e-53 0.5054
1. PBF P57028 DNA primase 5.22e-13 4.60e-50 6.23e-53 0.5265
1. PBF Q9I5W0 DNA primase 7.91e-12 1.20e-51 4.29e-61 0.5509
1. PBF Q5HFJ8 DNA primase 2.78e-15 1.43e-64 1.81e-68 0.5222
1. PBF P0ABS6 DNA primase 2.91e-12 7.71e-50 1.97e-57 0.5557
1. PBF Q04505 DNA primase 1.93e-14 2.10e-53 1.47e-63 0.5651
1. PBF P0A119 DNA primase 1.29e-13 3.61e-49 2.15e-59 0.5766
1. PBF P07362 DNA primase 7.55e-15 1.23e-51 1.93e-57 0.4855
1. PBF P52308 DNA primase 0.00e+00 1.61e-66 3.28e-57 0.5264
1. PBF Q68VQ4 DNA primase 7.12e-13 4.06e-59 2.11e-48 0.541
1. PBF Q89B09 DNA primase 2.22e-15 2.28e-50 3.70e-51 0.5756
1. PBF P0A118 DNA primase 4.49e-13 3.61e-49 2.15e-59 0.5764
1. PBF P63963 DNA primase 3.11e-15 1.14e-51 1.26e-40 0.5099
1. PBF P56064 DNA primase 1.39e-14 3.47e-63 2.08e-58 0.5523
1. PBF O83505 DNA primase 5.55e-16 2.85e-61 3.01e-41 0.527
1. PBF Q8NWB7 DNA primase 1.33e-15 3.09e-66 2.28e-70 0.5204
3. BF Q6L1F0 DNA primase DnaG 7.20e-03 NA 0.004 0.4195
3. BF Q9HLX7 DNA primase DnaG 1.69e-02 NA 0.027 0.32
3. BF A2SQD1 DNA primase DnaG 5.94e-02 NA 0.009 0.3866
4. PB P0ABS5 DNA primase 2.83e-12 7.71e-50 1.97e-57 NA
4. PB P9WNW1 DNA primase 6.77e-15 1.14e-51 1.26e-40 NA
6. F O31904 SPbeta prophage-derived uncharacterized protein YorJ 2.23e-08 NA NA 0.4145
6. F Q5JH14 DNA primase DnaG 1.14e-02 NA NA 0.2909
6. F B6YSY6 DNA primase DnaG 2.61e-02 NA NA 0.3667
6. F Q5ZIW1 Twinkle mtDNA helicase 1.35e-03 NA NA 0.4348
6. F P75099 Uncharacterized protein MG010 homolog 6.13e-10 NA NA 0.7894
6. F P47256 Uncharacterized protein MG010 1.10e-09 NA NA 0.7275
6. F Q9RMV7 Uncharacterized protein pXO2-78/BXB0107/GBAA_pXO2_0107 5.28e-04 NA NA 0.3291
7. B Q05271 Gene 58 protein NA NA 7.97e-05 NA
7. B Q97CE5 DNA primase DnaG 2.89e-03 NA 0.018 NA
7. B A6UV02 DNA primase DnaG 5.77e-03 NA 0.045 NA
7. B O64249 Gene 58 protein NA NA 6.83e-05 NA