Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54771.1
JCVISYN3A_0407

RNA polymerase subunit sigma.
M. mycoides homolog: Q6MTE2.
TIGRfam Classification: 4=Probable.
Category: Essential.

Statistics

Total GO Annotation: 46
Unique PROST Go: 1
Unique BLAST Go: 8
Unique Foldseek Go: 0

Total Homologs: 162
Unique PROST Homologs: 0
Unique BLAST Homologs: 7
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: rpoD; RNA polymerase sigma factor
Zhang et al. [4]: GO:0016987|sigma factor activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q5HNY7 (RNA polymerase sigma factor SigA) with a FATCAT P-Value: 0 and RMSD of 2.19 angstrom. The sequence alignment identity is 37.4%.
Structural alignment shown in left. Query protein AVX54771.1 colored as red in alignment, homolog Q5HNY7 colored as blue. Query protein AVX54771.1 is also shown in right top, homolog Q5HNY7 showed in right bottom. They are colored based on secondary structures.

  AVX54771.1 MAKFNNKSELKKIASFNDFLDYTVSFANKNNNEISSEDVLEVFANIFPNASDNESEKILDVLQQKGIVFSD--LIDDDIEQEELEEVEEEIEDVNLEEL- 97
      Q5HNY7 -------------------------------------------------MSDNQ-VKI-----KKQTI--DPTLTLEDVKKQLIDKGKKE-GHLSHEEIA 42

  AVX54771.1 EELENLE-DLDDLD--FD-L---DST-SNNLD--DYDENVN-DDLDEFKEAKSAAIKGRKSAKSSNHMKYRVGGISNETKIQDIIKTYFYKIGQAPILTK 186
      Q5HNY7 EKLQNFEMDSDQMDDFFDQLNDNDITLVNEKDSSDTDDKINPNDL---------------SAPP---------GV----KINDPVRMYLKEIGRVNLLSA 114

  AVX54771.1 EQEIIYAKMAVSDDPEDVQEGRNKLIESNLKLVISVARKHLNRGLDFADLIEEGNIGLMKAVDKFEYEKGFKFSTYATWWIRQAITRAIADQARTIRIPV 286
      Q5HNY7 QEEIELAKRIEQGD--EI--AKSRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFSKGFKFSTYATWWIRQAITRAIADQARTIRIPV 210

  AVX54771.1 HMVETINKLARVERQLTQELGREPNADEIANRVGE--GITGDKVIEIKKLSIEPVSLEKPFGDEDDTHFGDFVEDKDMVSPNEYTEKEILKEVMDKVFED 384
      Q5HNY7 HMVETINKLIRVQRQLLQDLGRDPAPEEI----GEEMDLPPEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLDT 306

  AVX54771.1 MPPREEKVIRMRYGIVPTRLRTLLRLAQECNDSNAKELKQAIEELDIHLDTPIEKVRKFNNQIINNNLAKYDSARTLEEVGKELNVTRERIRQIEAKTIR 484
      Q5HNY7 LTDREENVLRLRFG------------------------------LD---DG-----R----------------TRTLEEVGKVFGVTRERIRQIEAKALR 352

  AVX54771.1 KLKQPSPNNKSGKTLKEFYKGY 506
      Q5HNY7 KLRHPS---RS-KRLKDFMD-- 368

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0016987 sigma factor activity
1. PBF GO:0001108 bacterial-type RNA polymerase holo enzyme binding
1. PBF GO:0003677 DNA binding
1. PBF GO:1900233 positive regulation of single-species biofilm formation on inanimate substrate
1. PBF GO:1901000 regulation of response to salt stress
1. PBF GO:1900377 negative regulation of secondary metabolite biosynthetic process
1. PBF GO:0001123
1. PBF GO:0005737 cytoplasm
1. PBF GO:2000145 regulation of cell motility
1. PBF GO:0006352 DNA-templated transcription, initiation
1. PBF GO:0009408 response to heat
1. PBF GO:1900407 regulation of cellular response to oxidative stress
1. PBF GO:1900034 regulation of cellular response to heat
2. PF GO:0050921 positive regulation of chemotaxis
3. BF GO:0030436 asexual sporulation
3. BF GO:0043620 regulation of DNA-templated transcription in response to stress
3. BF GO:0071978 bacterial-type flagellum-dependent swarming motility
3. BF GO:0003899 DNA-directed 5'-3' RNA polymerase activity
3. BF GO:0030435 sporulation resulting in formation of a cellular spore
3. BF GO:0006355 regulation of transcription, DNA-templated
4. PB GO:0010114 response to red light
4. PB GO:0043175 RNA polymerase core enzyme binding
4. PB GO:0009658 chloroplast organization
4. PB GO:0010218 response to far red light
4. PB GO:0009415 response to water
4. PB GO:0071483 cellular response to blue light
4. PB GO:0071482 cellular response to light stimulus
4. PB GO:2001141 regulation of RNA biosynthetic process
4. PB GO:0010207 photosystem II assembly
4. PB GO:0090351 seedling development
4. PB GO:0071461 cellular response to redox state
4. PB GO:0080005 photosystem stoichiometry adjustment
4. PB GO:0001000 bacterial-type RNA polymerase core enzyme binding
4. PB GO:0009410 response to xenobiotic stimulus
4. PB GO:0006399 tRNA metabolic process
4. PB GO:0071472 cellular response to salt stress
4. PB GO:0009553 embryo sac development
5. P GO:0009507 chloroplast
7. B GO:0042800 histone methyltransferase activity (H3-K4 specific)
7. B GO:0034059 response to anoxia
7. B GO:0001121
7. B GO:0031421 invertasome
7. B GO:0009009 site-specific recombinase activity
7. B GO:0097692 histone H3-K4 monomethylation
7. B GO:0044666 MLL3/4 complex
7. B GO:0000985

Uniprot GO Annotations

GO Description
GO:0016987 sigma factor activity
GO:0003677 DNA binding
GO:2000142 regulation of DNA-templated transcription, initiation
GO:0003700 DNA-binding transcription factor activity
GO:0006352 DNA-templated transcription, initiation
GO:0006355 regulation of transcription, DNA-templated

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P0A4J0 RNA polymerase sigma factor SigA 3.33e-16 1.65e-33 4.57e-93 0.7289
1. PBF Q6GGD8 RNA polymerase sigma factor SigA 2.70e-14 2.05e-33 2.32e-88 0.7053
1. PBF P52327 RNA polymerase sigma factor RpoD 6.20e-07 3.20e-03 8.14e-81 0.4921
1. PBF P27785 RNA polymerase sigma factor SigA 0.00e+00 2.70e-09 1.18e-71 0.8221
1. PBF P0A2E6 RNA polymerase sigma factor RpoS 1.73e-13 1.71e-17 4.24e-58 0.7889
1. PBF P33118 RNA polymerase sigma factor SigB 0.00e+00 1.10e-14 1.23e-61 0.7783
1. PBF Q89B10 RNA polymerase sigma factor RpoD 1.68e-07 7.97e-05 6.94e-80 0.471
1. PBF P37970 RNA polymerase sigma-F factor 2.50e-07 1.23e-04 6.51e-13 0.5586
1. PBF P59117 RNA polymerase sigma factor RpoD 9.87e-07 3.55e-05 3.40e-70 0.5259
1. PBF O24744 RNA polymerase sigma factor RpoD 2.11e-08 4.00e-04 2.57e-80 0.4611
1. PBF P52328 RNA polymerase sigma factor SigA 1.05e-09 2.02e-38 9.52e-91 0.6787
1. PBF P77951 RNA polymerase sigma factor SigA 4.05e-14 3.53e-12 5.80e-78 0.6321
1. PBF Q2K619 RNA polymerase sigma factor RpoD 1.11e-06 2.68e-03 2.00e-81 0.7649
1. PBF Q31QR8 RNA polymerase sigma factor SigA4 2.65e-14 4.09e-06 1.77e-46 0.7911
1. PBF P18182 RNA polymerase principal sigma factor HrdA 0.00e+00 1.90e-24 3.54e-69 0.6607
1. PBF Q68VQ5 RNA polymerase sigma factor RpoD 4.16e-08 1.26e-06 1.23e-79 0.767
1. PBF Q31QG5 RNA polymerase sigma factor SigA3 0.00e+00 9.18e-08 5.39e-59 0.7904
1. PBF P35540 RNA polymerase sigma factor RpoS 2.48e-13 9.64e-17 4.77e-58 0.7571
1. PBF Q03066 RNA polymerase sigma-C factor 1.41e-07 1.29e-28 2.08e-49 0.5877
1. PBF P45684 RNA polymerase sigma factor RpoS 2.07e-12 5.33e-19 3.25e-59 0.729
1. PBF Q8CP24 RNA polymerase sigma factor SigA 0.00e+00 5.90e-33 2.19e-87 0.7012
1. PBF Q5HFJ9 RNA polymerase sigma factor SigA 1.14e-13 2.05e-33 2.32e-88 0.6829
1. PBF F5ZTT9 RNA polymerase sigma factor RpoS 1.93e-12 1.71e-17 4.24e-58 0.7448
1. PBF Q9Z7F0 RNA polymerase sigma factor SigA 2.86e-06 6.11e-11 2.46e-68 0.4624
1. PBF P57163 RNA polymerase sigma factor RpoD 1.39e-07 3.88e-05 3.41e-80 0.7462
1. PBF P42378 RNA polymerase sigma factor RpoH 3.71e-06 6.27e-03 3.26e-12 0.577
1. PBF P0A2E7 RNA polymerase sigma factor RpoS 2.33e-13 1.71e-17 4.24e-58 0.7448
1. PBF Q8PG33 RNA polymerase sigma factor RpoD 4.02e-07 1.23e-04 4.90e-81 0.7403
1. PBF Q59914 RNA polymerase principal sigma factor HrdD 1.10e-14 4.46e-18 7.36e-58 0.7624
1. PBF Q4UJT1 RNA polymerase sigma factor RpoD 2.51e-08 2.46e-07 1.33e-79 0.7681
1. PBF Q04506 RNA polymerase sigma factor SigA 0.00e+00 1.88e-33 1.88e-86 0.7001
1. PBF Q87DT7 RNA polymerase sigma factor RpoD 1.80e-06 2.14e-03 9.61e-81 0.7386
1. PBF Q1RKH7 RNA polymerase sigma factor RpoD 1.13e-07 6.16e-06 3.71e-79 0.4658
1. PBF Q9PDM9 RNA polymerase sigma factor RpoD 5.11e-08 2.79e-03 9.51e-81 0.7582
1. PBF P78022 RNA polymerase sigma factor SigA 5.97e-09 2.38e-20 4.38e-85 0.5702
1. PBF O66381 RNA polymerase sigma factor SigA 9.99e-16 1.64e-38 6.22e-93 0.6988
1. PBF Q9KI19 RNA polymerase sigma factor RpoS 2.44e-15 4.77e-18 3.28e-47 0.707
1. PBF P0A603 RNA polymerase sigma factor SigA 7.74e-12 1.32e-05 1.04e-72 0.561
1. PBF Q5HNY7 RNA polymerase sigma factor SigA 0.00e+00 5.90e-33 2.19e-87 0.6937
1. PBF P26480 RNA polymerase sigma factor RpoD 3.75e-08 3.06e-04 1.11e-83 0.7633
1. PBF P52322 RNA polymerase sigma factor SigA 4.24e-06 2.10e-29 4.58e-69 0.6225
1. PBF P18333 RNA polymerase sigma factor SigA 1.17e-07 1.85e-10 3.77e-68 0.4746
1. PBF P77994 RNA polymerase sigma factor SigA 3.00e-15 8.21e-34 6.85e-79 0.6744
1. PBF P0A2E3 RNA polymerase sigma factor RpoD 1.14e-07 6.89e-06 5.24e-81 0.4594
1. PBF O83506 RNA polymerase sigma factor RpoD 1.56e-07 8.23e-05 3.40e-75 0.4919
1. PBF Q60012 RNA polymerase principal sigma factor HrdD 4.11e-15 6.64e-17 4.89e-60 0.7486
1. PBF P52323 RNA polymerase sigma factor RpoD 1.08e-08 6.10e-05 3.18e-71 0.4743
1. PBF Q31ME3 RNA polymerase sigma factor SigA2 0.00e+00 4.11e-07 6.42e-57 0.7933
1. PBF Q9EZJ8 RNA polymerase sigma factor SigA 6.13e-09 1.89e-21 5.33e-77 0.5673
1. PBF P74565 RNA polymerase sigma factor SigA 3.64e-07 1.87e-30 1.66e-68 0.5832
1. PBF P06224 RNA polymerase sigma factor SigA 0.00e+00 1.88e-33 2.42e-92 0.6941
1. PBF P43766 RNA polymerase sigma factor RpoD 6.65e-08 1.47e-04 1.89e-86 0.4701
1. PBF O51804 RNA polymerase sigma factor RpoS 8.78e-13 1.88e-13 1.02e-59 0.7352
1. PBF Q99TT5 RNA polymerase sigma factor SigA 9.64e-14 6.05e-34 3.80e-88 0.6963
1. PBF P52326 RNA polymerase sigma factor RpoD 1.51e-08 1.88e-04 4.25e-82 0.7597
1. PBF Q59996 Probable RNA polymerase sigma-C factor 8.88e-06 1.28e-25 2.57e-53 0.6112
1. PBF Q03065 RNA polymerase sigma-B factor 1.71e-14 6.03e-10 1.50e-54 0.7205
1. PBF P58290 RNA polymerase sigma factor SigA (Fragment) 0.00e+00 3.32e-28 4.28e-86 0.7425
1. PBF P9WGI4 RNA polymerase sigma factor SigB 0.00e+00 6.24e-12 2.39e-63 0.786
1. PBF O33662 RNA polymerase sigma factor SigA 7.55e-15 1.39e-34 6.44e-91 0.7057
1. PBF P52325 RNA polymerase sigma factor RpoD 2.32e-07 1.49e-03 1.18e-80 0.4602
1. PBF P33451 RNA polymerase sigma factor RpoD 1.19e-07 2.62e-06 1.25e-79 0.4666
1. PBF P47765 RNA polymerase sigma factor RpoS 2.00e-15 3.48e-19 3.25e-58 0.7408
1. PBF P0A2E4 RNA polymerase sigma factor RpoD 1.21e-07 6.89e-06 5.24e-81 0.4671
1. PBF P38023 RNA polymerase sigma factor SigA1 7.62e-13 5.38e-28 2.01e-70 0.6686
1. PBF B1VXR4 RNA polymerase principal sigma factor HrdB 3.64e-11 3.53e-12 5.80e-78 0.528
1. PBF P47491 RNA polymerase sigma factor SigA 4.02e-09 8.27e-22 1.00e-82 0.5466
1. PBF P56835 RNA polymerase sigma factor SigA 2.80e-07 1.26e-10 1.31e-68 0.474
1. PBF P37971 RNA polymerase sigma-F factor 3.97e-07 1.32e-03 1.83e-13 0.6313
1. PBF P18183 RNA polymerase principal sigma factor HrdB 3.96e-10 7.61e-11 2.45e-78 0.6496
1. PBF P0A0I9 RNA polymerase sigma factor SigA 1.19e-14 2.05e-33 2.32e-88 0.6895
1. PBF Q6G905 RNA polymerase sigma factor SigA 1.11e-16 2.05e-33 2.32e-88 0.6928
1. PBF P52331 RNA polymerase sigma factor SigA 1.11e-15 4.06e-36 6.41e-90 0.6913
1. PBF P32001 RNA polymerase sigma factor RpoD 7.68e-09 3.65e-04 5.84e-81 0.4801
1. PBF P0A0I8 RNA polymerase sigma factor SigA 1.11e-16 2.05e-33 2.32e-88 0.6845
1. PBF P33452 RNA polymerase sigma factor RpoD 5.40e-06 7.51e-03 2.02e-81 0.7676
1. PBF P18249 RNA polymerase principal sigma factor HrdD 1.28e-14 2.94e-17 2.00e-62 0.7621
1. PBF P52324 RNA polymerase sigma factor RpoD 2.30e-08 7.37e-03 2.13e-82 0.7731
1. PBF P52329 RNA polymerase sigma factor SigA 1.69e-12 2.59e-36 3.01e-92 0.6438
1. PBF P0DM81 RNA polymerase sigma factor RpoS 4.09e-13 1.71e-17 4.24e-58 0.7472
1. PBF Q72L95 RNA polymerase sigma factor SigA 8.78e-09 2.26e-31 1.17e-73 0.6091
1. PBF P33656 RNA polymerase sigma factor SigA 4.24e-13 1.73e-32 2.11e-80 0.6809
1. PBF Q59753 RNA polymerase sigma factor RpoD 5.30e-06 1.49e-03 1.25e-81 0.4692
1. PBF P0A4I9 RNA polymerase sigma factor SigA 0.00e+00 1.65e-33 4.57e-93 0.713
1. PBF P9WGI0 RNA polymerase sigma factor SigA 1.32e-12 1.32e-05 1.04e-72 0.5571
1. PBF P61540 RNA polymerase sigma factor RpoD 2.65e-06 3.55e-05 3.40e-70 0.5184
1. PBF D0ZVL4 RNA polymerase sigma factor RpoS 4.06e-11 1.71e-17 4.24e-58 0.7419
1. PBF Q8P4H2 RNA polymerase sigma factor RpoD 2.20e-07 1.49e-04 5.98e-81 0.7491
1. PBF Q92BQ6 RNA polymerase sigma factor SigA 5.56e-14 1.65e-36 6.41e-90 0.6667
1. PBF Q92FZ8 RNA polymerase sigma factor RpoD 4.75e-08 4.42e-07 1.10e-79 0.4757
1. PBF P26683 RNA polymerase sigma factor SigA 4.94e-12 7.01e-33 2.23e-73 0.6807
1. PBF P18184 RNA polymerase principal sigma factor HrdC 0.00e+00 1.66e-19 8.22e-62 0.7725
3. BF Q9ZMY3 RNA polymerase sigma factor RpoD 2.40e-05 NA 1.40e-73 0.4598
3. BF P0CZ15 RNA polymerase sigma factor RpoD 1.36e-06 NA 1.23e-80 0.7557
3. BF P26768 Putative RNA polymerase sigma-G factor (Fragment) 1.21e-05 NA 4.82e-10 0.8247
3. BF P44404 RNA polymerase sigma factor RpoH 8.83e-07 NA 3.61e-17 0.6791
3. BF P17211 RNA polymerase sigma factor WhiG 1.47e-05 NA 5.04e-06 0.4397
3. BF P50511 RNA polymerase sigma factor RpoH 5.65e-07 NA 3.28e-13 0.6531
3. BF P0AEM7 RNA polymerase sigma factor FliA 6.62e-04 NA 2.79e-07 0.3052
3. BF P50509 RNA polymerase sigma factor RpoH 2.35e-06 NA 9.35e-15 0.6493
3. BF P10726 RNA polymerase sigma-D factor 3.90e-09 NA 0.019 0.4792
3. BF P62182 RNA polymerase sigma-28 factor 7.24e-06 NA 3.52e-08 0.5959
3. BF P50512 RNA polymerase sigma factor RpoH 3.48e-08 NA 6.26e-16 0.638
3. BF P11539 RNA polymerase sigma factor RpoH 2.23e-06 NA 1.15e-11 0.592
3. BF P19433 RNA polymerase sigma-B factor 1.28e-05 NA 6.30e-18 0.5143
3. BF P33657 RNA polymerase sigma-E factor 3.46e-05 NA 5.47e-08 0.5278
3. BF D5AQI9 RNA polymerase sigma factor RpoD 1.46e-06 NA 1.04e-81 0.7676
3. BF P33658 RNA polymerase sigma-G factor 1.18e-14 NA 1.11e-14 0.75
3. BF Q8DD54 RNA polymerase sigma factor RpoH 3.48e-06 NA 7.91e-13 0.6016
3. BF P0A2E9 RNA polymerase sigma factor FliA 4.72e-04 NA 1.26e-09 0.3187
3. BF P50507 RNA polymerase sigma factor RpoH 5.20e-08 NA 9.64e-15 0.638
3. BF Q8KA76 RNA polymerase sigma factor RpoH 2.01e-07 NA 3.09e-11 0.6666
3. BF P62178 RNA polymerase sigma-35 factor 1.13e-06 NA 6.17e-12 0.6638
3. BF P52621 RNA polymerase sigma factor FliA 7.62e-04 NA 1.99e-04 0.3107
3. BF P17869 RNA polymerase sigma-H factor 1.61e-05 NA 8.30e-04 0.4809
3. BF P17531 RNA polymerase sigma factor RpoD 1.78e-06 NA 3.74e-81 0.4681
3. BF P9WGI2 RNA polymerase sigma factor SigF 4.74e-07 NA 3.07e-13 0.6223
3. BF P62177 RNA polymerase sigma-35 factor 2.74e-06 NA 6.17e-12 0.4403
3. BF O05385 RNA polymerase sigma factor RpoH 4.28e-06 NA 1.27e-09 0.5981
3. BF P55993 RNA polymerase sigma factor RpoD 7.55e-09 NA 1.52e-73 0.4719
3. BF P0AGB4 RNA polymerase sigma factor RpoH 2.10e-06 NA 1.81e-11 0.6553
3. BF P06222 RNA polymerase sigma-E factor 4.62e-06 NA 1.06e-10 0.4909
3. BF P12254 RNA polymerase sigma-K factor 2.19e-05 NA 2.47e-08 0.4798
3. BF Q83BB6 RNA polymerase sigma factor RpoD 8.90e-06 NA 2.42e-78 0.4642
3. BF P35145 RNA polymerase sigma-F factor 5.11e-15 NA 1.33e-17 0.7921
3. BF P02964 RNA polymerase sigma-H factor 1.24e-04 NA 0.002 0.5039
3. BF P19940 RNA polymerase sigma-G factor 1.43e-14 NA 3.45e-15 0.7426
3. BF P26764 RNA polymerase sigma-F factor 4.50e-14 NA 2.64e-19 0.7784
3. BF P50510 RNA polymerase sigma factor RpoH 1.41e-08 NA 1.55e-11 0.6422
3. BF P62179 RNA polymerase sigma-35 factor 2.54e-06 NA 6.17e-12 0.6686
3. BF P0AEM8 RNA polymerase sigma factor FliA 1.03e-05 NA 2.79e-07 0.2864
3. BF P07860 RNA polymerase sigma-F factor 2.05e-10 NA 4.92e-20 0.6665
3. BF P62180 RNA polymerase sigma-28 factor 5.58e-06 NA 3.52e-08 0.4515
3. BF P06574 RNA polymerase sigma-B factor 4.58e-08 NA 1.49e-04 0.7942
3. BF P0CAW9 RNA polymerase sigma factor RpoH 3.42e-08 NA 1.44e-23 0.6868
3. BF B8H3C3 RNA polymerase sigma factor RpoH 3.12e-08 NA 1.44e-23 0.6889
3. BF Q07083 RNA polymerase sigma-C factor 7.18e-08 NA 3.69e-27 0.6011
3. BF Q89B27 RNA polymerase sigma factor RpoH 3.43e-06 NA 1.80e-10 0.4691
3. BF P62181 RNA polymerase sigma-28 factor 7.10e-05 NA 3.52e-08 0.4637
3. BF P50508 RNA polymerase sigma factor RpoH 1.77e-06 NA 5.79e-11 0.6393
3. BF P0AGB5 RNA polymerase sigma factor RpoH 4.27e-06 NA 1.81e-11 0.625
3. BF Q01624 RNA polymerase sigma-B factor 6.00e-09 NA 2.22e-22 0.7094
3. BF Q9K5J6 RNA polymerase sigma-B factor 1.37e-07 NA 2.05e-07 0.6409
3. BF P0A2E8 RNA polymerase sigma factor FliA 3.26e-04 NA 1.26e-09 0.3295
4. PB P00579 RNA polymerase sigma factor RpoD 2.35e-07 1.19e-05 8.13e-81 NA
4. PB P9WGI5 RNA polymerase sigma factor SigB 2.22e-16 6.24e-12 2.39e-63 NA
4. PB P9WGI1 RNA polymerase sigma factor SigA 1.47e-11 1.32e-05 1.04e-72 NA
4. PB Q9LD95 RNA polymerase sigma factor sigF, chloroplastic 1.44e-07 3.69e-07 1.37e-39 NA
4. PB Q0J7T6 RNA polymerase sigma factor sigA 3.09e-07 1.32e-06 1.36e-24 NA
4. PB O24629 RNA polymerase sigma factor sigA 1.08e-07 1.92e-08 1.46e-25 NA
4. PB P0A0J0 RNA polymerase sigma factor SigA 1.10e-14 2.05e-33 2.32e-88 NA
4. PB Q9ZNX9 RNA polymerase sigma factor sigE, chloroplastic/mitochondrial 3.27e-08 1.06e-05 2.79e-23 NA
4. PB O22056 RNA polymerase sigma factor sigB 2.02e-08 1.09e-02 3.65e-41 NA
4. PB P13445 RNA polymerase sigma factor RpoS 4.84e-13 1.35e-16 4.47e-58 NA
4. PB Q9ZSL6 RNA polymerase sigma factor sigD, chloroplastic 2.76e-11 2.15e-07 4.89e-33 NA
7. B P0AGB3 RNA polymerase sigma factor RpoH 1.92e-06 NA 1.81e-11 NA
7. B P43344 RNA polymerase sigma factor RpoD (Fragment) NA NA 5.60e-74 NA
7. B P0AEM6 RNA polymerase sigma factor FliA 1.16e-03 NA 2.79e-07 NA
7. B Q8NEZ4 Histone-lysine N-methyltransferase 2C NA NA 0.035 NA
7. B P9WGI3 RNA polymerase sigma factor SigF 6.87e-08 NA 3.07e-13 NA
7. B P29248 RNA polymerase sigma factor FliA 4.48e-05 NA 0.013 NA
7. B O24621 RNA polymerase sigma factor sigC 3.16e-06 NA 2.29e-26 NA