Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54772.1

JCVISYN3A_0408

Uncharacterized methyltransferase.
M. mycoides homolog: Q6MTE1.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 83
Unique PROST Go: 4
Unique BLAST Go: 0
Unique Foldseek Go: 72

Total Homologs: 1062
Unique PROST Homologs: 83
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 974

Literature

Danchin and Fang [1]: tRNA (adenine(22)-N(1))-methyltransferase|a methyl group at position N(1) prevents Watson-Crick-type base pairing by adenosine and is therefore important for regulation of structure and stability of tRNA molecules
Yang and Tsui [2]: tRNA (Adenine(22)-N(1))-methyltransferase
Antczak et al. [3]: trmK; tRNA (adenine(22)-N(1))-methyltransferase
Zhang et al. [4]: GO:0016429|tRNA (adenine-N1-)-methyltrans ferase activity
Bianchi et al. [5]: Ribosomal RNA methyltransferase - trmK-like - Similar PDB: 6QE6

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P54471 (tRNA (adenine(22)-N(1))-methyltransferase) with a FATCAT P-Value: 0 and RMSD of 2.09 angstrom. The sequence alignment identity is 31.2%.
Structural alignment shown in left. Query protein AVX54772.1 colored as red in alignment, homolog P54471 colored as blue. Query protein AVX54772.1 is also shown in right top, homolog P54471 showed in right bottom. They are colored based on secondary structures.

  AVX54772.1 ---M-LSFRLHQVAKLINNSTTIADIGTDHAYLPIYLVQNNKTKIAYACDINQKP-LKIALKNVEKFGLTDQIFTILSNGLEFVKNKEILNIDYVTICGL 95
      P54471 MNELKLSKRLQTVAEYIPNGAVMADIGSDHAYLPCYAVLNHKASGAIAGEITDGPFLS-AKRQVEKSGLNSHISVRQGDGLEVIKKGE---ADAITIAGM 96

  AVX54772.1 GSQTILEILK--NDHQKIS---NYIICSNTSVKNLRLWAVSHNY-LIKYESFIYEDD--HYYWLI-EI-NKNKFSD--HLEE--LEIEFGSKQFFNKNSL 181
      P54471 GGALIAHILEAGKD--KLTGKERLILQPNIHAVHIREWLYKERYALI--DEVILEEDGKCYEVLVAEAGDRDAAYDGISLSAGMLVGPFLAKE---KNAV 189

  AVX54772.1 YISYLENEISNLNKISNQI--------NPNNIKYLEIQNRINKIRKYIDVIR- 225
      P54471 FLKKWTQELQHTQSIYEQISQAADTEQNKQKLK--ELADRMELLKEVID--HG 238

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0016429	tRNA (adenine-N1-)-methyltransferase activity
1. PBF	GO:0005737	cytoplasm
2. PF	GO:0031167	rRNA methylation
2. PF	GO:0052908	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity
2. PF	GO:0003723	RNA binding
2. PF	GO:0000179	rRNA (adenine-N6,N6-)-dimethyltransferase activity
3. BF	GO:0030488	tRNA methylation
5. P	GO:0009052	pentose-phosphate shunt, non-oxidative branch
5. P	GO:0052910	23S rRNA (adenine(2085)-N(6))-dimethyltransferase activity
5. P	GO:0004751	ribose-5-phosphate isomerase activity
5. P	GO:0046677	response to antibiotic
6. F	GO:0003677	DNA binding
6. F	GO:0006744	ubiquinone biosynthetic process
6. F	GO:0035246	peptidyl-arginine N-methylation
6. F	GO:0043776	cobalt-precorrin-6B C5-methyltransferase activity
6. F	GO:0036009	protein-glutamine N-methyltransferase activity
6. F	GO:0003838	sterol 24-C-methyltransferase activity
6. F	GO:0006696	ergosterol biosynthetic process
6. F	GO:0005634	nucleus
6. F	GO:0008168	methyltransferase activity
6. F	GO:0046872	metal ion binding
6. F	GO:0009060	aerobic respiration
6. F	GO:0052916	23S rRNA (guanine(1835)-N(2))-methyltransferase activity
6. F	GO:0016273	arginine N-methyltransferase activity
6. F	GO:0070475	rRNA base methylation
6. F	GO:0052914	16S rRNA (guanine(1207)-N(2))-methyltransferase activity
6. F	GO:0002098	tRNA wobble uridine modification
6. F	GO:0052915	23S rRNA (guanine(2445)-N(2))-methyltransferase activity
6. F	GO:0018216	peptidyl-arginine methylation
6. F	GO:0044020	histone methyltransferase activity (H4-R3 specific)
6. F	GO:0043527	tRNA methyltransferase complex
6. F	GO:0006349	regulation of gene expression by genomic imprinting
6. F	GO:0032259	methylation
6. F	GO:0005506	iron ion binding
6. F	GO:0016430	tRNA (adenine-N6-)-methyltransferase activity
6. F	GO:0031515	tRNA (m1A) methyltransferase complex
6. F	GO:0035241	protein-arginine omega-N monomethyltransferase activity
6. F	GO:0008757	S-adenosylmethionine-dependent methyltransferase activity
6. F	GO:0008276	protein methyltransferase activity
6. F	GO:0000387	spliceosomal snRNP assembly
6. F	GO:0102955	S-adenosylmethionine:2-demethylmenaquinol-7 methyltransferase activity
6. F	GO:0008176	tRNA (guanine-N7-)-methyltransferase activity
6. F	GO:0018364	peptidyl-glutamine methylation
6. F	GO:0102094	S-adenosylmethionine:2-demethylmenaquinol methyltransferase activity
6. F	GO:0043333	2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity
6. F	GO:0005886	plasma membrane
6. F	GO:0009383	rRNA (cytosine-C5-)-methyltransferase activity
6. F	GO:0052729	dimethylglycine N-methyltransferase activity
6. F	GO:0017174	glycine N-methyltransferase activity
6. F	GO:0030410	nicotianamine synthase activity
6. F	GO:0070043	rRNA (guanine-N7-)-methyltransferase activity
6. F	GO:0043777	cobalt-precorrin-7 C15-methyltransferase activity
6. F	GO:0036265	RNA (guanine-N7)-methylation
6. F	GO:0000049	tRNA binding
6. F	GO:0052730	sarcosine N-methyltransferase activity
6. F	GO:0019286	glycine betaine biosynthetic process from glycine
6. F	GO:0003676	nucleic acid binding
6. F	GO:0008469	histone-arginine N-methyltransferase activity
6. F	GO:0051539	4 iron, 4 sulfur cluster binding
6. F	GO:0034969	histone arginine methylation
6. F	GO:0016021	integral component of membrane
6. F	GO:0006694	steroid biosynthetic process
6. F	GO:0043046	DNA methylation involved in gamete generation
6. F	GO:0043770	demethylmenaquinone methyltransferase activity
6. F	GO:0017000	antibiotic biosynthetic process
6. F	GO:0009234	menaquinone biosynthetic process
6. F	GO:0035243	protein-arginine omega-N symmetric methyltransferase activity
6. F	GO:0000287	magnesium ion binding
6. F	GO:0008169	C-methyltransferase activity
6. F	GO:0016277	[myelin basic protein]-arginine N-methyltransferase activity
6. F	GO:0102308	erythromycin D 3''-o-methyltransferase activity
6. F	GO:0016765	transferase activity, transferring alkyl or aryl (other than methyl) groups
6. F	GO:0009019	tRNA (guanine-N1-)-methyltransferase activity
6. F	GO:0102027	S-adenosylmethionine:2-demethylquinol-8 methyltransferase activity
6. F	GO:0102522	tRNA 4-demethylwyosine alpha-amino-alpha-carboxypropyltransferase activity
6. F	GO:0009007	site-specific DNA-methyltransferase (adenine-specific) activity
6. F	GO:0046140	corrin biosynthetic process
6. F	GO:0008649	rRNA methyltransferase activity
6. F	GO:0102559	protein-(glutamine-N5) methyltransferase activity
6. F	GO:0030418	nicotianamine biosynthetic process
6. F	GO:0042214	terpene metabolic process
6. F	GO:0102307	erythromycin C 3''-o-methyltransferase activity
6. F	GO:0070041	rRNA (uridine-C5-)-methyltransferase activity

Uniprot GO Annotations

GO	Description
GO:0016429	tRNA (adenine-N1-)-methyltransferase activity
GO:0030488	tRNA methylation

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	P47490	Putative tRNA methyltransferase MG248	6.66e-16	3.91e-59	2.68e-06	0.7688
1. PBF	P54471	tRNA (adenine(22)-N(1))-methyltransferase	0.00e+00	3.85e-57	4.71e-23	0.8737
1. PBF	P75427	Putative tRNA methyltransferase MPN_351	1.11e-16	7.01e-54	1.21e-08	0.8282
2. PF	Q5FH30	Ribosomal RNA small subunit methyltransferase A	3.34e-05	2.93e-02	NA	0.5176
2. PF	Q5HBC6	Ribosomal RNA small subunit methyltransferase A	2.93e-05	2.76e-02	NA	0.5096
5. P	O26833	Uncharacterized protein MTH_738	2.48e-03	1.21e-02	NA	NA
5. P	Q1QN95	Ribose-5-phosphate isomerase A	5.43e-02	3.94e-02	NA	NA
5. P	Q30NR7	Ribosomal RNA small subunit methyltransferase A	5.61e-04	1.63e-02	NA	NA
5. P	P13957	rRNA adenine N-6-methyltransferase	3.51e-05	3.94e-02	NA	NA
5. P	Q2K7M6	Ribose-5-phosphate isomerase A	4.74e-02	3.00e-02	NA	NA
5. P	B5ZRL6	Ribose-5-phosphate isomerase A	4.72e-02	3.48e-02	NA	NA
5. P	P39367	Uncharacterized protein YjhP	6.00e-08	2.66e-03	NA	NA
5. P	Q8EMZ1	Ribose-5-phosphate isomerase A 2	7.51e-02	1.73e-02	NA	NA
5. P	Q5NHI5	Ribosomal RNA small subunit methyltransferase A	2.23e-04	4.92e-02	NA	NA
5. P	B9JFX9	Ribose-5-phosphate isomerase A	5.48e-02	1.47e-02	NA	NA
5. P	A3CNA9	Ribose-5-phosphate isomerase A	5.19e-02	1.50e-02	NA	NA
5. P	Q7NPM5	Ribose-5-phosphate isomerase A	8.08e-02	5.06e-03	NA	NA
5. P	Q6AL71	Ribosomal RNA small subunit methyltransferase A	2.23e-04	2.72e-02	NA	NA
5. P	A8AXN9	Ribose-5-phosphate isomerase A	4.73e-02	2.03e-02	NA	NA
5. P	A1WD86	Ribosomal RNA small subunit methyltransferase A	6.84e-05	4.76e-02	NA	NA
5. P	B8NM78	Methyltransferase ustM	7.91e-06	7.88e-05	NA	NA
5. P	A5UXC5	Ribose-5-phosphate isomerase A	3.51e-02	3.32e-02	NA	NA
5. P	P0A4D6	rRNA adenine N-6-methyltransferase	6.13e-05	6.52e-03	NA	NA
5. P	B2UVG9	Ribosomal RNA small subunit methyltransferase A	4.39e-05	2.13e-02	NA	NA
5. P	A4SYB4	Ribose-5-phosphate isomerase A	5.64e-02	2.46e-02	NA	NA
5. P	P0A4D5	rRNA adenine N-6-methyltransferase	6.13e-05	6.52e-03	NA	NA
5. P	B8ZNH8	Ribose-5-phosphate isomerase A	5.11e-02	3.51e-02	NA	NA
5. P	B5E3K1	Ribose-5-phosphate isomerase A	4.95e-02	3.21e-02	NA	NA
5. P	Q5XCL6	Ribose-5-phosphate isomerase A	5.94e-02	1.59e-02	NA	NA
5. P	Q7VGZ3	Ribosomal RNA small subunit methyltransferase A	2.11e-04	2.75e-03	NA	NA
5. P	Q00014	rRNA adenine N-6-methyltransferase	4.58e-05	2.48e-02	NA	NA
5. P	Q8P1C5	Ribose-5-phosphate isomerase A	4.94e-02	3.23e-02	NA	NA
5. P	Q7NJ41	Ribosomal RNA small subunit methyltransferase A	3.99e-04	1.71e-02	NA	NA
5. P	Q0AR22	Ribose-5-phosphate isomerase A	4.62e-02	1.45e-02	NA	NA
5. P	Q48U18	Ribose-5-phosphate isomerase A	5.88e-02	2.79e-02	NA	NA
5. P	Q1JC89	Ribose-5-phosphate isomerase A	5.93e-02	2.05e-02	NA	NA
5. P	A9IJV4	Ribose-5-phosphate isomerase A	6.62e-02	3.85e-02	NA	NA
5. P	P13978	rRNA adenine N-6-methyltransferase	3.52e-05	3.72e-02	NA	NA
5. P	C1CS62	Ribose-5-phosphate isomerase A	5.17e-02	3.21e-02	NA	NA
5. P	Q47VJ8	Ribosomal RNA small subunit methyltransferase A	3.18e-04	4.53e-02	NA	NA
5. P	A6UTZ1	Probable ribosomal RNA small subunit methyltransferase A	1.90e-05	9.37e-03	NA	NA
5. P	C3MDE7	Ribose-5-phosphate isomerase A	4.41e-02	1.87e-02	NA	NA
5. P	C1C6G3	Ribose-5-phosphate isomerase A	5.08e-02	3.21e-02	NA	NA
5. P	Q0VMV2	Ribosomal RNA small subunit methyltransferase A	5.67e-05	4.57e-02	NA	NA
5. P	Q1JM73	Ribose-5-phosphate isomerase A	4.87e-02	2.05e-02	NA	NA
5. P	Q5HS85	Ribosomal RNA small subunit methyltransferase A	2.05e-04	2.65e-02	NA	NA
5. P	Q9V0L6	Ribose-5-phosphate isomerase A	4.80e-02	4.31e-02	NA	NA
5. P	Q14IY7	Ribosomal RNA small subunit methyltransferase A	2.15e-04	4.92e-02	NA	NA
5. P	Q9PLW7	Ribosomal RNA small subunit methyltransferase A	1.87e-04	2.13e-02	NA	NA
5. P	A2C1Z5	Ribosomal RNA small subunit methyltransferase A	1.01e-04	3.69e-02	NA	NA
5. P	Q1MFT6	Ribose-5-phosphate isomerase A	4.79e-02	3.88e-02	NA	NA
5. P	Q4FMR0	Ribosomal RNA small subunit methyltransferase A	6.89e-05	5.10e-03	NA	NA
5. P	Q7VA25	Ribose-5-phosphate isomerase A	2.33e-02	4.17e-02	NA	NA
5. P	P10738	rRNA adenine N-6-methyltransferase	5.43e-05	5.06e-03	NA	NA
5. P	B0T734	Ribose-5-phosphate isomerase A	1.21e-01	1.63e-02	NA	NA
5. P	B9JW57	Ribose-5-phosphate isomerase A	4.68e-02	1.70e-02	NA	NA
5. P	P13956	rRNA adenine N-6-methyltransferase	3.65e-05	3.05e-02	NA	NA
5. P	Q1CRJ9	Ribosomal RNA small subunit methyltransferase A	3.60e-05	3.32e-02	NA	NA
5. P	B5XL07	Ribose-5-phosphate isomerase A	2.26e-02	2.59e-02	NA	NA
5. P	Q1J737	Ribose-5-phosphate isomerase A	5.95e-02	2.59e-02	NA	NA
5. P	P21236	rRNA adenine N-6-methyltransferase	7.91e-05	5.38e-03	NA	NA
5. P	Q46L58	Ribosomal RNA small subunit methyltransferase A	1.24e-04	4.01e-02	NA	NA
5. P	C1CJR7	Ribose-5-phosphate isomerase A	4.95e-02	3.21e-02	NA	NA
5. P	Q98ML9	Ribose-5-phosphate isomerase A	5.63e-02	1.73e-02	NA	NA
5. P	Q8DJF2	Ribose-5-phosphate isomerase A	4.74e-02	4.84e-02	NA	NA
5. P	B1V9I5	Ribosomal RNA small subunit methyltransferase A	3.75e-04	7.49e-03	NA	NA
5. P	A2RF13	Ribose-5-phosphate isomerase A	5.92e-02	2.59e-02	NA	NA
5. P	Q92PB8	Ribose-5-phosphate isomerase A	2.73e-02	1.33e-03	NA	NA
5. P	A7NNA4	Ribose-5-phosphate isomerase A	3.14e-02	5.10e-03	NA	NA
5. P	O25972	Ribosomal RNA small subunit methyltransferase A	3.80e-05	3.00e-02	NA	NA
5. P	Q2SN31	Ribose-5-phosphate isomerase A	4.36e-02	1.42e-02	NA	NA
5. P	A7I417	Ribosomal RNA small subunit methyltransferase A	8.48e-05	3.91e-02	NA	NA
5. P	Q8DQD1	Ribose-5-phosphate isomerase A	5.17e-02	3.21e-02	NA	NA
5. P	Q21F87	Ribose-5-phosphate isomerase A	3.80e-02	4.39e-02	NA	NA
5. P	C5BMC8	Ribose-5-phosphate isomerase A	4.36e-02	1.31e-02	NA	NA
5. P	P06573	rRNA adenine N-6-methyltransferase	6.17e-05	6.80e-03	NA	NA
5. P	Q02607	rRNA adenine N-6-methyltransferase	7.02e-05	4.42e-02	NA	NA
5. P	Q58435	Probable ribosomal RNA small subunit methyltransferase A	9.76e-05	1.56e-02	NA	NA
5. P	Q04L82	Ribose-5-phosphate isomerase A	5.10e-02	3.21e-02	NA	NA
5. P	P06572	rRNA adenine N-6-methyltransferase	3.43e-05	2.54e-02	NA	NA
5. P	B1YEE3	Ribose-5-phosphate isomerase A	3.99e-02	1.65e-03	NA	NA
5. P	C1CDH6	Ribose-5-phosphate isomerase A	4.93e-02	3.51e-02	NA	NA
5. P	Q17ZF9	Ribosomal RNA small subunit methyltransferase A	5.54e-05	4.31e-02	NA	NA
5. P	Q9ZJI7	Ribosomal RNA small subunit methyltransferase A	3.96e-05	2.32e-02	NA	NA
5. P	Q0ACJ4	Ribose-5-phosphate isomerase A	3.37e-02	2.15e-02	NA	NA
5. P	P20173	rRNA adenine N-6-methyltransferase	6.04e-05	4.89e-03	NA	NA
5. P	P02979	rRNA adenine N-6-methyltransferase	3.37e-05	3.75e-02	NA	NA
5. P	Q1JHB8	Ribose-5-phosphate isomerase A	5.95e-02	2.90e-02	NA	NA
6. F	Q9CFX1	Ribosomal RNA small subunit methyltransferase G	2.82e-08	NA	NA	0.6833
6. F	Q088J8	Ribosomal protein L11 methyltransferase	1.43e-07	NA	NA	0.7373
6. F	Q83RX5	Ribosomal RNA large subunit methyltransferase K/L	6.21e-03	NA	NA	0.6213
6. F	B3QLQ8	Ribosomal protein L11 methyltransferase	6.41e-09	NA	NA	0.7582
6. F	A5HY34	Release factor glutamine methyltransferase	5.65e-09	NA	NA	0.6103
6. F	A0L9S5	Ribosomal RNA large subunit methyltransferase G	1.09e-06	NA	NA	0.6958
6. F	A8FSS4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.19e-07	NA	NA	0.7042
6. F	A1SAM0	Ribosomal protein L11 methyltransferase	1.72e-07	NA	NA	0.7403
6. F	A2RK93	Ribosomal RNA small subunit methyltransferase G	2.06e-08	NA	NA	0.6829
6. F	A0A1B4XBG9	Methyltransferase sdnD	4.76e-07	NA	NA	0.4957
6. F	Q13SP1	Ribosomal RNA small subunit methyltransferase G	2.42e-08	NA	NA	0.6416
6. F	B8ZTI4	tRNA (guanine-N(7)-)-methyltransferase	1.10e-04	NA	NA	0.4284
6. F	B7JN37	Ribosomal protein L11 methyltransferase	1.27e-10	NA	NA	0.7806
6. F	B0S3V0	Ribosomal RNA small subunit methyltransferase G	7.41e-09	NA	NA	0.7021
6. F	Q8DHH6	tRNA (guanine-N(7)-)-methyltransferase	7.45e-07	NA	NA	0.5596
6. F	Q87AE9	tRNA (guanine-N(7)-)-methyltransferase	7.39e-05	NA	NA	0.5487
6. F	A1SRS4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.17e-05	NA	NA	0.5074
6. F	B0VMY0	Ribosomal RNA small subunit methyltransferase G	6.95e-08	NA	NA	0.6755
6. F	Q2RXA9	Ribosomal RNA small subunit methyltransferase A	1.03e-04	NA	NA	0.4809
6. F	A2C4M0	Ribosomal RNA small subunit methyltransferase G	1.04e-07	NA	NA	0.7156
6. F	Q71ZJ9	Ribosomal protein L11 methyltransferase	1.75e-10	NA	NA	0.6901
6. F	Q8NLS3	tRNA (guanine-N(7)-)-methyltransferase	4.69e-04	NA	NA	0.5093
6. F	B6I4H5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.79e-05	NA	NA	0.4956
6. F	A1R4F7	Ribosomal RNA small subunit methyltransferase A	7.06e-05	NA	NA	0.6305
6. F	Q8DHV7	Release factor glutamine methyltransferase	5.02e-08	NA	NA	0.6187
6. F	Q8Y3N3	Ribosomal RNA small subunit methyltransferase G	1.08e-08	NA	NA	0.7004
6. F	O32036	tRNA 5-hydroxyuridine methyltransferase	2.78e-05	NA	NA	0.6388
6. F	Q5ZRH9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	5.07e-05	NA	NA	0.4877
6. F	Q88CS7	tRNA (guanine-N(7)-)-methyltransferase	1.21e-04	NA	NA	0.5387
6. F	B9DXR9	Ribosomal RNA small subunit methyltransferase G	4.76e-09	NA	NA	0.6723
6. F	B9J7S8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.07e-05	NA	NA	0.5545
6. F	Q3IY65	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	5.80e-05	NA	NA	0.5167
6. F	A1A2F7	Ribosomal RNA small subunit methyltransferase H	1.89e-03	NA	NA	0.7087
6. F	Q83WC3	Sarcosine/dimethylglycine N-methyltransferase	1.59e-07	NA	NA	0.4739
6. F	Q2A524	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.54e-05	NA	NA	0.5405
6. F	B5R1C6	Ribosomal protein L11 methyltransferase	7.18e-08	NA	NA	0.7443
6. F	Q88L39	Ribosomal RNA large subunit methyltransferase K/L	9.18e-03	NA	NA	0.5838
6. F	Q8FBJ0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.46e-05	NA	NA	0.496
6. F	Q3JYX9	Ribosomal protein L11 methyltransferase	2.21e-08	NA	NA	0.7237
6. F	Q9CNN7	50S ribosomal protein L3 glutamine methyltransferase	2.42e-06	NA	NA	0.5047
6. F	B5F7P3	Ribosomal protein L11 methyltransferase	7.19e-08	NA	NA	0.7441
6. F	Q8DDE5	Ribosomal RNA small subunit methyltransferase B	4.55e-06	NA	NA	0.6479
6. F	Q0RAP0	Ribosomal RNA small subunit methyltransferase G	5.10e-06	NA	NA	0.5919
6. F	Q1JDG1	Ribosomal RNA small subunit methyltransferase G	3.60e-08	NA	NA	0.649
6. F	B6EMU1	tRNA (guanine-N(7)-)-methyltransferase	4.04e-05	NA	NA	0.5298
6. F	A5GV37	Ribosomal protein L11 methyltransferase	4.86e-09	NA	NA	0.6777
6. F	Q92NN5	Ribosomal protein L11 methyltransferase	1.26e-09	NA	NA	0.6959
6. F	A4WNC5	Protein-L-isoaspartate O-methyltransferase	2.84e-06	NA	NA	0.7012
6. F	B7JIK9	Ribosomal RNA small subunit methyltransferase G	2.06e-08	NA	NA	0.7048
6. F	Q39IU7	tRNA (guanine-N(7)-)-methyltransferase	2.87e-04	NA	NA	0.5299
6. F	Q9ZKH1	tRNA U34 carboxymethyltransferase	8.08e-07	NA	NA	0.5292
6. F	A8AVJ7	Ribosomal RNA small subunit methyltransferase G	2.47e-08	NA	NA	0.6666
6. F	Q5WAG5	Ribosomal RNA small subunit methyltransferase G	8.38e-09	NA	NA	0.6638
6. F	B7I508	Ribosomal RNA small subunit methyltransferase G	8.72e-08	NA	NA	0.6775
6. F	B4S130	Ribosomal protein L11 methyltransferase	4.79e-08	NA	NA	0.6582
6. F	A6VLR7	tRNA (guanine-N(7)-)-methyltransferase	1.39e-04	NA	NA	0.574
6. F	C5A009	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.76e-05	NA	NA	0.4958
6. F	P0DJO9	Ribosomal protein L11 methyltransferase	1.76e-10	NA	NA	0.7324
6. F	C6DI77	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.63e-05	NA	NA	0.5145
6. F	B5ZWH3	Ribosomal protein L11 methyltransferase	1.09e-09	NA	NA	0.7164
6. F	Q606J9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.31e-05	NA	NA	0.517
6. F	Q8ZQ73	Ribosomal RNA large subunit methyltransferase K/L	8.27e-03	NA	NA	0.4893
6. F	Q87LI7	tRNA (guanine-N(7)-)-methyltransferase	6.58e-05	NA	NA	0.5056
6. F	A3QIE1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.60e-05	NA	NA	0.4958
6. F	Q3KJC5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.01e-05	NA	NA	0.5348
6. F	A1S8P4	Ribosomal RNA large subunit methyltransferase G	1.74e-03	NA	NA	0.6812
6. F	B8E6B6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.32e-05	NA	NA	0.5418
6. F	P72546	tRNA (guanine-N(7)-)-methyltransferase	7.30e-07	NA	NA	0.545
6. F	Q9JTA1	50S ribosomal protein L3 glutamine methyltransferase	2.69e-06	NA	NA	0.4966
6. F	Q730M3	Ribosomal protein L11 methyltransferase	1.19e-10	NA	NA	0.7658
6. F	F0NBH8	Protein-lysine N-methyltransferase	7.29e-11	NA	NA	0.6799
6. F	A6VUQ2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.68e-07	NA	NA	0.7156
6. F	A1KUF5	tRNA (guanine-N(7)-)-methyltransferase	6.82e-05	NA	NA	0.5604
6. F	Q57J85	Ribosomal protein L11 methyltransferase	6.80e-08	NA	NA	0.7448
6. F	B5BBL9	Ribosomal RNA large subunit methyltransferase K/L	6.55e-03	NA	NA	0.584
6. F	B6J641	Ribosomal RNA small subunit methyltransferase A	1.46e-05	NA	NA	0.5731
6. F	Q1MME0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.01e-05	NA	NA	0.5847
6. F	Q9Z439	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.79e-05	NA	NA	0.5071
6. F	A1UUE1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.13e-05	NA	NA	0.5335
6. F	P54460	Ribosomal protein L11 methyltransferase	1.53e-10	NA	NA	0.742
6. F	B1LM21	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.13e-05	NA	NA	0.4856
6. F	Q88PT7	Ribosomal RNA small subunit methyltransferase C	6.63e-07	NA	NA	0.6647
6. F	A0LXM6	tRNA1(Val) (adenine(37)-N6)-methyltransferase	5.96e-09	NA	NA	0.6383
6. F	B2J5Q6	Ribosomal RNA small subunit methyltransferase G	1.04e-07	NA	NA	0.6756
6. F	A5WFA2	Ribosomal RNA small subunit methyltransferase G	3.18e-07	NA	NA	0.6887
6. F	B8DD12	Ribosomal RNA small subunit methyltransferase G	1.05e-08	NA	NA	0.7088
6. F	Q7MVR7	Demethylmenaquinone methyltransferase	9.82e-06	NA	NA	0.5465
6. F	B6I1X9	Ribosomal protein L11 methyltransferase	6.82e-08	NA	NA	0.7283
6. F	Q0HQK1	Ribosomal protein L11 methyltransferase	1.35e-07	NA	NA	0.7224
6. F	B9IY79	Ribosomal protein L11 methyltransferase	1.11e-10	NA	NA	0.7661
6. F	A5WAD6	tRNA (guanine-N(7)-)-methyltransferase	1.19e-04	NA	NA	0.5383
6. F	Q3KFC5	Ribosomal RNA large subunit methyltransferase K/L	9.22e-03	NA	NA	0.5986
6. F	Q3JXU8	Ribosomal RNA small subunit methyltransferase G	7.36e-08	NA	NA	0.6504
6. F	A7GXS7	Carboxy-S-adenosyl-L-methionine synthase	7.49e-04	NA	NA	0.5137
6. F	Q87TH4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.83e-05	NA	NA	0.5336
6. F	Q3A6I7	tRNA (guanine-N(7)-)-methyltransferase	4.81e-05	NA	NA	0.5369
6. F	D3KYU3	Geranyl diphosphate 2-C-methyltransferase	6.58e-06	NA	NA	0.513
6. F	Q3JCB2	tRNA (guanine-N(7)-)-methyltransferase	1.29e-04	NA	NA	0.5153
6. F	A1JPV4	tRNA (guanine-N(7)-)-methyltransferase	9.50e-05	NA	NA	0.5373
6. F	Q9CLC2	tRNA (guanine-N(7)-)-methyltransferase	1.13e-04	NA	NA	0.5484
6. F	C3LRX0	tRNA (guanine-N(7)-)-methyltransferase	5.87e-05	NA	NA	0.5066
6. F	B8CI06	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.46e-05	NA	NA	0.5023
6. F	Q65UK6	Ribosomal RNA large subunit methyltransferase K/L	9.93e-03	NA	NA	0.6162
6. F	B7KJ88	Ribosomal protein L11 methyltransferase	1.32e-09	NA	NA	0.7632
6. F	B4SUN8	Ribosomal protein L11 methyltransferase	7.27e-08	NA	NA	0.7432
6. F	Q4ZUM1	Ribosomal RNA large subunit methyltransferase K/L	1.81e-02	NA	NA	0.5979
6. F	B5XJV1	Ribosomal RNA small subunit methyltransferase G	4.50e-08	NA	NA	0.662
6. F	Q0TCJ7	Ribosomal protein L11 methyltransferase	7.13e-08	NA	NA	0.7279
6. F	A1RHL0	tRNA (guanine-N(7)-)-methyltransferase	7.50e-05	NA	NA	0.5344
6. F	Q8EKU4	Ribosomal RNA small subunit methyltransferase G	9.69e-09	NA	NA	0.6619
6. F	A5CY44	Ribosomal RNA small subunit methyltransferase G	4.88e-08	NA	NA	0.7141
6. F	B1KPU0	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.84e-07	NA	NA	0.7035
6. F	Q57C92	Ribosomal protein L11 methyltransferase	3.84e-09	NA	NA	0.7201
6. F	B8E918	tRNA (guanine-N(7)-)-methyltransferase	7.38e-05	NA	NA	0.5493
6. F	Q6DDT5	Glutathione S-transferase C-terminal domain-containing protein	8.56e-03	NA	NA	0.6732
6. F	Q1D096	tRNA (guanine-N(7)-)-methyltransferase	2.49e-07	NA	NA	0.5512
6. F	Q89XT8	Release factor glutamine methyltransferase	3.92e-08	NA	NA	0.5732
6. F	A7ZK52	Ribosomal RNA large subunit methyltransferase K/L	7.62e-03	NA	NA	0.485
6. F	Q12S38	Ribosomal protein L11 methyltransferase	1.65e-07	NA	NA	0.7031
6. F	Q24MA0	Ribosomal RNA small subunit methyltransferase G	3.81e-08	NA	NA	0.726
6. F	Q9A838	Ribosomal protein L11 methyltransferase	3.79e-09	NA	NA	0.7317
6. F	Q89A46	tRNA (guanine-N(7)-)-methyltransferase	6.25e-05	NA	NA	0.4367
6. F	Q3AG54	Ribosomal RNA small subunit methyltransferase G	3.90e-08	NA	NA	0.7189
6. F	Q6ANR2	Ribosomal RNA small subunit methyltransferase G	1.29e-07	NA	NA	0.6752
6. F	Q8EKR0	Ribosomal RNA small subunit methyltransferase B	8.04e-06	NA	NA	0.6103
6. F	Q8DPH3	Ribosomal RNA small subunit methyltransferase G	2.64e-08	NA	NA	0.6477
6. F	A5FZ96	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.50e-04	NA	NA	0.5343
6. F	A4Y5X4	Ribosomal RNA large subunit methyltransferase K/L	8.86e-03	NA	NA	0.4843
6. F	Q9F1Y5	Geranyl diphosphate 2-C-methyltransferase	4.03e-06	NA	NA	0.5085
6. F	A1W0R3	tRNA (guanine-N(7)-)-methyltransferase	3.54e-03	NA	NA	0.498
6. F	Q8E3T0	Ribosomal RNA small subunit methyltransferase G	4.31e-08	NA	NA	0.6912
6. F	B8D875	tRNA (guanine-N(7)-)-methyltransferase	7.50e-05	NA	NA	0.5234
6. F	A0LLH7	Ribosomal RNA small subunit methyltransferase G 1	6.19e-07	NA	NA	0.6593
6. F	A7MLY2	tRNA (guanine-N(7)-)-methyltransferase	7.86e-05	NA	NA	0.5311
6. F	Q87SB8	tRNA1(Val) (adenine(37)-N6)-methyltransferase	2.14e-08	NA	NA	0.6215
6. F	B1IT47	tRNA (guanine-N(7)-)-methyltransferase	7.20e-05	NA	NA	0.4935
6. F	A5UJR5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	4.76e-10	NA	NA	0.6423
6. F	A8MG53	Ribosomal protein L11 methyltransferase	2.32e-09	NA	NA	0.7461
6. F	O87694	Cobalamin biosynthesis bifunctional protein CbiET	2.76e-07	NA	NA	0.6065
6. F	A7Z6V9	Ribosomal protein L11 methyltransferase	1.07e-10	NA	NA	0.7539
6. F	A4F7P5	Erythromycin 3''-O-methyltransferase	1.56e-06	NA	NA	0.714
6. F	B2IA21	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.74e-05	NA	NA	0.5154
6. F	A4TMZ0	Ribosomal RNA large subunit methyltransferase K/L	6.01e-03	NA	NA	0.5702
6. F	B7HPL1	Ribosomal protein L11 methyltransferase	1.09e-10	NA	NA	0.7665
6. F	A0KNV5	tRNA (guanine-N(7)-)-methyltransferase	7.53e-05	NA	NA	0.4669
6. F	B2SFA2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.61e-05	NA	NA	0.4962
6. F	Q7U8J1	Ribosomal RNA small subunit methyltransferase G	9.71e-08	NA	NA	0.7149
6. F	Q82S79	Ribosomal RNA small subunit methyltransferase G	2.55e-08	NA	NA	0.6402
6. F	Q72H89	Ribosomal RNA small subunit methyltransferase G	1.44e-07	NA	NA	0.6964
6. F	Q8U248	tRNA (guanine(6)-N2)-methyltransferase	2.74e-08	NA	NA	0.6927
6. F	A9N6Y0	Ribosomal RNA large subunit methyltransferase K/L	8.24e-03	NA	NA	0.5839
6. F	A3PFL1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	5.58e-05	NA	NA	0.523
6. F	Q8UIH5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.16e-05	NA	NA	0.5387
6. F	Q5PGE3	Ribosomal RNA large subunit methyltransferase K/L	8.19e-03	NA	NA	0.4888
6. F	Q6ADP1	Ribosomal RNA small subunit methyltransferase A	6.82e-06	NA	NA	0.5662
6. F	B7VJ58	tRNA1(Val) (adenine(37)-N6)-methyltransferase	2.12e-08	NA	NA	0.653
6. F	Q3JZQ7	Ribosomal RNA small subunit methyltransferase G	2.92e-08	NA	NA	0.7108
6. F	Q608G0	tRNA (guanine-N(7)-)-methyltransferase	9.34e-05	NA	NA	0.639
6. F	A3D7B5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.26e-07	NA	NA	0.7098
6. F	Q8EJR7	Ribosomal protein L11 methyltransferase	1.24e-07	NA	NA	0.7397
6. F	B1KR07	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.54e-05	NA	NA	0.4998
6. F	Q1ICL2	Ribosomal RNA large subunit methyltransferase K/L	8.80e-03	NA	NA	0.5707
6. F	Q727D9	Release factor glutamine methyltransferase	1.48e-06	NA	NA	0.571
6. F	P9WFZ0	tRNA (adenine(58)-N(1))-methyltransferase TrmI	4.50e-07	NA	NA	0.6079
6. F	Q65V70	Ribosomal protein L11 methyltransferase	5.62e-08	NA	NA	0.6794
6. F	B5FCP7	tRNA U34 carboxymethyltransferase	7.19e-07	NA	NA	0.5141
6. F	Q8FE22	tRNA (guanine-N(7)-)-methyltransferase	7.25e-05	NA	NA	0.4938
6. F	B7NLI5	Ribosomal protein L11 methyltransferase	7.17e-08	NA	NA	0.7286
6. F	A5G9V1	Ribosomal RNA small subunit methyltransferase G	1.81e-08	NA	NA	0.6686
6. F	Q3M6A1	Ribosomal RNA small subunit methyltransferase G	1.33e-07	NA	NA	0.638
6. F	A4TR39	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.26e-05	NA	NA	0.4964
6. F	Q8A1D7	Release factor glutamine methyltransferase	8.70e-08	NA	NA	0.6048
6. F	Q58D65	tRNA wybutosine-synthesizing protein 2 homolog	3.70e-03	NA	NA	0.5217
6. F	B8I303	Ribosomal protein L11 methyltransferase	2.51e-09	NA	NA	0.7426
6. F	Q2JJQ0	tRNA (guanine-N(7)-)-methyltransferase	2.51e-06	NA	NA	0.5311
6. F	B7IC17	Ribosomal protein L11 methyltransferase	6.61e-08	NA	NA	0.7101
6. F	Q31DJ1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	5.83e-07	NA	NA	0.6404
6. F	B0TAD9	Ribosomal protein L11 methyltransferase	1.75e-10	NA	NA	0.7182
6. F	A2BY60	Ribosomal protein L11 methyltransferase	2.08e-09	NA	NA	0.7386
6. F	Q9JU19	tRNA (guanine-N(7)-)-methyltransferase	8.54e-05	NA	NA	0.5377
6. F	A7ZR85	tRNA (guanine-N(7)-)-methyltransferase	6.94e-05	NA	NA	0.4934
6. F	A5N449	Ribosomal RNA small subunit methyltransferase G	3.91e-09	NA	NA	0.6776
6. F	C3K8U4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.23e-05	NA	NA	0.5073
6. F	A6T742	Ribosomal RNA large subunit methyltransferase K/L	6.43e-03	NA	NA	0.6181
6. F	P59718	tRNA (guanine-N(7)-)-methyltransferase	1.67e-06	NA	NA	0.5218
6. F	A4J7F1	Ribosomal protein L11 methyltransferase	1.45e-10	NA	NA	0.7533
6. F	C3MCY6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.08e-05	NA	NA	0.5272
6. F	Q2NWP9	Ribosomal protein L11 methyltransferase	9.78e-08	NA	NA	0.7405
6. F	Q8YVT3	Ribosomal protein L11 methyltransferase	4.31e-09	NA	NA	0.6763
6. F	Q1J4K0	Ribosomal protein L11 methyltransferase	1.63e-08	NA	NA	0.7452
6. F	A8H3Y1	Ribosomal RNA large subunit methyltransferase K/L	8.16e-03	NA	NA	0.6321
6. F	Q0ATU7	Ribosomal RNA small subunit methyltransferase G	1.36e-07	NA	NA	0.6456
6. F	Q73TS5	tRNA (guanine-N(7)-)-methyltransferase	3.09e-04	NA	NA	0.448
6. F	Q4K4C6	tRNA (guanine-N(7)-)-methyltransferase	1.27e-04	NA	NA	0.5675
6. F	Q0S679	tRNA (guanine-N(7)-)-methyltransferase	5.49e-04	NA	NA	0.4968
6. F	A2C6U2	Ribosomal RNA small subunit methyltransferase G	5.93e-08	NA	NA	0.7128
6. F	Q5F783	50S ribosomal protein L3 glutamine methyltransferase	2.53e-06	NA	NA	0.5147
6. F	A9MHU0	Ribosomal RNA large subunit methyltransferase K/L	8.66e-03	NA	NA	0.4807
6. F	Q99MI9	Protein arginine N-methyltransferase 7	5.30e-02	NA	NA	0.5103
6. F	A7MQL7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.04e-05	NA	NA	0.4897
6. F	B3PH48	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.07e-05	NA	NA	0.5349
6. F	B0K8H7	Ribosomal RNA small subunit methyltransferase G	2.04e-08	NA	NA	0.679
6. F	Q63PG9	Ribosomal RNA small subunit methyltransferase G	6.32e-08	NA	NA	0.6497
6. F	B5ZYK8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.06e-05	NA	NA	0.5504
6. F	Q582G4	Protein arginine N-methyltransferase 7	1.26e-02	NA	NA	0.6562
6. F	P44402	Ribosomal protein L11 methyltransferase	7.95e-08	NA	NA	0.6815
6. F	Q81LS4	Ribosomal protein L11 methyltransferase	1.11e-10	NA	NA	0.7652
6. F	B9JXT0	Ribosomal protein L11 methyltransferase	6.43e-09	NA	NA	0.6961
6. F	Q6MBP0	tRNA (guanine-N(7)-)-methyltransferase	5.60e-07	NA	NA	0.6246
6. F	Q8P558	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.06e-05	NA	NA	0.5204
6. F	A4VTE0	Ribosomal RNA small subunit methyltransferase G	3.34e-08	NA	NA	0.6679
6. F	B8FBE9	Ribosomal protein L11 methyltransferase	9.15e-11	NA	NA	0.7097
6. F	Q0TDP1	tRNA (guanine-N(7)-)-methyltransferase	6.39e-05	NA	NA	0.4932
6. F	B1XKZ0	Ribosomal protein L11 methyltransferase	1.16e-09	NA	NA	0.7333
6. F	B5REY1	Ribosomal protein L11 methyltransferase	6.88e-08	NA	NA	0.7439
6. F	B0CHK5	Ribosomal protein L11 methyltransferase	3.44e-09	NA	NA	0.7098
6. F	Q29LT4	Glutathione S-transferase C-terminal domain-containing protein homolog	1.29e-02	NA	NA	0.6492
6. F	P0A888	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.28e-05	NA	NA	0.4936
6. F	Q8FJ88	Ribosomal RNA large subunit methyltransferase K/L	6.26e-03	NA	NA	0.6213
6. F	B0V7H8	Ribosomal protein L11 methyltransferase	6.54e-08	NA	NA	0.7408
6. F	Q75FL1	Demethylmenaquinone methyltransferase	3.00e-04	NA	NA	0.5063
6. F	Q5PJW5	Ribosomal protein L11 methyltransferase	7.25e-08	NA	NA	0.744
6. F	Q66B88	Carboxy-S-adenosyl-L-methionine synthase 1	8.17e-05	NA	NA	0.4701
6. F	Q2NRB6	tRNA (guanine-N(7)-)-methyltransferase	8.32e-05	NA	NA	0.5224
6. F	Q3JCY2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.23e-07	NA	NA	0.7197
6. F	Q3IJV7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.95e-05	NA	NA	0.5325
6. F	Q8RI89	Ribosomal RNA small subunit methyltransferase G	1.59e-07	NA	NA	0.725
6. F	Q6LLY5	Ribosomal protein L11 methyltransferase	9.27e-08	NA	NA	0.6921
6. F	Q9X027	tRNA (guanine-N(7)-)-methyltransferase	1.42e-04	NA	NA	0.5553
6. F	P60094	Ribosomal protein L11 methyltransferase	1.52e-07	NA	NA	0.7011
6. F	Q5NEL0	50S ribosomal protein L3 glutamine methyltransferase	6.53e-04	NA	NA	0.5268
6. F	C3LQP9	Ribosomal protein L11 methyltransferase	8.53e-08	NA	NA	0.7015
6. F	Q8EBX8	tRNA (guanine-N(7)-)-methyltransferase	7.86e-05	NA	NA	0.5392
6. F	A4TI61	tRNA (guanine-N(7)-)-methyltransferase	7.21e-05	NA	NA	0.5791
6. F	D9N1A1	Highly reducing polyketide synthase ACTTS3	6.91e-01	NA	NA	0.5525
6. F	C6Y2G0	tRNA1(Val) (adenine(37)-N6)-methyltransferase	1.66e-08	NA	NA	0.5664
6. F	Q9RTS6	tRNA (guanine-N(7)-)-methyltransferase	3.30e-04	NA	NA	0.4257
6. F	Q74LY0	Demethylmenaquinone methyltransferase	2.70e-04	NA	NA	0.585
6. F	Q1J8D8	Ribosomal RNA small subunit methyltransferase G	3.56e-08	NA	NA	0.6495
6. F	B2VG41	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.96e-05	NA	NA	0.4971
6. F	Q2RWE0	Release factor glutamine methyltransferase	4.00e-08	NA	NA	0.5808
6. F	Q2GGH6	Ribosomal RNA small subunit methyltransferase A	3.36e-05	NA	NA	0.4998
6. F	A9WGI4	Ribosomal RNA small subunit methyltransferase G	2.61e-08	NA	NA	0.6509
6. F	Q9RXR2	Release factor glutamine methyltransferase	9.51e-08	NA	NA	0.5753
6. F	B4EWC9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.93e-05	NA	NA	0.5253
6. F	A9WVP1	Ribosomal RNA small subunit methyltransferase G	8.00e-08	NA	NA	0.6087
6. F	Q4QNK0	tRNA (guanine-N(7)-)-methyltransferase	7.56e-05	NA	NA	0.5519
6. F	B5FC65	Ribosomal protein L11 methyltransferase	9.77e-08	NA	NA	0.6958
6. F	Q1IGD2	tRNA (guanine-N(7)-)-methyltransferase	1.25e-04	NA	NA	0.5479
6. F	A1SNN2	tRNA (guanine-N(7)-)-methyltransferase	2.51e-04	NA	NA	0.4323
6. F	Q17Y58	tRNA U34 carboxymethyltransferase	9.99e-07	NA	NA	0.5334
6. F	Q1CNB4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.21e-05	NA	NA	0.4661
6. F	Q83AC2	Ribosomal RNA small subunit methyltransferase A	1.20e-05	NA	NA	0.5578
6. F	P25813	Ribosomal RNA small subunit methyltransferase G	8.89e-09	NA	NA	0.7183
6. F	B0KNH3	Ribosomal RNA small subunit methyltransferase C	6.33e-07	NA	NA	0.6487
6. F	Q8YI53	Ribosomal protein L11 methyltransferase	3.77e-09	NA	NA	0.7093
6. F	C1ER75	Ribosomal RNA small subunit methyltransferase G	1.65e-08	NA	NA	0.7057
6. F	H2E7U0	Sterol methyltransferase-like 3	7.91e-06	NA	NA	0.4503
6. F	B4E582	Ribosomal RNA small subunit methyltransferase G	4.67e-08	NA	NA	0.6908
6. F	Q9KJ20	Glycine/sarcosine/dimethylglycine N-methyltransferase	1.16e-04	NA	NA	0.4496
6. F	P0A293	50S ribosomal protein L3 glutamine methyltransferase	1.92e-06	NA	NA	0.5031
6. F	P73820	Ribosomal protein L11 methyltransferase	2.34e-09	NA	NA	0.7296
6. F	B4STS7	tRNA (guanine-N(7)-)-methyltransferase	6.92e-05	NA	NA	0.6281
6. F	Q5X0X6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.65e-05	NA	NA	0.4931
6. F	A3KI18	Geranyl diphosphate 2-C-methyltransferase	5.67e-06	NA	NA	0.5134
6. F	Q14IC3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.53e-07	NA	NA	0.7197
6. F	Q6G1I2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.06e-05	NA	NA	0.5195
6. F	Q8G4R0	Ribosomal RNA small subunit methyltransferase H	2.81e-03	NA	NA	0.7049
6. F	Q7VPN5	Ribosomal protein L11 methyltransferase	6.24e-08	NA	NA	0.7393
6. F	A7NAY4	tRNA (guanine-N(7)-)-methyltransferase	4.81e-05	NA	NA	0.5582
6. F	B0VCZ6	Ribosomal RNA small subunit methyltransferase G	1.02e-07	NA	NA	0.6878
6. F	Q6F9W7	Ribosomal RNA small subunit methyltransferase G	1.26e-07	NA	NA	0.6715
6. F	Q6A5B2	Ribosomal RNA small subunit methyltransferase G	1.29e-07	NA	NA	0.6658
6. F	A3DHY6	Ribosomal RNA small subunit methyltransferase G	6.39e-08	NA	NA	0.7389
6. F	B1YQK3	Ribosomal RNA small subunit methyltransferase G	6.63e-08	NA	NA	0.6788
6. F	A2S6K9	Ribosomal RNA small subunit methyltransferase G	7.13e-08	NA	NA	0.6785
6. F	Q1BR98	Ribosomal RNA small subunit methyltransferase G	5.18e-08	NA	NA	0.6713
6. F	Q07Z53	tRNA (guanine-N(7)-)-methyltransferase	9.73e-05	NA	NA	0.4709
6. F	B0TUD3	tRNA1(Val) (adenine(37)-N6)-methyltransferase	6.10e-09	NA	NA	0.6381
6. F	Q9JYC0	50S ribosomal protein L3 glutamine methyltransferase	2.65e-06	NA	NA	0.5154
6. F	B1L800	Ribosomal RNA small subunit methyltransferase G	1.37e-07	NA	NA	0.6496
6. F	Q2S0V8	Release factor glutamine methyltransferase	1.17e-06	NA	NA	0.5118
6. F	Q6PCI6	Protein arginine N-methyltransferase 7	5.62e-02	NA	NA	0.4864
6. F	P0A8T2	Ribosomal protein L11 methyltransferase	7.28e-08	NA	NA	0.7281
6. F	B5YFF7	Ribosomal RNA small subunit methyltransferase G	4.99e-09	NA	NA	0.6369
6. F	Q8EBQ3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.18e-07	NA	NA	0.7062
6. F	Q62HT7	tRNA (guanine-N(7)-)-methyltransferase	2.53e-04	NA	NA	0.5538
6. F	B8DE40	Ribosomal protein L11 methyltransferase	1.60e-10	NA	NA	0.7327
6. F	B1XAJ7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.12e-05	NA	NA	0.4947
6. F	Q03SF4	Ribosomal protein L11 methyltransferase	2.30e-08	NA	NA	0.7223
6. F	B6EMW5	tRNA1(Val) (adenine(37)-N6)-methyltransferase	2.02e-06	NA	NA	0.5785
6. F	A8G8B8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.52e-05	NA	NA	0.502
6. F	F2JTX5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.73e-07	NA	NA	0.7072
6. F	Q5GSM9	Ribosomal RNA small subunit methyltransferase A	2.86e-05	NA	NA	0.5638
6. F	A0K2X1	Ribosomal RNA small subunit methyltransferase G	4.77e-08	NA	NA	0.6866
6. F	A8AQF7	Ribosomal protein L11 methyltransferase	6.76e-08	NA	NA	0.7441
6. F	B0KM36	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.72e-05	NA	NA	0.5096
6. F	P44648	tRNA (guanine-N(7)-)-methyltransferase	7.52e-05	NA	NA	0.552
6. F	B1IQ33	Ribosomal protein L11 methyltransferase	6.94e-08	NA	NA	0.7291
6. F	Q68VR6	Bifunctional methyltransferase	1.53e-04	NA	NA	0.5033
6. F	Q7NBG2	tRNA (guanine-N(7)-)-methyltransferase	2.79e-04	NA	NA	0.495
6. F	A1SSB8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.78e-07	NA	NA	0.6786
6. F	Q088H8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.11e-05	NA	NA	0.5402
6. F	B5FIW1	Ribosomal protein L11 methyltransferase	7.25e-08	NA	NA	0.7443
6. F	Q2YJM4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.57e-05	NA	NA	0.5361
6. F	A5II90	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.94e-05	NA	NA	0.4899
6. F	Q7NRJ5	tRNA (guanine-N(7)-)-methyltransferase	1.01e-04	NA	NA	0.467
6. F	Q6AQF1	Ribosomal protein L11 methyltransferase	9.12e-10	NA	NA	0.7697
6. F	Q9A7N5	Ribosomal RNA small subunit methyltransferase A	6.35e-05	NA	NA	0.4898
6. F	A7FDE0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.50e-05	NA	NA	0.4944
6. F	P60092	Ribosomal protein L11 methyltransferase	7.70e-08	NA	NA	0.6903
6. F	Q3YXE7	tRNA (guanine-N(7)-)-methyltransferase	7.05e-05	NA	NA	0.4934
6. F	Q39ZT2	Ribosomal RNA small subunit methyltransferase G	1.33e-08	NA	NA	0.7211
6. F	Q5F5B4	Release factor glutamine methyltransferase	3.24e-07	NA	NA	0.545
6. F	Q03MB7	Ribosomal RNA small subunit methyltransferase G	2.76e-08	NA	NA	0.658
6. F	B8CS82	tRNA (guanine-N(7)-)-methyltransferase	7.88e-05	NA	NA	0.4781
6. F	A8A570	Ribosomal protein L11 methyltransferase	6.65e-08	NA	NA	0.7287
6. F	A0KUE8	tRNA (guanine-N(7)-)-methyltransferase	7.67e-05	NA	NA	0.475
6. F	Q6HDK9	Ribosomal protein L11 methyltransferase	1.13e-10	NA	NA	0.7844
6. F	B7LHW6	Ribosomal protein L11 methyltransferase	7.10e-08	NA	NA	0.7282
6. F	B8E8S1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.93e-07	NA	NA	0.7105
6. F	A2RGB9	Ribosomal RNA small subunit methyltransferase G	1.90e-08	NA	NA	0.6654
6. F	Q8A005	Demethylmenaquinone methyltransferase	8.81e-06	NA	NA	0.5382
6. F	P57616	tRNA (guanine-N(7)-)-methyltransferase	7.17e-05	NA	NA	0.5387
6. F	A1U8R4	Ribosomal RNA small subunit methyltransferase G	7.34e-07	NA	NA	0.6202
6. F	A0KU76	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.80e-07	NA	NA	0.7016
6. F	A1W7D2	tRNA (guanine-N(7)-)-methyltransferase	2.94e-04	NA	NA	0.5513
6. F	C1FP29	Ribosomal RNA small subunit methyltransferase G	1.11e-08	NA	NA	0.6574
6. F	B2VL75	Ribosomal protein L11 methyltransferase	7.17e-08	NA	NA	0.7247
6. F	A7NAA1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.59e-05	NA	NA	0.4959
6. F	C5BRL2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.26e-05	NA	NA	0.4998
6. F	Q1ME53	Ribosomal protein L11 methyltransferase	7.91e-10	NA	NA	0.7377
6. F	Q0I7M9	Ribosomal RNA small subunit methyltransferase G	8.54e-06	NA	NA	0.71
6. F	Q7NIP7	Ribosomal protein L11 methyltransferase	1.41e-09	NA	NA	0.7058
6. F	Q6FRZ7	Sterol 24-C-methyltransferase	7.60e-06	NA	NA	0.4251
6. F	Q5ZY91	tRNA (guanine-N(7)-)-methyltransferase	7.96e-05	NA	NA	0.4632
6. F	A7GT06	Ribosomal protein L11 methyltransferase	1.15e-10	NA	NA	0.7822
6. F	Q1BYF4	tRNA (guanine-N(7)-)-methyltransferase	2.81e-04	NA	NA	0.54
6. F	P0CS08	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	2.51e-04	NA	NA	0.4486
6. F	Q6C2D9	Sterol 24-C-methyltransferase	7.68e-06	NA	NA	0.4179
6. F	Q31W09	Ribosomal protein L11 methyltransferase	6.81e-08	NA	NA	0.7283
6. F	B1HXA1	tRNA (guanine-N(7)-)-methyltransferase	1.60e-05	NA	NA	0.5125
6. F	Q8EPW5	Ribosomal protein L11 methyltransferase	8.49e-11	NA	NA	0.7421
6. F	Q0HL77	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.79e-07	NA	NA	0.6957
6. F	A6WGM8	Ribosomal RNA small subunit methyltransferase G	1.34e-05	NA	NA	0.6809
6. F	Q6DAQ7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.83e-05	NA	NA	0.5128
6. F	Q818F1	Ribosomal protein L11 methyltransferase	1.10e-10	NA	NA	0.7654
6. F	Q9KVQ6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.81e-05	NA	NA	0.4959
6. F	Q8K927	tRNA (guanine-N(7)-)-methyltransferase	9.73e-05	NA	NA	0.5493
6. F	A0RLR0	Ribosomal RNA small subunit methyltransferase G	1.96e-08	NA	NA	0.6978
6. F	Q8ZAX6	Ribosomal protein L11 methyltransferase	7.42e-08	NA	NA	0.7411
6. F	B9LFP4	Ribosomal protein L11 methyltransferase	3.44e-08	NA	NA	0.6279
6. F	Q8D1I3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.70e-05	NA	NA	0.4978
6. F	B4EX23	Ribosomal protein L11 methyltransferase	6.94e-08	NA	NA	0.7018
6. F	A3M4Y3	Ribosomal RNA small subunit methyltransferase G	7.81e-08	NA	NA	0.6753
6. F	A9MNA2	Ribosomal protein L11 methyltransferase	7.66e-08	NA	NA	0.7441
6. F	A5F9I8	tRNA (guanine-N(7)-)-methyltransferase	6.16e-05	NA	NA	0.5015
6. F	P74003	Release factor glutamine methyltransferase	4.36e-08	NA	NA	0.5462
6. F	Q02EV4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.98e-05	NA	NA	0.5031
6. F	A5WA45	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.44e-05	NA	NA	0.5399
6. F	Q3Z8E1	Ribosomal RNA small subunit methyltransferase G	3.59e-08	NA	NA	0.6547
6. F	Q6D8J7	tRNA (guanine-N(7)-)-methyltransferase	8.22e-05	NA	NA	0.4904
6. F	A1BGS9	tRNA (guanine-N(7)-)-methyltransferase	2.49e-05	NA	NA	0.5459
6. F	B4TX91	Ribosomal protein L11 methyltransferase	7.33e-08	NA	NA	0.7442
6. F	Q3M6M1	Ribosomal protein L11 methyltransferase	4.18e-09	NA	NA	0.6604
6. F	A9N9I7	Ribosomal RNA small subunit methyltransferase A	1.48e-05	NA	NA	0.5734
6. F	A5GNG2	Ribosomal RNA small subunit methyltransferase G	6.35e-08	NA	NA	0.6825
6. F	B4RMI6	tRNA (guanine-N(7)-)-methyltransferase	8.71e-05	NA	NA	0.5591
6. F	Q899S0	Ribosomal RNA small subunit methyltransferase G	1.14e-08	NA	NA	0.6726
6. F	Q7MHI6	tRNA (guanine-N(7)-)-methyltransferase	6.32e-05	NA	NA	0.4951
6. F	Q39R75	tRNA (guanine-N(7)-)-methyltransferase	1.24e-04	NA	NA	0.5539
6. F	B1HPM1	Ribosomal RNA small subunit methyltransferase G	1.08e-08	NA	NA	0.6613
6. F	C1DHS2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.28e-05	NA	NA	0.5065
6. F	B2K217	Carboxy-S-adenosyl-L-methionine synthase 1	1.09e-04	NA	NA	0.4706
6. F	Q7CHK7	Ribosomal RNA large subunit methyltransferase K/L	5.77e-03	NA	NA	0.5693
6. F	B5XY56	Ribosomal RNA large subunit methyltransferase K/L	6.95e-03	NA	NA	0.6183
6. F	Q6G577	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.87e-05	NA	NA	0.5088
6. F	B0C384	Ribosomal RNA small subunit methyltransferase G	1.04e-07	NA	NA	0.6216
6. F	A5WFX2	Ribosomal protein L11 methyltransferase	3.80e-08	NA	NA	0.7622
6. F	Q2YPS7	Ribosomal protein L11 methyltransferase	3.80e-09	NA	NA	0.7204
6. F	Q74FT5	tRNA (guanine-N(7)-)-methyltransferase	8.10e-05	NA	NA	0.5654
6. F	O66479	tRNA (guanine-N(7)-)-methyltransferase	4.69e-05	NA	NA	0.5818
6. F	Q8DEQ3	tRNA1(Val) (adenine(37)-N6)-methyltransferase	8.12e-09	NA	NA	0.6087
6. F	Q2GK91	Ribosomal RNA small subunit methyltransferase A	2.05e-04	NA	NA	0.4916
6. F	Q0BJM7	Ribosomal RNA small subunit methyltransferase G	5.15e-08	NA	NA	0.6465
6. F	A5VYJ3	Ribosomal RNA small subunit methyltransferase C	6.51e-07	NA	NA	0.6634
6. F	A6VTA1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.03e-05	NA	NA	0.4937
6. F	Q8P4G1	Ribosomal RNA small subunit methyltransferase B	1.81e-05	NA	NA	0.573
6. F	A3P103	Ribosomal RNA small subunit methyltransferase G	7.26e-08	NA	NA	0.6509
6. F	C4L001	Ribosomal RNA small subunit methyltransferase G	1.45e-08	NA	NA	0.6679
6. F	B5F1U5	Ribosomal RNA large subunit methyltransferase K/L	6.37e-03	NA	NA	0.5838
6. F	B4TNX9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.02e-05	NA	NA	0.4625
6. F	A4SJL7	Ribosomal protein L11 methyltransferase	6.35e-08	NA	NA	0.7072
6. F	Q1CGJ3	Ribosomal RNA large subunit methyltransferase K/L	5.89e-03	NA	NA	0.5696
6. F	B2SC50	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.59e-05	NA	NA	0.5361
6. F	Q03F44	Ribosomal protein L11 methyltransferase	2.38e-09	NA	NA	0.7366
6. F	Q9V2G1	tRNA (guanine(37)-N1)/4-demethylwyosine(37)-methyltransferase Taw22	1.55e-06	NA	NA	0.5962
6. F	A8FMY4	tRNA (guanine-N(7)-)-methyltransferase	1.01e-02	NA	NA	0.4925
6. F	B7UJZ0	Ribosomal protein L11 methyltransferase	6.62e-08	NA	NA	0.7286
6. F	Q6A6S9	tRNA (guanine-N(7)-)-methyltransferase	1.60e-04	NA	NA	0.4681
6. F	C6DIJ9	Ribosomal protein L11 methyltransferase	1.39e-07	NA	NA	0.7282
6. F	Q9A1D7	Ribosomal RNA small subunit methyltransferase G	3.70e-08	NA	NA	0.6494
6. F	Q64XV8	Demethylmenaquinone methyltransferase	8.02e-06	NA	NA	0.5154
6. F	B6EL06	Ribosomal RNA small subunit methyltransferase C	6.53e-07	NA	NA	0.6654
6. F	A4IXH9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.45e-05	NA	NA	0.5093
6. F	Q07UP0	Ribosomal RNA small subunit methyltransferase G	1.34e-07	NA	NA	0.6721
6. F	Q48JX8	Ribosomal RNA large subunit methyltransferase K/L	1.80e-02	NA	NA	0.5972
6. F	Q8UDP9	Ribosomal protein L11 methyltransferase	9.87e-10	NA	NA	0.7504
6. F	Q7VP04	Ribosomal RNA large subunit methyltransferase K/L	4.32e-03	NA	NA	0.5882
6. F	Q8ZZA9	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	8.19e-11	NA	NA	0.5808
6. F	Q7VRJ1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.74e-05	NA	NA	0.4988
6. F	P45106	50S ribosomal protein L3 glutamine methyltransferase	2.35e-06	NA	NA	0.5131
6. F	Q63RN0	tRNA (guanine-N(7)-)-methyltransferase	2.55e-04	NA	NA	0.5521
6. F	Q1CEV4	tRNA (guanine-N(7)-)-methyltransferase	7.52e-05	NA	NA	0.543
6. F	C4L423	Ribosomal protein L11 methyltransferase	1.38e-10	NA	NA	0.7181
6. F	A0KNJ1	Ribosomal protein L11 methyltransferase	6.06e-08	NA	NA	0.6924
6. F	A9CG70	Release factor glutamine methyltransferase	3.11e-09	NA	NA	0.5136
6. F	B7N0Q3	Ribosomal protein L11 methyltransferase	6.74e-08	NA	NA	0.7287
6. F	Q7NJS7	Release factor glutamine methyltransferase	1.38e-07	NA	NA	0.5934
6. F	Q98KD0	Ribosomal protein L11 methyltransferase	3.84e-10	NA	NA	0.7414
6. F	B1JQR7	Ribosomal RNA large subunit methyltransferase K/L	7.35e-03	NA	NA	0.5694
6. F	Q04W54	tRNA (guanine-N(7)-)-methyltransferase	1.87e-05	NA	NA	0.5686
6. F	A6TSL8	Ribosomal protein L11 methyltransferase	3.43e-10	NA	NA	0.7398
6. F	Q10X25	Ribosomal protein L11 methyltransferase	3.97e-09	NA	NA	0.6571
6. F	Q7U4Z9	Dimethylglycine N-methyltransferase	2.67e-07	NA	NA	0.5076
6. F	Q5LCS1	tRNA1(Val) (adenine(37)-N6)-methyltransferase	3.04e-09	NA	NA	0.6608
6. F	Q9KV64	Ribosomal protein L11 methyltransferase	9.52e-08	NA	NA	0.6874
6. F	A1JIF2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.92e-05	NA	NA	0.4974
6. F	P44074	Uncharacterized protein HI_0912	5.61e-08	NA	NA	0.5591
6. F	Q5LH04	Demethylmenaquinone methyltransferase	7.88e-06	NA	NA	0.5152
6. F	B4TJV7	Ribosomal protein L11 methyltransferase	7.12e-08	NA	NA	0.7443
6. F	Q8TYY7	tRNA (guanine(26)-N(2))-dimethyltransferase	6.16e-07	NA	NA	0.6181
6. F	Q57HN8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.84e-05	NA	NA	0.4954
6. F	A8LNK7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.64e-05	NA	NA	0.5017
6. F	Q6NDM2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.27e-05	NA	NA	0.5169
6. F	Q8YDE4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.52e-05	NA	NA	0.5362
6. F	Q64TX7	tRNA1(Val) (adenine(37)-N6)-methyltransferase	2.98e-09	NA	NA	0.6552
6. F	Q92G13	Bifunctional methyltransferase	1.60e-04	NA	NA	0.4367
6. F	Q5WSQ8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.25e-05	NA	NA	0.4908
6. F	E1SSZ4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.82e-07	NA	NA	0.6665
6. F	Q8PPP2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.72e-05	NA	NA	0.5612
6. F	C0R5G4	Ribosomal RNA small subunit methyltransferase A	2.01e-04	NA	NA	0.5265
6. F	B1J2S8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.53e-05	NA	NA	0.5076
6. F	Q6YQV6	Ribosomal RNA small subunit methyltransferase G	6.21e-09	NA	NA	0.7213
6. F	P67688	Ribosomal protein L11 methyltransferase	6.91e-08	NA	NA	0.6903
6. F	Q8E9R7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.25e-05	NA	NA	0.5226
6. F	Q2RFJ0	Ribosomal RNA small subunit methyltransferase G	6.26e-08	NA	NA	0.6213
6. F	Q11GT9	Ribosomal protein L11 methyltransferase	1.06e-09	NA	NA	0.7659
6. F	B2S360	tRNA (guanine-N(7)-)-methyltransferase	4.96e-06	NA	NA	0.4933
6. F	C6DYR8	Ribosomal RNA small subunit methyltransferase G	1.04e-08	NA	NA	0.6871
6. F	P0CU27	Protein-lysine N-methyltransferase EFM3	2.27e-06	NA	NA	0.5774
6. F	A8H1S1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.00e-08	NA	NA	0.7284
6. F	A4QCP0	Ribosomal RNA small subunit methyltransferase A	3.47e-04	NA	NA	0.5981
6. F	A5GVE0	Ribosomal RNA small subunit methyltransferase G	3.57e-08	NA	NA	0.6682
6. F	Q97F67	Release factor glutamine methyltransferase	6.79e-09	NA	NA	0.5855
6. F	A3NF53	Ribosomal RNA small subunit methyltransferase G	6.91e-08	NA	NA	0.651
6. F	A1ASL8	Protein-L-isoaspartate O-methyltransferase 1	2.22e-05	NA	NA	0.6544
6. F	C3MEL0	Ribosomal protein L11 methyltransferase	1.01e-09	NA	NA	0.7553
6. F	Q0AJ68	tRNA (guanine-N(7)-)-methyltransferase	6.61e-05	NA	NA	0.498
6. F	A4Y952	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.76e-07	NA	NA	0.7089
6. F	B2ISD7	Ribosomal protein L11 methyltransferase	1.69e-08	NA	NA	0.6958
6. F	B2HZC3	Ribosomal RNA small subunit methyltransferase G	7.84e-08	NA	NA	0.6841
6. F	Q8ZM40	tRNA (guanine-N(7)-)-methyltransferase	8.45e-05	NA	NA	0.489
6. F	A3D9J5	Ribosomal protein L11 methyltransferase	1.40e-07	NA	NA	0.7252
6. F	Q4QLT2	Ribosomal protein L11 methyltransferase	8.36e-08	NA	NA	0.6883
6. F	C0Q3E1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.69e-05	NA	NA	0.4938
6. F	A8H966	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.12e-05	NA	NA	0.5021
6. F	B7HCT8	Ribosomal protein L11 methyltransferase	1.05e-10	NA	NA	0.7634
6. F	P0DF44	Ribosomal RNA small subunit methyltransferase G	3.63e-08	NA	NA	0.6494
6. F	Q7ULT2	Release factor glutamine methyltransferase	1.23e-07	NA	NA	0.5923
6. F	B9E6W9	Ribosomal protein L11 methyltransferase	1.08e-10	NA	NA	0.7506
6. F	Q7MGK4	Ribosomal RNA small subunit methyltransferase B	4.26e-06	NA	NA	0.6491
6. F	B8NI24	O-methyltransferase imqG	1.99e-08	NA	NA	0.5384
6. F	Q9CKD6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.51e-05	NA	NA	0.4653
6. F	B1WNQ4	Ribosomal protein L11 methyltransferase	5.45e-09	NA	NA	0.6433
6. F	B4T1Z1	Ribosomal RNA large subunit methyltransferase K/L	8.19e-03	NA	NA	0.5835
6. F	Q8PG22	Ribosomal RNA small subunit methyltransferase B	9.41e-06	NA	NA	0.5798
6. F	Q9KQ83	50S ribosomal protein L3 glutamine methyltransferase	3.52e-06	NA	NA	0.5071
6. F	Q1GC56	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.10e-05	NA	NA	0.5313
6. F	Q814F8	Ribosomal RNA small subunit methyltransferase G	2.02e-08	NA	NA	0.7051
6. F	B5BGT7	Ribosomal protein L11 methyltransferase	6.94e-08	NA	NA	0.7444
6. F	A1BAN1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.57e-05	NA	NA	0.5148
6. F	Q8Z7S6	Ribosomal RNA large subunit methyltransferase K/L	6.94e-03	NA	NA	0.5837
6. F	Q0ACP5	tRNA (guanine-N(7)-)-methyltransferase	1.36e-04	NA	NA	0.4616
6. F	A4Y8Y5	tRNA (guanine-N(7)-)-methyltransferase	6.92e-05	NA	NA	0.5658
6. F	Q98R44	tRNA (guanine-N(7)-)-methyltransferase	4.19e-06	NA	NA	0.542
6. F	A9LZQ8	tRNA (guanine-N(7)-)-methyltransferase	8.87e-05	NA	NA	0.5345
6. F	Q0HXI0	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.60e-07	NA	NA	0.6977
6. F	Q93D95	Ribosomal RNA small subunit methyltransferase G	3.46e-08	NA	NA	0.7274
6. F	Q3AZ92	Ribosomal RNA small subunit methyltransferase G	1.43e-07	NA	NA	0.702
6. F	A5UAE5	tRNA (guanine-N(7)-)-methyltransferase	7.29e-05	NA	NA	0.5385
6. F	A7ZAV9	Ribosomal RNA small subunit methyltransferase G	8.93e-09	NA	NA	0.7015
6. F	Q55787	Ribosomal RNA small subunit methyltransferase G	1.60e-07	NA	NA	0.568
6. F	A0Q5J5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.59e-07	NA	NA	0.719
6. F	A0LR93	Ribosomal RNA small subunit methyltransferase A	1.89e-05	NA	NA	0.5498
6. F	Q2RKY6	Ribosomal protein L11 methyltransferase	4.82e-11	NA	NA	0.7562
6. F	Q04HG5	Ribosomal RNA small subunit methyltransferase G	1.71e-08	NA	NA	0.6732
6. F	A5FKD7	tRNA1(Val) (adenine(37)-N6)-methyltransferase	6.59e-09	NA	NA	0.668
6. F	Q2VYQ1	tRNA (guanine-N(7)-)-methyltransferase	9.25e-05	NA	NA	0.5114
6. F	A4WF74	Ribosomal protein L11 methyltransferase	7.39e-08	NA	NA	0.7445
6. F	B0K5N2	Ribosomal RNA small subunit methyltransferase G	2.11e-08	NA	NA	0.7296
6. F	Q39KY8	Ribosomal RNA small subunit methyltransferase G	5.90e-08	NA	NA	0.6779
6. F	A4WKL2	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	2.43e-08	NA	NA	0.6016
6. F	Q3BQ14	tRNA (guanine-N(7)-)-methyltransferase	4.94e-04	NA	NA	0.5962
6. F	B8D9X3	tRNA (guanine-N(7)-)-methyltransferase	7.58e-05	NA	NA	0.5319
6. F	Q39PR1	Ribosomal RNA small subunit methyltransferase G	2.14e-08	NA	NA	0.6712
6. F	Q02YJ6	Ribosomal RNA small subunit methyltransferase G	1.90e-08	NA	NA	0.7008
6. F	A1A9L8	Ribosomal RNA large subunit methyltransferase K/L	6.22e-03	NA	NA	0.621
6. F	B7GKD0	Ribosomal protein L11 methyltransferase	8.48e-11	NA	NA	0.7621
6. F	Q98G94	Release factor glutamine methyltransferase	3.94e-09	NA	NA	0.5458
6. F	B1YAJ6	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	1.99e-08	NA	NA	0.5919
6. F	Q666M5	tRNA (guanine-N(7)-)-methyltransferase	8.19e-05	NA	NA	0.5794
6. F	Q5FU61	Ribosomal RNA small subunit methyltransferase A	5.14e-04	NA	NA	0.4928
6. F	B0KN57	tRNA (guanine-N(7)-)-methyltransferase	1.21e-04	NA	NA	0.5382
6. F	Q4R3U8	tRNA wybutosine-synthesizing protein 2 homolog	3.94e-03	NA	NA	0.5142
6. F	B3PZ92	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.09e-05	NA	NA	0.5648
6. F	C0ZB50	Ribosomal protein L11 methyltransferase	9.76e-11	NA	NA	0.7809
6. F	B9KAS1	Ribosomal RNA small subunit methyltransferase G	1.93e-07	NA	NA	0.6567
6. F	Q92BP0	Ribosomal protein L11 methyltransferase	1.55e-10	NA	NA	0.7473
6. F	Q0ADD7	Ribosomal RNA small subunit methyltransferase G	2.95e-08	NA	NA	0.6876
6. F	A8FJF8	Ribosomal RNA small subunit methyltransferase G	1.28e-08	NA	NA	0.7066
6. F	D5FKJ3	2-ketoarginine methyltransferase	1.67e-07	NA	NA	0.551
6. F	Q8KCD5	Release factor glutamine methyltransferase	1.53e-06	NA	NA	0.5632
6. F	Q9ZCB3	Bifunctional methyltransferase	1.68e-04	NA	NA	0.4822
6. F	Q72I77	tRNA (guanine-N(7)-)-methyltransferase	2.91e-04	NA	NA	0.5565
6. F	A3QDY0	Ribosomal RNA large subunit methyltransferase K/L	1.31e-02	NA	NA	0.4787
6. F	Q1RDR6	Ribosomal RNA large subunit methyltransferase K/L	6.13e-03	NA	NA	0.621
6. F	Q2YCZ3	tRNA (guanine-N(7)-)-methyltransferase	1.33e-04	NA	NA	0.5214
6. F	B1VEE1	tRNA (guanine-N(7)-)-methyltransferase	5.35e-04	NA	NA	0.4672
6. F	Q9JZ24	tRNA (guanine-N(7)-)-methyltransferase	1.02e-04	NA	NA	0.5645
6. F	A1T1J8	tRNA (guanine-N(7)-)-methyltransferase	2.69e-04	NA	NA	0.5008
6. F	Q7VN18	tRNA (guanine-N(7)-)-methyltransferase	9.31e-05	NA	NA	0.5123
6. F	Q319D4	Ribosomal protein L11 methyltransferase	8.32e-10	NA	NA	0.7198
6. F	Q2KDB0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.99e-05	NA	NA	0.5685
6. F	B1I7P5	Ribosomal protein L11 methyltransferase	2.12e-08	NA	NA	0.7138
6. F	A8FFD0	Ribosomal protein L11 methyltransferase	1.07e-10	NA	NA	0.731
6. F	A0L1M4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.21e-05	NA	NA	0.5427
6. F	B1KUB0	Ribosomal RNA small subunit methyltransferase G	9.45e-09	NA	NA	0.624
6. F	Q5NGX1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.52e-07	NA	NA	0.719
6. F	Q489G6	Ribosomal protein L11 methyltransferase	5.36e-08	NA	NA	0.6193
6. F	B5QW73	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.16e-05	NA	NA	0.4644
6. F	A9MQR6	tRNA (guanine-N(7)-)-methyltransferase	8.29e-05	NA	NA	0.4879
6. F	A8GCK7	Ribosomal RNA large subunit methyltransferase K/L	7.17e-03	NA	NA	0.6259
6. F	B9MQF1	Ribosomal RNA small subunit methyltransferase G	7.56e-08	NA	NA	0.6976
6. F	B5QZF1	Ribosomal RNA large subunit methyltransferase K/L	8.22e-03	NA	NA	0.584
6. F	Q5PKP4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.09e-05	NA	NA	0.462
6. F	Q576Q0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.33e-05	NA	NA	0.5361
6. F	B4TRX1	Ribosomal RNA large subunit methyltransferase K/L	8.82e-03	NA	NA	0.6182
6. F	B0JYE6	Ribosomal RNA small subunit methyltransferase G	5.31e-08	NA	NA	0.6873
6. F	Q0AWM5	Ribosomal protein L11 methyltransferase	9.06e-10	NA	NA	0.7308
6. F	A8GJ47	tRNA (guanine-N(7)-)-methyltransferase	8.99e-05	NA	NA	0.5701
6. F	B1J2G9	tRNA (guanine-N(7)-)-methyltransferase	1.06e-04	NA	NA	0.5595
6. F	Q8EAR4	Release factor glutamine methyltransferase	1.32e-07	NA	NA	0.6304
6. F	A9B5V4	Ribosomal protein L11 methyltransferase	1.02e-08	NA	NA	0.6206
6. F	Q8FZQ6	Ribosomal protein L11 methyltransferase	3.49e-09	NA	NA	0.7096
6. F	Q32A11	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.74e-05	NA	NA	0.4956
6. F	Q7VXJ6	50S ribosomal protein L3 glutamine methyltransferase	3.59e-06	NA	NA	0.5476
6. F	B5FQZ1	Ribosomal RNA large subunit methyltransferase K/L	8.09e-03	NA	NA	0.4893
6. F	Q133Y8	Ribosomal protein L11 methyltransferase	1.75e-09	NA	NA	0.714
6. F	Q0TAM1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.78e-05	NA	NA	0.4956
6. F	Q0I516	tRNA (guanine-N(7)-)-methyltransferase	1.00e-04	NA	NA	0.519
6. F	A6TES6	Ribosomal protein L11 methyltransferase	7.03e-08	NA	NA	0.7287
6. F	B7LRN4	Ribosomal protein L11 methyltransferase	6.81e-08	NA	NA	0.7284
6. F	B5F9T8	tRNA1(Val) (adenine(37)-N6)-methyltransferase	1.98e-06	NA	NA	0.624
6. F	A1RHE4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.59e-07	NA	NA	0.7028
6. F	Q72HI4	Demethylmenaquinone methyltransferase	1.34e-05	NA	NA	0.5208
6. F	A5IN97	Ribosomal protein L11 methyltransferase	1.64e-10	NA	NA	0.7789
6. F	B1JEN3	Ribosomal RNA small subunit methyltransferase C	5.19e-07	NA	NA	0.6457
6. F	A4YB19	Ribosomal protein L11 methyltransferase	1.39e-07	NA	NA	0.7395
6. F	A3CLJ1	Ribosomal RNA small subunit methyltransferase G	3.02e-08	NA	NA	0.6661
6. F	A1AFE6	tRNA (guanine-N(7)-)-methyltransferase	7.17e-05	NA	NA	0.4934
6. F	A9BF05	Ribosomal RNA small subunit methyltransferase G	3.50e-08	NA	NA	0.6318
6. F	Q8XDB2	Ribosomal RNA large subunit methyltransferase K/L	6.40e-03	NA	NA	0.6209
6. F	A0QME9	tRNA (guanine-N(7)-)-methyltransferase	2.42e-04	NA	NA	0.4348
6. F	B1JP75	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.20e-05	NA	NA	0.4662
6. F	P31049	Probable fatty acid methyltransferase	3.64e-06	NA	NA	0.4791
6. F	Q8R6G7	Ribosomal protein L11 methyltransferase	2.91e-09	NA	NA	0.6628
6. F	B2J397	Ribosomal protein L11 methyltransferase	1.59e-09	NA	NA	0.7442
6. F	Q8NRY1	Ribosomal RNA small subunit methyltransferase A	9.33e-05	NA	NA	0.6097
6. F	B6ENA3	Ribosomal protein L11 methyltransferase	1.27e-07	NA	NA	0.6964
6. F	Q2NU80	Ribosomal RNA large subunit methyltransferase K/L	7.66e-03	NA	NA	0.5098
6. F	A9KLX7	Ribosomal RNA small subunit methyltransferase G	8.04e-08	NA	NA	0.6952
6. F	Q3AF06	Ribosomal protein L11 methyltransferase	2.88e-11	NA	NA	0.7764
6. F	Q72W54	Uncharacterized RNA methyltransferase LIC_10086	5.04e-06	NA	NA	0.6879
6. F	A5UIB7	Ribosomal protein L11 methyltransferase	8.64e-08	NA	NA	0.6807
6. F	Q9HUX4	L-histidine 2-aminobutanoyltransferase	1.26e-06	NA	NA	0.6243
6. F	A4JA23	Ribosomal RNA small subunit methyltransferase G	3.87e-08	NA	NA	0.7139
6. F	A8B4Q0	tRNA (guanine(37)-N1)-methyltransferase	1.30e-03	NA	NA	0.5232
6. F	Q9KD70	Ribosomal protein L11 methyltransferase	9.60e-11	NA	NA	0.7785
6. F	A3Q9Q5	Ribosomal protein L11 methyltransferase	1.26e-07	NA	NA	0.7245
6. F	Q0T0S8	tRNA (guanine-N(7)-)-methyltransferase	7.32e-05	NA	NA	0.4938
6. F	A3M6R7	Ribosomal protein L11 methyltransferase	6.40e-08	NA	NA	0.7578
6. F	B0UWE3	tRNA (guanine-N(7)-)-methyltransferase	1.12e-04	NA	NA	0.4955
6. F	Q4UJU4	Bifunctional methyltransferase	1.53e-04	NA	NA	0.5116
6. F	Q5M5Y2	Ribosomal RNA small subunit methyltransferase G	2.81e-08	NA	NA	0.6542
6. F	Q2NYW4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.66e-05	NA	NA	0.5594
6. F	B0VLL0	Ribosomal protein L11 methyltransferase	6.35e-08	NA	NA	0.7103
6. F	A6VM22	Ribosomal protein L11 methyltransferase	5.17e-08	NA	NA	0.6806
6. F	Q1R766	tRNA (guanine-N(7)-)-methyltransferase	6.95e-05	NA	NA	0.4937
6. F	Q31RM0	Ribosomal RNA small subunit methyltransferase G	8.12e-08	NA	NA	0.7146
6. F	A4XDK0	Ribosomal RNA small subunit methyltransferase G	5.76e-07	NA	NA	0.6242
6. F	A5UD93	Ribosomal protein L11 methyltransferase	7.92e-08	NA	NA	0.7288
6. F	A9M676	Ribosomal protein L11 methyltransferase	3.42e-09	NA	NA	0.7094
6. F	A8YXD7	Ribosomal RNA small subunit methyltransferase G	1.43e-08	NA	NA	0.646
6. F	Q9PD92	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	5.21e-05	NA	NA	0.4832
6. F	Q04XB2	tRNA (guanine-N(7)-)-methyltransferase	1.87e-05	NA	NA	0.5665
6. F	B5R6B4	Ribosomal RNA large subunit methyltransferase K/L	8.53e-03	NA	NA	0.5837
6. F	B1KIW4	tRNA (guanine-N(7)-)-methyltransferase	7.40e-05	NA	NA	0.5282
6. F	Q3K588	tRNA (guanine-N(7)-)-methyltransferase	1.23e-04	NA	NA	0.5619
6. F	Q5M6B7	Ribosomal protein L11 methyltransferase	1.41e-08	NA	NA	0.709
6. F	Q21H69	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.02e-05	NA	NA	0.4672
6. F	C1CL20	Ribosomal RNA small subunit methyltransferase G	3.28e-08	NA	NA	0.6483
6. F	Q1QA78	Ribosomal protein L11 methyltransferase	5.58e-08	NA	NA	0.7585
6. F	Q5KWZ9	Ribosomal protein L11 methyltransferase	9.61e-11	NA	NA	0.7755
6. F	Q8Z3U1	tRNA (guanine-N(7)-)-methyltransferase	8.41e-05	NA	NA	0.503
6. F	Q9WZG6	Ribosomal RNA small subunit methyltransferase G	1.55e-07	NA	NA	0.5642
6. F	Q1JND4	Ribosomal RNA small subunit methyltransferase G	3.05e-08	NA	NA	0.6521
6. F	P0A8I6	tRNA (guanine-N(7)-)-methyltransferase	7.50e-05	NA	NA	0.4923
6. F	Q5XDS2	Ribosomal RNA small subunit methyltransferase G	3.75e-08	NA	NA	0.6622
6. F	Q89WD0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.03e-05	NA	NA	0.5117
6. F	Q92SK7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.53e-05	NA	NA	0.5369
6. F	Q7V5Q2	Ribosomal RNA small subunit methyltransferase G	5.36e-08	NA	NA	0.7146
6. F	A6W0X8	Malonyl-[acyl-carrier protein] O-methyltransferase	1.52e-04	NA	NA	0.4926
6. F	A0Q549	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.58e-05	NA	NA	0.4957
6. F	B8CU29	tRNA1(Val) (adenine(37)-N6)-methyltransferase	4.91e-09	NA	NA	0.6292
6. F	Q7VHY7	Ribosomal protein L11 methyltransferase	1.59e-07	NA	NA	0.7025
6. F	Q8EXJ3	Demethylmenaquinone methyltransferase	2.93e-04	NA	NA	0.5046
6. F	Q65H56	Ribosomal protein L11 methyltransferase	8.58e-11	NA	NA	0.7637
6. F	C1CT24	Ribosomal protein L11 methyltransferase	1.76e-08	NA	NA	0.7037
6. F	P0DF45	Ribosomal RNA small subunit methyltransferase G	4.04e-08	NA	NA	0.6477
6. F	Q1LJU9	tRNA (guanine-N(7)-)-methyltransferase	2.38e-04	NA	NA	0.5144
6. F	Q1IWK0	tRNA (guanine-N(7)-)-methyltransferase	2.62e-03	NA	NA	0.4797
6. F	Q82YY1	Ribosomal RNA small subunit methyltransferase G	3.24e-08	NA	NA	0.6528
6. F	Q047S1	Ribosomal RNA small subunit methyltransferase G	4.88e-08	NA	NA	0.6565
6. F	A6TDW8	tRNA (guanine-N(7)-)-methyltransferase	9.10e-05	NA	NA	0.5451
6. F	B2GF22	Ribosomal RNA small subunit methyltransferase G	5.26e-08	NA	NA	0.6768
6. F	C1CR21	Ribosomal RNA small subunit methyltransferase G	2.86e-08	NA	NA	0.6649
6. F	Q9LCY2	Ribosomal RNA small subunit methyltransferase G	9.34e-08	NA	NA	0.6969
6. F	B2VDF6	Ribosomal RNA large subunit methyltransferase K/L	5.71e-03	NA	NA	0.609
6. F	B4RZ48	Ribosomal RNA large subunit methyltransferase K/L	3.02e-03	NA	NA	0.4641
6. F	A6GWI6	tRNA1(Val) (adenine(37)-N6)-methyltransferase	2.20e-06	NA	NA	0.6385
6. F	B8E680	Ribosomal protein L11 methyltransferase	1.36e-07	NA	NA	0.7226
6. F	B9DTP3	Ribosomal RNA small subunit methyltransferase G	1.85e-08	NA	NA	0.7011
6. F	C0M821	Ribosomal RNA small subunit methyltransferase G	2.96e-08	NA	NA	0.7169
6. F	Q0HL06	tRNA (guanine-N(7)-)-methyltransferase	7.58e-05	NA	NA	0.475
6. F	A6L3D5	Demethylmenaquinone methyltransferase	8.86e-06	NA	NA	0.5351
6. F	Q12PZ8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.15e-06	NA	NA	0.6884
6. F	A4J9R9	Ribosomal RNA small subunit methyltransferase G	5.59e-08	NA	NA	0.6594
6. F	P59720	tRNA (guanine-N(7)-)-methyltransferase	7.24e-05	NA	NA	0.5477
6. F	Q2JTZ8	Ribosomal RNA small subunit methyltransferase G	2.47e-07	NA	NA	0.6596
6. F	C0RE56	Ribosomal protein L11 methyltransferase	3.53e-09	NA	NA	0.7096
6. F	B7IYG5	Ribosomal protein L11 methyltransferase	1.10e-10	NA	NA	0.7851
6. F	B0TJ16	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.23e-05	NA	NA	0.5026
6. F	Q1CA41	Ribosomal RNA large subunit methyltransferase K/L	6.12e-03	NA	NA	0.5778
6. F	Q5NFE1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.54e-05	NA	NA	0.5229
6. F	A6WTE5	Ribosomal protein L11 methyltransferase	1.35e-07	NA	NA	0.6752
6. F	Q4ZZG3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.67e-05	NA	NA	0.5327
6. F	B2FSD1	tRNA (guanine-N(7)-)-methyltransferase	5.92e-05	NA	NA	0.6035
6. F	Q3J2B7	Release factor glutamine methyltransferase	3.46e-09	NA	NA	0.5548
6. F	A3D9F2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.32e-05	NA	NA	0.534
6. F	H2E7T7	Botryococcene C-methyltransferase	9.47e-06	NA	NA	0.4191
6. F	Q8DDP9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.58e-05	NA	NA	0.5061
6. F	Q31IM5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.62e-05	NA	NA	0.4954
6. F	A0RRT6	Ribosomal RNA small subunit methyltransferase A	6.46e-05	NA	NA	0.532
6. F	P0DD19	Ribosomal protein L11 methyltransferase	4.45e-09	NA	NA	0.7414
6. F	Q8FUZ3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.39e-05	NA	NA	0.5362
6. F	Q1G8A5	Ribosomal RNA small subunit methyltransferase G	5.10e-08	NA	NA	0.6553
6. F	A5F3S3	Ribosomal protein L11 methyltransferase	8.97e-08	NA	NA	0.7368
6. F	A4QHQ6	tRNA (guanine-N(7)-)-methyltransferase	4.85e-04	NA	NA	0.5633
6. F	B8G6Y3	Ribosomal RNA small subunit methyltransferase G	2.43e-08	NA	NA	0.6001
6. F	A8A6U0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.78e-05	NA	NA	0.4961
6. F	Q10Y54	Ribosomal RNA small subunit methyltransferase G	1.48e-07	NA	NA	0.6122
6. F	P0A8I7	tRNA (guanine-N(7)-)-methyltransferase	6.97e-05	NA	NA	0.4935
6. F	Q9A9T7	Release factor glutamine methyltransferase	1.07e-07	NA	NA	0.539
6. F	Q3JC88	Ribosomal protein L11 methyltransferase	1.09e-08	NA	NA	0.7096
6. F	Q4R6Y8	Glutathione S-transferase C-terminal domain-containing protein	9.48e-03	NA	NA	0.6471
6. F	Q9RU72	Ribosomal protein L11 methyltransferase	9.37e-09	NA	NA	0.7144
6. F	A1WIH0	tRNA (guanine-N(7)-)-methyltransferase	3.54e-04	NA	NA	0.5475
6. F	A6W6U4	Ribosomal RNA small subunit methyltransferase A	1.24e-05	NA	NA	0.6055
6. F	Q7VAM5	Ribosomal protein L11 methyltransferase	7.21e-10	NA	NA	0.7699
6. F	Q2GE45	Ribosomal RNA small subunit methyltransferase A	2.25e-04	NA	NA	0.5245
6. F	Q634M9	Ribosomal protein L11 methyltransferase	1.13e-10	NA	NA	0.7654
6. F	A1TI25	Ribosomal RNA small subunit methyltransferase G	6.31e-07	NA	NA	0.6223
6. F	B1MX30	Ribosomal RNA small subunit methyltransferase G	1.61e-08	NA	NA	0.6577
6. F	P0A8T4	Ribosomal protein L11 methyltransferase	7.16e-08	NA	NA	0.7285
6. F	Q16DL1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.37e-05	NA	NA	0.5295
6. F	Q57K06	tRNA (guanine-N(7)-)-methyltransferase	8.25e-05	NA	NA	0.4971
6. F	C0RMK3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.34e-05	NA	NA	0.536
6. F	Q8D382	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.52e-05	NA	NA	0.5244
6. F	A1WZP9	tRNA (guanine-N(7)-)-methyltransferase	5.51e-05	NA	NA	0.4599
6. F	Q9PL91	tRNA (guanine-N(7)-)-methyltransferase	1.91e-06	NA	NA	0.5776
6. F	Q3AHY7	Ribosomal RNA small subunit methyltransferase G	5.29e-08	NA	NA	0.7072
6. F	B3CPY6	Ribosomal RNA small subunit methyltransferase A	3.77e-05	NA	NA	0.5686
6. F	B8E004	Release factor glutamine methyltransferase	3.78e-08	NA	NA	0.54
6. F	A5W6K7	Ribosomal RNA large subunit methyltransferase K/L	1.01e-02	NA	NA	0.5805
6. F	Q2JMA3	Ribosomal RNA small subunit methyltransferase G	2.20e-07	NA	NA	0.6809
6. F	A6WIE9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.02e-05	NA	NA	0.5227
6. F	Q2W0V3	Ribosomal RNA small subunit methyltransferase A	5.44e-05	NA	NA	0.6175
6. F	Q6MHQ3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.33e-04	NA	NA	0.5064
6. F	Q0BNE2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.44e-05	NA	NA	0.5122
6. F	Q9KJ21	Sarcosine/dimethylglycine N-methyltransferase	2.53e-07	NA	NA	0.4444
6. F	Q1R477	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.97e-05	NA	NA	0.488
6. F	A9KYL8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.32e-05	NA	NA	0.5424
6. F	B7L996	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.07e-05	NA	NA	0.4956
6. F	Q9V1J7	tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase TrmI	1.98e-07	NA	NA	0.5728
6. F	Q32DK7	50S ribosomal protein L3 glutamine methyltransferase	1.90e-06	NA	NA	0.5025
6. F	A8A4A3	tRNA (guanine-N(7)-)-methyltransferase	7.30e-05	NA	NA	0.4934
6. F	B0T1G7	Ribosomal protein L11 methyltransferase	4.80e-09	NA	NA	0.7612
6. F	Q48V72	Ribosomal RNA small subunit methyltransferase G	3.86e-08	NA	NA	0.6489
6. F	Q88D17	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.01e-05	NA	NA	0.4975
6. F	Q883N9	Ribosomal RNA large subunit methyltransferase K/L	1.80e-02	NA	NA	0.5982
6. F	A1RP78	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.28e-05	NA	NA	0.5425
6. F	Q8ECQ4	50S ribosomal protein L3 glutamine methyltransferase	2.50e-06	NA	NA	0.5207
6. F	B1MZ55	Ribosomal protein L11 methyltransferase	1.31e-09	NA	NA	0.7433
6. F	O34331	Putative rRNA methyltransferase YlbH	1.24e-10	NA	NA	0.702
6. F	A5D3Y3	Ribosomal protein L11 methyltransferase	8.59e-11	NA	NA	0.7139
6. F	Q8DCC3	tRNA (guanine-N(7)-)-methyltransferase	6.06e-05	NA	NA	0.5072
6. F	Q9ZD05	Uncharacterized methylase RP545	5.93e-04	NA	NA	0.5091
6. F	C1C922	Ribosomal protein L11 methyltransferase	2.01e-08	NA	NA	0.7013
6. F	Q6D000	Ribosomal RNA small subunit methyltransferase B	6.11e-06	NA	NA	0.6264
6. F	Q4FRP0	Ribosomal protein L11 methyltransferase	5.75e-08	NA	NA	0.7625
6. F	A3N231	tRNA (guanine-N(7)-)-methyltransferase	1.23e-04	NA	NA	0.522
6. F	Q4KFI6	Ribosomal RNA large subunit methyltransferase K/L	9.42e-03	NA	NA	0.6014
6. F	Q32C29	tRNA (guanine-N(7)-)-methyltransferase	6.42e-05	NA	NA	0.4934
6. F	A7MEX5	Ribosomal RNA large subunit methyltransferase K/L	6.10e-03	NA	NA	0.6188
6. F	Q9PF94	tRNA (guanine-N(7)-)-methyltransferase	7.88e-05	NA	NA	0.5532
6. F	Q31WM2	tRNA (guanine-N(7)-)-methyltransferase	6.36e-05	NA	NA	0.4932
6. F	O58523	tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase	3.63e-08	NA	NA	0.65
6. F	Q0HZP7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.40e-05	NA	NA	0.5404
6. F	A1V8U2	Ribosomal RNA small subunit methyltransferase G	6.71e-08	NA	NA	0.68
6. F	Q5M1S5	Ribosomal protein L11 methyltransferase	1.26e-08	NA	NA	0.7066
6. F	Q255M7	tRNA (guanine-N(7)-)-methyltransferase	2.51e-06	NA	NA	0.5811
6. F	O84836	tRNA (guanine-N(7)-)-methyltransferase	1.12e-06	NA	NA	0.5514
6. F	Q0WDE1	50S ribosomal protein L3 glutamine methyltransferase	6.66e-04	NA	NA	0.4988
6. F	O83477	tRNA (guanine-N(7)-)-methyltransferase	5.15e-06	NA	NA	0.5019
6. F	A2RHI1	Ribosomal protein L11 methyltransferase	1.76e-08	NA	NA	0.7028
6. F	B3DQM3	Ribosomal RNA small subunit methyltransferase H	2.85e-03	NA	NA	0.6962
6. F	Q1II29	Release factor glutamine methyltransferase	5.93e-07	NA	NA	0.6306
6. F	Q5M1E6	Ribosomal RNA small subunit methyltransferase G	2.96e-08	NA	NA	0.6747
6. F	Q15NR8	tRNA1(Val) (adenine(37)-N6)-methyltransferase	4.72e-08	NA	NA	0.6224
6. F	Q746Q5	Ribosomal RNA small subunit methyltransferase G	2.83e-08	NA	NA	0.7147
6. F	Q8FM11	tRNA (guanine-N(7)-)-methyltransferase	4.86e-04	NA	NA	0.4924
6. F	C5BCF2	tRNA (guanine-N(7)-)-methyltransferase	9.31e-05	NA	NA	0.481
6. F	Q1BFP0	tRNA (guanine-N(7)-)-methyltransferase	3.84e-04	NA	NA	0.5072
6. F	A1TRL2	tRNA (guanine-N(7)-)-methyltransferase	2.60e-04	NA	NA	0.5661
6. F	P67689	Ribosomal protein L11 methyltransferase	6.79e-08	NA	NA	0.7443
6. F	Q2J4A4	Ribosomal RNA small subunit methyltransferase G	1.54e-07	NA	NA	0.6682
6. F	C5BCA4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.03e-05	NA	NA	0.4713
6. F	A5VJF8	Ribosomal protein L11 methyltransferase	2.38e-09	NA	NA	0.7094
6. F	Q129H3	tRNA (guanine-N(7)-)-methyltransferase	2.70e-04	NA	NA	0.5032
6. F	Q9CCZ9	tRNA (guanine-N(7)-)-methyltransferase	1.20e-04	NA	NA	0.4202
6. F	Q3Z3H3	Ribosomal RNA large subunit methyltransferase K/L	6.22e-03	NA	NA	0.6217
6. F	B0TK00	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.52e-08	NA	NA	0.7284
6. F	A1AV41	Ribosomal RNA small subunit methyltransferase G	4.62e-08	NA	NA	0.6636
6. F	Q7VA38	Ribosomal RNA small subunit methyltransferase G	1.35e-07	NA	NA	0.6723
6. F	A0JU87	Ribosomal RNA small subunit methyltransferase A	3.48e-05	NA	NA	0.5647
6. F	Q831F7	Release factor glutamine methyltransferase	2.55e-07	NA	NA	0.5728
6. F	Q4A6Q0	Ribosomal RNA small subunit methyltransferase G	9.46e-08	NA	NA	0.651
6. F	B1LGM4	Ribosomal protein L11 methyltransferase	7.04e-08	NA	NA	0.7288
6. F	Q71VW1	Ribosomal RNA small subunit methyltransferase G	1.06e-08	NA	NA	0.7084
6. F	A0AIS2	Ribosomal protein L11 methyltransferase	1.31e-10	NA	NA	0.7467
6. F	B8CJP2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.19e-08	NA	NA	0.7188
6. F	A9WW74	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.29e-05	NA	NA	0.5361
6. F	Q6NET4	tRNA (guanine-N(7)-)-methyltransferase	2.76e-04	NA	NA	0.4881
6. F	C1L0D6	Ribosomal RNA small subunit methyltransferase G	1.09e-08	NA	NA	0.7068
6. F	B7K2J4	Ribosomal protein L11 methyltransferase	1.87e-09	NA	NA	0.6787
6. F	Q2SN12	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.40e-05	NA	NA	0.5332
6. F	B4U4T4	Ribosomal RNA small subunit methyltransferase G	2.95e-08	NA	NA	0.6656
6. F	Q8D035	L-histidine 2-aminobutanoyltransferase	1.06e-06	NA	NA	0.6318
6. F	Q89FW1	Ribosomal protein L11 methyltransferase	5.21e-10	NA	NA	0.7481
6. F	Q5E263	Ribosomal protein L11 methyltransferase	1.00e-07	NA	NA	0.6959
6. F	P0CS09	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	2.49e-04	NA	NA	0.449
6. F	A9KXQ5	tRNA (guanine-N(7)-)-methyltransferase	8.43e-05	NA	NA	0.5451
6. F	B5E522	Ribosomal RNA small subunit methyltransferase G	2.60e-08	NA	NA	0.6646
6. F	A0A0H2ZHV3	L-histidine 2-aminobutanoyltransferase	1.26e-06	NA	NA	0.6185
6. F	A6QQV6	Protein arginine N-methyltransferase 7	4.84e-02	NA	NA	0.5106
6. F	Q2K6E0	Ribosomal protein L11 methyltransferase	1.35e-09	NA	NA	0.7336
6. F	Q12KQ0	tRNA (guanine-N(7)-)-methyltransferase	8.44e-05	NA	NA	0.4883
6. F	B5YSY4	Ribosomal protein L11 methyltransferase	7.20e-08	NA	NA	0.7283
6. F	A1AI22	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.18e-05	NA	NA	0.4952
6. F	Q8DPZ3	Release factor glutamine methyltransferase	6.87e-07	NA	NA	0.5663
6. F	B2RJE9	Demethylmenaquinone methyltransferase	1.09e-05	NA	NA	0.5399
6. F	A3MQI8	Ribosomal RNA small subunit methyltransferase G	6.42e-08	NA	NA	0.6498
6. F	Q4JSC5	Ribosomal RNA small subunit methyltransferase G	7.03e-07	NA	NA	0.6467
6. F	A3MWC5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	3.71e-11	NA	NA	0.5982
6. F	A9R7L5	Ribosomal RNA large subunit methyltransferase K/L	5.79e-03	NA	NA	0.5697
6. F	A5UGF0	tRNA (guanine-N(7)-)-methyltransferase	6.86e-05	NA	NA	0.5555
6. F	Q643C8	Phenylpyruvate C(3)-methyltransferase	2.63e-07	NA	NA	0.5956
6. F	Q2NJ22	Ribosomal RNA small subunit methyltransferase G	4.09e-09	NA	NA	0.719
6. F	Q0HXA4	tRNA (guanine-N(7)-)-methyltransferase	7.40e-05	NA	NA	0.4719
6. F	C1CG04	Ribosomal protein L11 methyltransferase	1.72e-08	NA	NA	0.7
6. F	A1S4D3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.27e-07	NA	NA	0.7081
6. F	C1CMA0	Ribosomal protein L11 methyltransferase	2.82e-08	NA	NA	0.7109
6. F	B1YGA6	Ribosomal RNA small subunit methyltransferase G	9.88e-09	NA	NA	0.6944
6. F	Q5X7R0	tRNA (guanine-N(7)-)-methyltransferase	1.48e-04	NA	NA	0.494
6. F	B0JX03	Ribosomal protein L11 methyltransferase	1.20e-09	NA	NA	0.6659
6. F	Q8PHF4	tRNA (guanine-N(7)-)-methyltransferase	1.16e-04	NA	NA	0.5442
6. F	L0E172	Methyltransferase phqN	5.21e-05	NA	NA	0.4113
6. F	Q5PMK3	tRNA (guanine-N(7)-)-methyltransferase	8.74e-05	NA	NA	0.4894
6. F	Q0VLC7	tRNA (guanine-N(7)-)-methyltransferase	9.23e-05	NA	NA	0.5445
6. F	Q5N2N4	Ribosomal RNA small subunit methyltransferase G	8.36e-08	NA	NA	0.6609
6. F	Q0SZ25	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.19e-05	NA	NA	0.4957
6. F	B9KQJ8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.13e-05	NA	NA	0.5297
6. F	A8ACY2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.66e-05	NA	NA	0.4962
6. F	B2TUD1	Ribosomal RNA large subunit methyltransferase K/L	6.22e-03	NA	NA	0.4846
6. F	Q5SHW1	tRNA (guanine-N(7)-)-methyltransferase	2.90e-04	NA	NA	0.5608
6. F	A7GVP5	Ribosomal RNA small subunit methyltransferase G	1.05e-08	NA	NA	0.6968
6. F	Q7SHI7	Methyltransferase srdJ	4.00e-06	NA	NA	0.5891
6. F	Q57QU1	Ribosomal RNA large subunit methyltransferase K/L	8.61e-03	NA	NA	0.5835
6. F	A8FSK8	tRNA (guanine-N(7)-)-methyltransferase	7.69e-05	NA	NA	0.5082
6. F	C3P8L8	Ribosomal protein L11 methyltransferase	1.13e-10	NA	NA	0.7655
6. F	C3L5R5	Ribosomal protein L11 methyltransferase	1.13e-10	NA	NA	0.7843
6. F	Q47WQ1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.25e-07	NA	NA	0.7232
6. F	Q65VT5	tRNA (guanine-N(7)-)-methyltransferase	8.75e-05	NA	NA	0.554
6. F	Q3ZXE0	Ribosomal RNA small subunit methyltransferase G	2.70e-08	NA	NA	0.6504
6. F	B2IH12	Ribosomal protein L11 methyltransferase	2.86e-09	NA	NA	0.6861
6. F	B7IST2	Ribosomal RNA small subunit methyltransferase G	1.57e-08	NA	NA	0.7008
6. F	C4ZSZ5	Ribosomal protein L11 methyltransferase	7.07e-08	NA	NA	0.6855
6. F	Q63SZ9	50S ribosomal protein L3 glutamine methyltransferase	5.33e-06	NA	NA	0.528
6. F	B0TJD3	tRNA (guanine-N(7)-)-methyltransferase	8.17e-05	NA	NA	0.4948
6. F	A6WR37	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.47e-07	NA	NA	0.7122
6. F	Q5ZIB9	Protein arginine N-methyltransferase 7	5.14e-02	NA	NA	0.5061
6. F	Q73IR3	Ribosomal RNA small subunit methyltransferase A	2.30e-04	NA	NA	0.5429
6. F	Q47HS4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.17e-08	NA	NA	0.7483
6. F	O25443	tRNA (guanine-N(7)-)-methyltransferase	1.59e-02	NA	NA	0.561
6. F	B7MC29	Ribosomal protein L11 methyltransferase	6.98e-08	NA	NA	0.7285
6. F	Q1CB91	tRNA (guanine-N(7)-)-methyltransferase	7.82e-05	NA	NA	0.5367
6. F	Q2RFW1	Release factor glutamine methyltransferase	1.73e-08	NA	NA	0.5496
6. F	B1XHM8	Ribosomal protein L11 methyltransferase	6.97e-08	NA	NA	0.7282
6. F	B1YKT1	Ribosomal protein L11 methyltransferase	1.70e-10	NA	NA	0.787
6. F	Q89DG5	50S ribosomal protein L3 glutamine methyltransferase	2.79e-06	NA	NA	0.6109
6. F	Q0AQC3	Ribosomal RNA small subunit methyltransferase A	7.13e-05	NA	NA	0.4971
6. F	P0A889	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.85e-05	NA	NA	0.4886
6. F	Q7VKC4	Ribosomal RNA small subunit methyltransferase B	7.53e-06	NA	NA	0.5415
6. F	B2I9C6	tRNA (guanine-N(7)-)-methyltransferase	9.00e-05	NA	NA	0.51
6. F	Q8DY64	Ribosomal RNA small subunit methyltransferase G	4.03e-08	NA	NA	0.7133
6. F	A7MTN8	tRNA (guanine-N(7)-)-methyltransferase	6.70e-05	NA	NA	0.5114
6. F	P46326	Uncharacterized protein YxbB	3.08e-04	NA	NA	0.5263
6. F	Q1CBG0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.22e-05	NA	NA	0.498
6. F	Q7MZ81	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.74e-05	NA	NA	0.517
6. F	O66506	Release factor glutamine methyltransferase	2.18e-08	NA	NA	0.5579
6. F	P0A294	50S ribosomal protein L3 glutamine methyltransferase	8.28e-04	NA	NA	0.5441
6. F	A0AMC5	Ribosomal RNA small subunit methyltransferase G	1.15e-08	NA	NA	0.6994
6. F	A6WQU4	tRNA (guanine-N(7)-)-methyltransferase	6.94e-05	NA	NA	0.5456
6. F	Q9CHX0	Release factor glutamine methyltransferase	5.26e-07	NA	NA	0.5699
6. F	A9KYI1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.97e-07	NA	NA	0.7113
6. F	Q7N7H9	tRNA (guanine-N(7)-)-methyltransferase	7.42e-05	NA	NA	0.4886
6. F	A3D707	tRNA (guanine-N(7)-)-methyltransferase	7.32e-05	NA	NA	0.5451
6. F	Q3KKL0	tRNA (guanine-N(7)-)-methyltransferase	1.41e-06	NA	NA	0.5461
6. F	Q7MYI0	Ribosomal RNA small subunit methyltransferase B	6.02e-06	NA	NA	0.6352
6. F	C3LPS5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.83e-05	NA	NA	0.4955
6. F	A9WBM9	Release factor glutamine methyltransferase	1.23e-07	NA	NA	0.5495
6. F	Q60A25	Ribosomal protein L11 methyltransferase	1.95e-09	NA	NA	0.6927
6. F	Q9L7M3	Ribosomal RNA small subunit methyltransferase G	1.55e-06	NA	NA	0.5923
6. F	A5PKL6	Glutathione S-transferase C-terminal domain-containing protein	9.38e-03	NA	NA	0.7574
6. F	C1ESK6	Ribosomal protein L11 methyltransferase	1.16e-10	NA	NA	0.7661
6. F	Q5E3U5	50S ribosomal protein L3 glutamine methyltransferase	2.47e-06	NA	NA	0.5059
6. F	B7H3N1	Ribosomal RNA small subunit methyltransferase G	9.04e-08	NA	NA	0.6823
6. F	Q6D459	Ribosomal RNA large subunit methyltransferase K/L	5.93e-03	NA	NA	0.5996
6. F	Q6LML0	tRNA (guanine-N(7)-)-methyltransferase	6.39e-05	NA	NA	0.4868
6. F	Q5FI43	Ribosomal RNA small subunit methyltransferase G	1.86e-08	NA	NA	0.64
6. F	Q74HM3	Ribosomal RNA small subunit methyltransferase G	2.10e-08	NA	NA	0.6581
6. F	Q1R669	Ribosomal protein L11 methyltransferase	7.34e-08	NA	NA	0.7283
6. F	A4W8W0	Ribosomal RNA large subunit methyltransferase K/L	5.85e-03	NA	NA	0.4771
6. F	A8MKR7	Ribosomal RNA small subunit methyltransferase G	1.34e-08	NA	NA	0.7105
6. F	Q9KUR2	tRNA (guanine-N(7)-)-methyltransferase	5.80e-05	NA	NA	0.5059
6. F	A0QND0	Ribosomal RNA small subunit methyltransferase G	1.26e-06	NA	NA	0.617
6. F	Q97QD4	Ribosomal RNA small subunit methyltransferase G	2.70e-08	NA	NA	0.665
6. F	Q9I347	50S ribosomal protein L3 glutamine methyltransferase	1.20e-04	NA	NA	0.5087
6. F	Q8ZHE9	tRNA (guanine-N(7)-)-methyltransferase	7.97e-05	NA	NA	0.5243
6. F	B8ZMW2	Ribosomal protein L11 methyltransferase	1.64e-08	NA	NA	0.6947
6. F	A0KS74	Ribosomal protein L11 methyltransferase	1.32e-07	NA	NA	0.7261
6. F	Q6F9P9	Ribosomal protein L11 methyltransferase	1.21e-07	NA	NA	0.735
6. F	A9AWD7	(+)-O-methylkolavelool synthase	1.00e-06	NA	NA	0.4578
6. F	B7GQ70	Ribosomal RNA small subunit methyltransferase H	2.55e-03	NA	NA	0.4996
6. F	A9MCZ2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.31e-05	NA	NA	0.5362
6. F	B2K0Y4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.23e-05	NA	NA	0.4964
6. F	A6WYI0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.95e-05	NA	NA	0.5244
6. F	A7MXM2	tRNA1(Val) (adenine(37)-N6)-methyltransferase	2.74e-08	NA	NA	0.6517
6. F	A6UFF7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.37e-05	NA	NA	0.5264
6. F	A4VZL7	Ribosomal RNA small subunit methyltransferase G	3.79e-08	NA	NA	0.6421
6. F	A9AJF2	Ribosomal RNA small subunit methyltransferase G	5.31e-08	NA	NA	0.6515
6. F	A8AID1	Ribosomal RNA large subunit methyltransferase K/L	9.44e-03	NA	NA	0.6182
6. F	Q73NM2	tRNA (guanine-N(7)-)-methyltransferase	6.31e-05	NA	NA	0.5244
6. F	Q0I1Y6	Ribosomal protein L11 methyltransferase	9.22e-08	NA	NA	0.6927
6. F	C1KVB8	Ribosomal protein L11 methyltransferase	1.76e-10	NA	NA	0.7344
6. F	B2TVI4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.91e-05	NA	NA	0.4957
6. F	A5IHB4	tRNA (guanine-N(7)-)-methyltransferase	8.48e-05	NA	NA	0.4546
6. F	Q65W50	tRNA1(Val) (adenine(37)-N6)-methyltransferase	2.57e-05	NA	NA	0.6485
6. F	Q88VP9	Ribosomal protein L11 methyltransferase	1.56e-08	NA	NA	0.7208
6. F	A5FR82	Ribosomal RNA small subunit methyltransferase G	2.88e-08	NA	NA	0.6464
6. F	B5YY82	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.75e-05	NA	NA	0.4957
6. F	G2K044	Ribosomal protein L11 methyltransferase	1.70e-10	NA	NA	0.7335
6. F	Q0K7S5	tRNA (guanine-N(7)-)-methyltransferase	3.09e-04	NA	NA	0.5051
6. F	P39200	50S ribosomal protein L3 glutamine methyltransferase	2.63e-06	NA	NA	0.5082
6. F	A9ILA7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.98e-05	NA	NA	0.5219
6. F	Q12S23	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.24e-05	NA	NA	0.5016
6. F	A7MTX1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.98e-05	NA	NA	0.4887
6. F	Q3YS70	Ribosomal RNA small subunit methyltransferase A	2.10e-05	NA	NA	0.5268
6. F	B2RK25	tRNA1(Val) (adenine(37)-N6)-methyltransferase	1.11e-08	NA	NA	0.5977
6. F	Q46J33	Ribosomal RNA small subunit methyltransferase G	9.69e-08	NA	NA	0.7035
6. F	A4FG18	Geranyl diphosphate 2-C-methyltransferase	3.60e-06	NA	NA	0.5098
6. F	B2HNT4	Ribosomal RNA small subunit methyltransferase G	8.34e-07	NA	NA	0.644
6. F	B5XND9	Ribosomal protein L11 methyltransferase	6.76e-08	NA	NA	0.729
6. F	A0K1I7	tRNA (guanine-N(7)-)-methyltransferase	1.54e-03	NA	NA	0.5887
6. F	B8ZTN3	Ribosomal RNA small subunit methyltransferase G	1.32e-06	NA	NA	0.5984
6. F	A7MXI3	Ribosomal protein L11 methyltransferase	1.30e-07	NA	NA	0.7001
6. F	B2U7E2	tRNA (guanine-N(7)-)-methyltransferase	2.90e-04	NA	NA	0.5565
6. F	C0MG47	Ribosomal RNA small subunit methyltransferase G	2.87e-08	NA	NA	0.6616
6. F	A4WVR7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	5.69e-05	NA	NA	0.5229
6. F	Q9K5M8	Ribosomal RNA small subunit methyltransferase G	1.08e-08	NA	NA	0.7178
6. F	B2U2N5	Ribosomal protein L11 methyltransferase	6.97e-08	NA	NA	0.7282
6. F	Q665E3	Ribosomal protein L11 methyltransferase	7.90e-08	NA	NA	0.6922
6. F	B8F6T6	Ribosomal protein L11 methyltransferase	7.69e-08	NA	NA	0.6909
6. F	Q8KG70	Ribosomal protein L11 methyltransferase	1.16e-08	NA	NA	0.737
6. F	Q31UF3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.55e-05	NA	NA	0.4962
6. F	A7FEX6	tRNA (guanine-N(7)-)-methyltransferase	7.11e-05	NA	NA	0.5418
6. F	B4TDY8	Ribosomal RNA large subunit methyltransferase K/L	8.64e-03	NA	NA	0.489
6. F	Q0HEA1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.68e-05	NA	NA	0.5336
6. F	B9JZF4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.45e-04	NA	NA	0.5495
6. F	B0U6V1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.34e-05	NA	NA	0.5076
6. F	C5D9Y5	Ribosomal RNA small subunit methyltransferase G	1.02e-08	NA	NA	0.6541
6. F	A6TGL3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.90e-05	NA	NA	0.4965
6. F	Q8DD03	Ribosomal protein L11 methyltransferase	1.50e-07	NA	NA	0.7009
6. F	Q62FS7	Ribosomal RNA small subunit methyltransferase G	7.03e-08	NA	NA	0.6796
6. F	B7M638	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.00e-05	NA	NA	0.4973
6. F	Q97P62	Ribosomal protein L11 methyltransferase	1.51e-08	NA	NA	0.7011
6. F	O26249	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.31e-09	NA	NA	0.5638
6. F	Q926V6	Ribosomal RNA small subunit methyltransferase G	1.09e-08	NA	NA	0.7082
6. F	A8H1J9	tRNA (guanine-N(7)-)-methyltransferase	7.61e-05	NA	NA	0.4929
6. F	Q5SKN4	tRNA (adenine(58)-N(1))-methyltransferase TrmI	1.79e-07	NA	NA	0.6021
6. F	A1VRF7	tRNA (guanine-N(7)-)-methyltransferase	2.90e-04	NA	NA	0.5517
6. F	P96188	Modification methylase XamI	1.06e-04	NA	NA	0.4875
6. F	A7ZSF3	Ribosomal protein L11 methyltransferase	6.75e-08	NA	NA	0.7283
6. F	Q2STD8	Ribosomal RNA small subunit methyltransferase G	6.81e-08	NA	NA	0.6553
6. F	B5YT79	Ribosomal RNA large subunit methyltransferase K/L	6.43e-03	NA	NA	0.6217
6. F	B2S6P1	Ribosomal protein L11 methyltransferase	3.62e-09	NA	NA	0.7204
6. F	P37543	Uncharacterized protein YabB	3.15e-06	NA	NA	0.5661
6. F	A4VGE5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.23e-05	NA	NA	0.4903
6. F	B6J3A6	Ribosomal RNA small subunit methyltransferase A	1.19e-05	NA	NA	0.558
6. F	Q2S4C3	Ribosomal protein L11 methyltransferase	1.88e-10	NA	NA	0.7909
6. F	Q7MVG0	tRNA1(Val) (adenine(37)-N6)-methyltransferase	1.11e-08	NA	NA	0.5773
6. F	Q38XP2	Ribosomal protein L11 methyltransferase	2.08e-09	NA	NA	0.7635
6. F	Q32B79	Ribosomal protein L11 methyltransferase	6.99e-08	NA	NA	0.7281
6. F	Q66FT0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.36e-05	NA	NA	0.4658
6. F	Q2P0J4	tRNA (guanine-N(7)-)-methyltransferase	1.42e-04	NA	NA	0.5473
6. F	B3PTU0	Ribosomal protein L11 methyltransferase	8.53e-10	NA	NA	0.7636
6. F	Q03ZA4	Ribosomal RNA small subunit methyltransferase G	1.83e-08	NA	NA	0.6548
6. F	C4LAF1	Ribosomal protein L11 methyltransferase	1.18e-07	NA	NA	0.742
6. F	B9JH32	Ribosomal protein L11 methyltransferase	1.05e-09	NA	NA	0.7455
6. F	B7H0I7	Ribosomal protein L11 methyltransferase	6.44e-08	NA	NA	0.7103
6. F	B5FNW6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.21e-05	NA	NA	0.4616
6. F	B2JYS1	Ribosomal RNA large subunit methyltransferase K/L	5.73e-03	NA	NA	0.5695
6. F	A7GJN7	Ribosomal RNA small subunit methyltransferase G	1.11e-08	NA	NA	0.6244
6. F	Q5L5A2	tRNA (guanine-N(7)-)-methyltransferase	1.73e-06	NA	NA	0.5219
6. F	Q5GXE4	tRNA (guanine-N(7)-)-methyltransferase	1.37e-04	NA	NA	0.543
6. F	F6CY50	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.49e-07	NA	NA	0.6655
6. F	A1JRL5	Ribosomal protein L11 methyltransferase	7.23e-08	NA	NA	0.7433
6. F	B1IW72	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.20e-05	NA	NA	0.4954
6. F	Q5E6A4	tRNA U34 carboxymethyltransferase	7.22e-07	NA	NA	0.514
6. F	A6TXE3	Ribosomal RNA small subunit methyltransferase G	1.96e-08	NA	NA	0.6995
6. F	A0RIT1	Ribosomal protein L11 methyltransferase	1.11e-10	NA	NA	0.7826
6. F	C6VS84	tRNA1(Val) (adenine(37)-N6)-methyltransferase	2.24e-06	NA	NA	0.6317
6. F	A4Y2Q5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.18e-05	NA	NA	0.5426
6. F	G0FUS0	27-O-demethylrifamycin SV methyltransferase	2.90e-07	NA	NA	0.5672
6. F	A9KGZ8	Ribosomal RNA small subunit methyltransferase A	1.40e-05	NA	NA	0.5705
6. F	Q65CN3	Ribosomal RNA small subunit methyltransferase G	1.69e-08	NA	NA	0.6988
6. F	Q5E7Q6	tRNA1(Val) (adenine(37)-N6)-methyltransferase	7.67e-07	NA	NA	0.6299
6. F	Q086B4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.42e-07	NA	NA	0.7273
6. F	A4IR29	Ribosomal protein L11 methyltransferase	1.13e-10	NA	NA	0.7712
6. F	B7VM52	Ribosomal protein L11 methyltransferase	1.11e-07	NA	NA	0.7018
6. F	A5IJ79	Ribosomal RNA small subunit methyltransferase G	1.12e-07	NA	NA	0.6449
6. F	Q2JRH1	tRNA (guanine-N(7)-)-methyltransferase	2.12e-06	NA	NA	0.5654
6. F	Q98GV1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.25e-05	NA	NA	0.535