Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54776.1
JCVISYN3A_0412
Uncharacterized protein.
M. mycoides homolog: Q6MTD5.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 23
Unique PROST Go: 9
Unique BLAST Go: 1
Unique Foldseek Go: 5
Total Homologs: 103
Unique PROST Homologs: 3
Unique BLAST Homologs: 14
Unique Foldseek Homologs: 60
Structures and Sequence Alignment
The best structural homolog that predicted by 3. BF was
D2RLC8
(Protein translocase subunit SecD) with a FATCAT P-Value: 2.88e-05 and RMSD of 4.85 angstrom. The sequence alignment identity is 9.2%.
Structural alignment shown in left. Query protein AVX54776.1 colored as red in alignment, homolog D2RLC8 colored as blue.
Query protein AVX54776.1 is also shown in right top, homolog D2RLC8 showed in right bottom. They are colored based on secondary structures.
AVX54776.1 MKNRLASFKKVLRFIIVLILILALLTGIGFSSYKISNNISYGAKFVGGYQALVGVYDKTKNQEEEIPNGDAFKGAQSLEKKLSPFSDNTIETQQSGLSRV 100 D2RLC8 ---------------------------------------------------------------------------------------------------- 0 AVX54776.1 FIKASKKAYANNQDDFKNAIERTGGLFILDKNYQDIFFNENLMKIIGIDKVYDSSSDKRVAKKLTLEEFLGEAKAESLQPANFSNKNSPFVSFNLKNDYL 200 D2RLC8 ---------------------------------------------------------------------------------------------------- 0 AVX54776.1 KNLIDPKKNKDNNALTMITSVGHIIENLRTYYKKANSTNN-QVVEQYLNTY--FNQIIKPIQDYISS-KASSDPLGVKILKDLFTIEYSVPTTEGSQKNL 296 D2RLC8 ----------------------------------MESKNRAKLLVSVLAIVIAFAVFIKPL---VSTVKQ-----GL----DL---------QGGTHVVL 45 AVX54776.1 NIQRN--SLVDSDIVKWWNSN----SKGKIDNTKDLKYVLFG-TDNLNNKR-SDH-IFRFTNSANKYIYD-ANASE---K----DFIKDDKGN---VGKY 376 D2RLC8 QAQETPESKVDDDAI---NRSIQIISR-RV-N--EL-----GLTEPVIQRQGKDKIIVELPG-----VKDPEQAIAMLGKTAMLEF-KDMEGNTVLTGK- 126 AVX54776.1 YNKLKISSDNSTSQDIELDYIDKVSNSLIKILMTEILFKKDTTDK--DYVVNKNLDQNLFRNNILLHNNQIS-PENIRI---VTTNPAIVT---DRKTQT 467 D2RLC8 --DLK---DSKAS-------ADQSGQPVV----T-LQFNEDGAKKFAD-LTARNVGRQIA---ILLDGKVLTAP---RVSEPITGGNAQITGSKDAK-EA 201 AVX54776.1 TKLYIPVWSNTMAKQVESDIL--QT---SLGFTFKVLSIKEFSADITTIMLIITLACLVILALAVLVFMLFSYRLLGLFA---------IILA---AISA 550 D2RLC8 EHLAILLRSGSLPVKLE--VVENRTVGPTLGQDAKDASMKAFA---------IGLA-------GVFLFMLLYYRLSGLVADIVLLLYTLLLLAVMKGLNA 283 AVX54776.1 SLTMFVPIIFNMAIGPEIFMIMFVGIGLILDASIIYFENLKTHIYKEK-LSPE--SSFKISNKDTLPISLDTSFIILIPSVLLFIFGSGALKNLA-TISV 646 D2RLC8 TLT--LP---GMA-G------IILSIGMAVDANVLIFERFKEEIANGKTLRAAVNSGF--SRAFT-TI-LDSNVTTLMAAAVLFYLGTGPIKGFAVTLA- 366 AVX54776.1 INILIIILFVILGLRLLTWLVLKAKLFTKYPWLLPLNTIKNSQSTWFNDLMLSFYLSRIENLNTKTKLTTK-DLAKLKKFKDKYDFYLNKQEQIITNKKL 745 D2RLC8 LGVL-ISMFTAV---TVTKFILGA--------LIGSNFTKN--PAWFG--AKAF--------QPKAK-DGKGEAAR------------------------ 417 AVX54776.1 KQLKKDQHNLELVNKRLLKLENKYEIYLNKQEQINNNKKAKILKKKKSEEIKNKYLLKLENKKQKIINKNSFTKSSIKNSLIKQEFLQARINSNTSSQVL 845 D2RLC8 ---------------------------------------------------------------------------------------------------- 417 AVX54776.1 ETLENKNKQRRIFKINKIFTIIFIICTFLGAIIGITIGPNYNSSFGKSYSVIAYGQKINDIYDNLDEAIRNYKQFDPSTKRGKDIISMGEHLEKVKNSQD 945 D2RLC8 ---------------------------------------------------------------------------------------------------- 417 AVX54776.1 AYMKSKFKVDYSNLTKPSDKNQWASYVVGNIYKEIVKKNYVSLWKNPVSYNKYFRASVDVDYGYDFIDTNSLNLDHKQLAYVGFNIINAQDNKIISIFEK 1045 D2RLC8 ---------------------------------------------------------------------------------------------------- 417 AVX54776.1 LLVKDNLQNPDLSIKYDHDDNSSANGIINLINVPYTAYGEIKNIAIIFAITLLALLVYILIRFKWTYFVALALTLILVIVLVSSLVVIFRVPVGIEILSA 1145 D2RLC8 ---------------------------------------------------------------------------------------------------- 417 AVX54776.1 ILAVLSFTIITCVLFLGKGKSIIKSKDNKTFTEMFEKEIIAFSNKKATRHQVHEKNHQLKVEYKTNKKNLIKQQIEQNNIKSWWSKIFFKLKQNIKLRFN 1245 D2RLC8 ---------------------------------------------------------------------------------------------------- 417 AVX54776.1 KKDNSMYKDFKLKIKENKNILKHHKKHTKIEIDLIANNNAFLKETFINVFKFGISRTVLITVIYLAYAIILSFGLYAIIGMGLTIIIGILIASLVSLFIA 1345 D2RLC8 ---------------------------------------------------------------------------------------------------- 417 AVX54776.1 LPIWIWLEKKRMIYVLGYRYYVQNFKINQEEQIINGIND 1384 D2RLC8 --------------------------------------- 417
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0015450 | protein-transporting ATPase activity |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0065002 | intracellular protein transmembrane transport |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0043952 | protein transport by the Sec complex |
| 1. PBF | GO:0006605 | protein targeting |
| 2. PF | GO:0042910 | xenobiotic transmembrane transporter activity |
| 3. BF | GO:0015031 | protein transport |
| 5. P | GO:0030659 | cytoplasmic vesicle membrane |
| 5. P | GO:0045665 | negative regulation of neuron differentiation |
| 5. P | GO:0031965 | nuclear membrane |
| 5. P | GO:2000179 | positive regulation of neural precursor cell proliferation |
| 5. P | GO:0045834 | positive regulation of lipid metabolic process |
| 5. P | GO:0042632 | cholesterol homeostasis |
| 5. P | GO:0008203 | cholesterol metabolic process |
| 5. P | GO:0032368 | regulation of lipid transport |
| 5. P | GO:0007224 | smoothened signaling pathway |
| 6. F | GO:0022857 | transmembrane transporter activity |
| 6. F | GO:0008324 | cation transmembrane transporter activity |
| 6. F | GO:0042908 | xenobiotic transport |
| 6. F | GO:0046686 | response to cadmium ion |
| 6. F | GO:0006825 | copper ion transport |
| 7. B | GO:0000469 | cleavage involved in rRNA processing |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0005886 | plasma membrane |
| GO:0016021 | integral component of membrane |
| GO:0016020 | membrane |
| GO:0015031 | protein transport |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | O32047 | Protein translocase subunit SecDF | 6.44e-03 | 1.76e-11 | 3.98e-11 | 0.5769 |
| 2. PF | O31501 | Swarming motility protein SwrC | 9.80e-04 | 4.70e-02 | NA | 0.3352 |
| 2. PF | Q5SKE6 | Protein translocase subunit SecDF | 2.49e-02 | 1.56e-08 | NA | 0.6629 |
| 2. PF | Q49409 | Uncharacterized protein MG277 | 7.43e-05 | 5.05e-03 | NA | 0.1878 |
| 3. BF | B8E2N3 | Protein translocase subunit SecD | 2.11e-04 | NA | 7.56e-07 | 0.5483 |
| 3. BF | Q92H77 | Protein translocase subunit SecD | 8.18e-03 | NA | 8.72e-06 | 0.4007 |
| 3. BF | Q55610 | Protein translocase subunit SecD | 1.25e-03 | NA | 0.013 | 0.4745 |
| 3. BF | C8WQG7 | Protein translocase subunit SecD | 7.75e-04 | NA | 8.34e-10 | 0.5584 |
| 3. BF | B0CEA7 | Protein translocase subunit SecD | 3.04e-03 | NA | 0.007 | 0.443 |
| 3. BF | Q53955 | Protein translocase subunit SecD | 6.69e-03 | NA | 1.22e-05 | 0.3783 |
| 3. BF | D2RLC8 | Protein translocase subunit SecD | 2.88e-05 | NA | 3.39e-04 | 0.5394 |
| 3. BF | Q1RIN3 | Protein translocase subunit SecD | 6.81e-03 | NA | 8.24e-06 | 0.3997 |
| 3. BF | E4TJ18 | Protein translocase subunit SecD | 1.16e-02 | NA | 0.001 | 0.3533 |
| 3. BF | P0AG92 | Protein translocase subunit SecD | 2.88e-02 | NA | 0.015 | 0.3209 |
| 3. BF | O26073 | Protein translocase subunit SecF | 1.02e-02 | NA | 2.81e-04 | 0.5135 |
| 3. BF | Q9ZFF8 | Protein translocase subunit SecD | 2.73e-02 | NA | 3.17e-04 | 0.3229 |
| 3. BF | D1AMK9 | Protein translocase subunit SecD | 4.02e-04 | NA | 1.75e-04 | 0.522 |
| 3. BF | D1CDJ5 | Protein translocase subunit SecD | 6.27e-03 | NA | 0.012 | 0.4397 |
| 3. BF | E6W4K8 | Protein translocase subunit SecD | 3.91e-03 | NA | 5.04e-05 | 0.3794 |
| 3. BF | C7JGJ8 | Protein translocase subunit SecD | 9.99e-03 | NA | 0.016 | 0.3635 |
| 3. BF | Q4UKW3 | Protein translocase subunit SecD | 6.11e-03 | NA | 1.07e-05 | 0.4015 |
| 3. BF | P44591 | Protein translocase subunit SecD | 9.05e-03 | NA | 0.034 | 0.3179 |
| 3. BF | E8N5I8 | Protein translocase subunit SecD | 6.50e-03 | NA | 5.64e-04 | 0.4514 |
| 3. BF | Q55611 | Protein translocase subunit SecF | 9.10e-03 | NA | 0.002 | 0.6004 |
| 3. BF | Q9ZJ65 | Protein translocase subunit SecF | 9.47e-03 | NA | 4.45e-04 | 0.528 |
| 3. BF | Q9ZCW8 | Protein translocase subunit SecD | 7.05e-03 | NA | 8.42e-04 | 0.392 |
| 5. P | Q2YNM0 | Protein translocase subunit SecDF | 2.41e-04 | 3.77e-06 | NA | NA |
| 5. P | P0C117 | Protein translocase subunit SecDF | 8.72e-03 | 3.77e-06 | NA | NA |
| 5. P | Q9P2K9 | Protein dispatched homolog 3 | 1.14e-02 | 1.80e-02 | NA | NA |
| 6. F | D0ZEW1 | Multidrug resistance protein MdtB | 1.02e-04 | NA | NA | 0.3451 |
| 6. F | Q9ZHC9 | Putative cation efflux system protein SilA | 2.25e-04 | NA | NA | 0.3532 |
| 6. F | A7ZNP9 | Multidrug resistance protein MdtC | 1.59e-04 | NA | NA | 0.3741 |
| 6. F | Q1RH99 | Protein translocase subunit SecF | 1.38e-03 | NA | NA | 0.6118 |
| 6. F | D0JNB0 | Multidrug resistance protein MdtB | 9.70e-05 | NA | NA | 0.3635 |
| 6. F | B5RBW9 | Multidrug resistance protein MdtC | 2.43e-03 | NA | NA | 0.3766 |
| 6. F | P25197 | Nodulation protein NolG | 1.99e-03 | NA | NA | 0.3751 |
| 6. F | B1H0M4 | Protein translocase subunit SecD | 6.29e-03 | NA | NA | 0.4388 |
| 6. F | P94177 | Cation efflux system protein CzcA | 9.82e-04 | NA | NA | 0.3247 |
| 6. F | B0CEA6 | Protein translocase subunit SecF | 1.77e-02 | NA | NA | 0.5432 |
| 6. F | P38387 | Protein translocase subunit SecD | 1.28e-02 | NA | NA | 0.3553 |
| 6. F | A6TBH4 | Multidrug resistance protein MdtB | 2.87e-04 | NA | NA | 0.3512 |
| 6. F | P9WGP0 | Protein translocase subunit SecD | 4.42e-03 | NA | NA | 0.3507 |
| 6. F | C1A8P2 | Protein translocase subunit SecD | 9.75e-03 | NA | NA | 0.3812 |
| 6. F | D3V7P3 | Multidrug resistance protein MdtB | 9.75e-05 | NA | NA | 0.3191 |
| 6. F | A8F0L9 | Protein translocase subunit SecF | 4.81e-03 | NA | NA | 0.5913 |
| 6. F | Q668C6 | Multidrug resistance protein MdtB | 2.27e-04 | NA | NA | 0.352 |
| 6. F | F2EYE0 | Multidrug resistance protein MdtC | 1.38e-04 | NA | NA | 0.3849 |
| 6. F | Q7N3E2 | Multidrug resistance protein MdtB | 5.78e-04 | NA | NA | 0.3327 |
| 6. F | A8GHQ9 | Multidrug resistance protein MdtB | 1.69e-04 | NA | NA | 0.3314 |
| 6. F | C6CAI2 | Multidrug resistance protein MdtB | 2.30e-04 | NA | NA | 0.3573 |
| 6. F | C7NC37 | Protein translocase subunit SecD | 2.52e-04 | NA | NA | 0.5057 |
| 6. F | C5BHN3 | Multidrug resistance protein MdtC | 1.00e-04 | NA | NA | 0.3671 |
| 6. F | B6HYS1 | Multidrug resistance protein MdtC | 2.14e-04 | NA | NA | 0.3749 |
| 6. F | C5A3H4 | Protein-export membrane protein SecD | 2.38e-03 | NA | NA | 0.3586 |
| 6. F | Q8XBY1 | Cation efflux system protein CusA | 2.46e-04 | NA | NA | 0.3506 |
| 6. F | Q57MM4 | Multidrug resistance protein MdtC | 1.43e-04 | NA | NA | 0.3852 |
| 6. F | A8EXI0 | Protein translocase subunit SecF | 7.57e-03 | NA | NA | 0.5986 |
| 6. F | B5XPB8 | Multidrug resistance protein MdtC | 4.25e-04 | NA | NA | 0.3697 |
| 6. F | Q53956 | Protein translocase subunit SecF | 1.27e-02 | NA | NA | 0.5192 |
| 6. F | Q83KI4 | Multidrug resistance protein MdtC | 3.15e-04 | NA | NA | 0.3429 |
| 6. F | B1XQC0 | Protein translocase subunit SecF | 8.76e-03 | NA | NA | 0.577 |
| 6. F | Q6D2B0 | Multidrug resistance protein MdtC | 1.49e-04 | NA | NA | 0.3628 |
| 6. F | B4TNI7 | Multidrug resistance protein MdtC | 1.85e-04 | NA | NA | 0.37 |
| 6. F | Q3Z0C8 | Multidrug resistance protein MdtC | 1.29e-03 | NA | NA | 0.3318 |
| 6. F | Q68XY2 | Protein translocase subunit SecF | 9.86e-04 | NA | NA | 0.5575 |
| 6. F | P38386 | Protein translocase subunit SecF | 6.13e-03 | NA | NA | 0.373 |
| 6. F | A8GM76 | Protein translocase subunit SecF | 7.48e-03 | NA | NA | 0.5674 |
| 6. F | Q8FWV9 | Efflux pump membrane transporter BepG | 6.68e-04 | NA | NA | 0.3433 |
| 6. F | B7NCB2 | Multidrug resistance protein MdtC | 5.61e-04 | NA | NA | 0.3644 |
| 6. F | Q8ZCV9 | Multidrug resistance protein MdtC | 1.18e-04 | NA | NA | 0.3796 |
| 6. F | P0AG94 | Protein translocase subunit SecF | 2.04e-02 | NA | NA | 0.5485 |
| 6. F | Q8U4B4 | Protein-export membrane protein SecD | 3.04e-03 | NA | NA | 0.4122 |
| 6. F | Q7N3E1 | Multidrug resistance protein MdtC | 1.30e-04 | NA | NA | 0.3442 |
| 6. F | O51597 | Protein translocase subunit SecF | 3.21e-03 | NA | NA | 0.5842 |
| 6. F | P37972 | Nickel and cobalt resistance protein CnrA | 4.37e-04 | NA | NA | 0.3175 |
| 6. F | Q4UKA5 | Protein translocase subunit SecF | 2.66e-03 | NA | NA | 0.5664 |
| 6. F | P96687 | Membrane protein YdfJ | 1.21e-02 | NA | NA | 0.353 |
| 6. F | B5FMU7 | Multidrug resistance protein MdtC | 3.43e-03 | NA | NA | 0.38 |
| 6. F | A9BG78 | Protein translocase subunit SecF | 6.27e-03 | NA | NA | 0.6181 |
| 6. F | D2BGI6 | Protein translocase subunit SecD | 2.19e-03 | NA | NA | 0.469 |
| 6. F | B2K9M1 | Multidrug resistance protein MdtC | 5.57e-04 | NA | NA | 0.373 |
| 6. F | Q48815 | Protein HelA | 6.24e-04 | NA | NA | 0.3265 |
| 6. F | P13511 | Cobalt-zinc-cadmium resistance protein CzcA | 8.90e-04 | NA | NA | 0.3315 |
| 6. F | A7MHJ0 | Multidrug resistance protein MdtC | 1.58e-04 | NA | NA | 0.3938 |
| 6. F | Q7VCH3 | Protein translocase subunit SecD | 1.45e-03 | NA | NA | 0.4692 |
| 6. F | Q1IVE8 | Protein translocase subunit SecF | 2.32e-02 | NA | NA | 0.4266 |
| 6. F | A8GQT5 | Protein translocase subunit SecF | 3.06e-03 | NA | NA | 0.5666 |
| 6. F | B5XPB9 | Multidrug resistance protein MdtB | 6.30e-04 | NA | NA | 0.3464 |
| 6. F | B2KBZ1 | Protein translocase subunit SecD | 4.59e-03 | NA | NA | 0.4368 |
| 7. B | O67102 | Protein translocase subunit SecD | 4.37e-03 | NA | 7.39e-04 | NA |
| 7. B | P0AG90 | Protein translocase subunit SecD | 2.96e-02 | NA | 0.015 | NA |
| 7. B | D1Z670 | rRNA biogenesis protein RRP36 | 5.53e-01 | NA | 0.032 | NA |
| 7. B | P0AG91 | Protein translocase subunit SecD | 2.77e-02 | NA | 0.015 | NA |
| 7. B | A0LCK9 | Protein translocase subunit SecD | 2.12e-03 | NA | 0.043 | NA |
| 7. B | O83425 | Protein translocase subunit SecD | 4.92e-03 | NA | 0.044 | NA |
| 7. B | B5YIG9 | Protein translocase subunit SecD | 5.65e-03 | NA | 2.43e-04 | NA |
| 7. B | E9RGS3 | Protein translocase subunit SecD | 9.35e-03 | NA | 4.85e-08 | NA |
| 7. B | C1A8P3 | Protein translocase subunit SecF | 1.67e-02 | NA | 0.043 | NA |
| 7. B | Q9ZJ66 | Protein translocase subunit SecD | 4.81e-03 | NA | 0.006 | NA |
| 7. B | Q2IKX9 | Protein translocase subunit SecD | 1.36e-02 | NA | 6.11e-04 | NA |
| 7. B | O33517 | Protein translocase subunit SecD | 7.19e-03 | NA | 1.31e-04 | NA |
| 7. B | O26074 | Protein translocase subunit SecD | 4.19e-03 | NA | 6.45e-04 | NA |
| 7. B | Q68WF2 | Protein translocase subunit SecD | 1.02e-02 | NA | 0.001 | NA |