Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54777.1
JCVISYN3A_0413
Adenine phosphoribosyltransferase.
M. mycoides homolog: Q6MTD4.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 65
Unique PROST Go: 25
Unique BLAST Go: 2
Unique Foldseek Go: 0
Total Homologs: 2254
Unique PROST Homologs: 1193
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 5
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q5HUN2
(Adenine phosphoribosyltransferase) with a FATCAT P-Value: 0 and RMSD of 1.50 angstrom. The sequence alignment identity is 36.1%.
Structural alignment shown in left. Query protein AVX54777.1 colored as red in alignment, homolog Q5HUN2 colored as blue.
Query protein AVX54777.1 is also shown in right top, homolog Q5HUN2 showed in right bottom. They are colored based on secondary structures.
AVX54777.1 M-NL----KEFVVD----VKDFPKQGIVFKDITPLLNNKDAFKYTIDQMADFVKKLDVDVVVAPEARGFLLASAVAYAANKRFVLVRKPNKLPREVYDVE 91 Q5HUN2 MIKLTQEEQKYLLDSIRIIPDFPKKGIIFRDITTLLNNKEALNFLLKHLKERYKDYNLDFIAGTESRGFIFASMICAKLNLPFVPIRKPGKLPFETFSCE 100 AVX54777.1 YSLEYGTNHQQIHVGD-LK--PNDKVVVIDDVLATGGTMQAIIDLVKLSKAEVIGMSFLIDLTFLHDVNLFD---QYKVQKLIK-Y----- 170 Q5HUN2 YDLEYGSDKVELH-KDAFKNIQNARVLLVDDLIATGGTAIASYELIQ--KA---GAK-CVEACFL--MNLKDLNGANKLEKLTSVYSVLEI 182
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0006166 | purine ribonucleoside salvage |
1. PBF | GO:0052657 | guanine phosphoribosyltransferase activity |
1. PBF | GO:0005829 | cytosol |
1. PBF | GO:0000310 | xanthine phosphoribosyltransferase activity |
1. PBF | GO:0046110 | xanthine metabolic process |
1. PBF | GO:0002055 | adenine binding |
1. PBF | GO:0016740 | transferase activity |
1. PBF | GO:0043103 | hypoxanthine salvage |
1. PBF | GO:0005634 | nucleus |
1. PBF | GO:0046872 | metal ion binding |
1. PBF | GO:0009116 | nucleoside metabolic process |
1. PBF | GO:0032265 | XMP salvage |
1. PBF | GO:0032264 | IMP salvage |
1. PBF | GO:0003999 | adenine phosphoribosyltransferase activity |
1. PBF | GO:0019856 | pyrimidine nucleobase biosynthetic process |
1. PBF | GO:0044205 | 'de novo' UMP biosynthetic process |
1. PBF | GO:0006168 | adenine salvage |
1. PBF | GO:0005737 | cytoplasm |
1. PBF | GO:0006222 | UMP biosynthetic process |
1. PBF | GO:0016208 | AMP binding |
1. PBF | GO:0000287 | magnesium ion binding |
1. PBF | GO:0044209 | AMP salvage |
1. PBF | GO:0007625 | grooming behavior |
1. PBF | GO:0004588 | orotate phosphoribosyltransferase activity |
1. PBF | GO:0004422 | hypoxanthine phosphoribosyltransferase activity |
2. PF | GO:0006223 | uracil salvage |
2. PF | GO:0003723 | RNA binding |
2. PF | GO:0046100 | hypoxanthine metabolic process |
2. PF | GO:0006178 | guanine salvage |
2. PF | GO:0004845 | uracil phosphoribosyltransferase activity |
2. PF | GO:0044206 | UMP salvage |
2. PF | GO:0005654 | nucleoplasm |
2. PF | GO:0032263 | GMP salvage |
3. BF | GO:0045982 | negative regulation of purine nucleobase metabolic process |
3. BF | GO:0003677 | DNA binding |
4. PB | GO:0005886 | plasma membrane |
4. PB | GO:0005576 | extracellular region |
4. PB | GO:0046083 | adenine metabolic process |
5. P | GO:0006353 | DNA-templated transcription, termination |
5. P | GO:0045964 | positive regulation of dopamine metabolic process |
5. P | GO:0003700 | DNA-binding transcription factor activity |
5. P | GO:0009507 | chloroplast |
5. P | GO:0046651 | lymphocyte proliferation |
5. P | GO:0006355 | regulation of transcription, DNA-templated |
5. P | GO:0006221 | pyrimidine nucleotide biosynthetic process |
5. P | GO:0046038 | GMP catabolic process |
5. P | GO:0009220 | pyrimidine ribonucleotide biosynthetic process |
5. P | GO:0021756 | striatum development |
5. P | GO:0042803 | protein homodimerization activity |
5. P | GO:0021954 | central nervous system neuron development |
5. P | GO:0046040 | IMP metabolic process |
5. P | GO:0005794 | Golgi apparatus |
5. P | GO:0002057 | guanine binding |
5. P | GO:0097216 | guanosine tetraphosphate binding |
5. P | GO:0001913 | T cell mediated cytotoxicity |
5. P | GO:0000166 | nucleotide binding |
5. P | GO:0005525 | GTP binding |
5. P | GO:0021895 | cerebral cortex neuron differentiation |
5. P | GO:0005783 | endoplasmic reticulum |
5. P | GO:0008655 | pyrimidine-containing compound salvage |
5. P | GO:0016020 | membrane |
5. P | GO:0042417 | dopamine metabolic process |
5. P | GO:0046132 | pyrimidine ribonucleoside biosynthetic process |
7. B | GO:0005524 | ATP binding |
7. B | GO:0007595 | lactation |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0016740 | transferase activity |
GO:0009116 | nucleoside metabolic process |
GO:0006166 | purine ribonucleoside salvage |
GO:0044209 | AMP salvage |
GO:0003999 | adenine phosphoribosyltransferase activity |
GO:0006168 | adenine salvage |
GO:0005737 | cytoplasm |
GO:0016757 | glycosyltransferase activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | B4S410 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.12e-55 | 4.14e-34 | 0.9494 |
1. PBF | A0KY07 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.34e-53 | 4.61e-35 | 0.9339 |
1. PBF | Q83M42 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.57e-55 | 1.16e-40 | 0.9278 |
1. PBF | A0RJ16 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.9502 |
1. PBF | Q500M2 | Xanthine phosphoribosyltransferase | 2.33e-15 | 7.62e-38 | 1.63e-04 | 0.8146 |
1. PBF | Q03W57 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.61e-63 | 2.31e-43 | 0.9364 |
1. PBF | P52561 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.47e-49 | 2.66e-40 | 0.9344 |
1. PBF | Q2T199 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.40e-43 | 5.62e-28 | 0.9329 |
1. PBF | Q7NBS4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-58 | 8.92e-44 | 0.937 |
1. PBF | D3S0H7 | Hypoxanthine/guanine phosphoribosyltransferase | 1.92e-12 | 2.23e-41 | 3.88e-07 | 0.7265 |
1. PBF | Q634D6 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.04e-64 | 1.97e-49 | 0.9558 |
1. PBF | B7KKQ8 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.44e-61 | 2.25e-38 | 0.93 |
1. PBF | Q04633 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.25e-47 | 5.61e-33 | 0.9345 |
1. PBF | Q1WSL3 | Xanthine phosphoribosyltransferase | 1.44e-15 | 5.99e-40 | 0.014 | 0.8076 |
1. PBF | Q038P1 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.54e-66 | 1.17e-40 | 0.9589 |
1. PBF | Q15RT2 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.36e-53 | 2.52e-32 | 0.9364 |
1. PBF | Q5LZD4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.63e-68 | 1.93e-42 | 0.9662 |
1. PBF | Q2JI33 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.06e-57 | 8.10e-37 | 0.9369 |
1. PBF | B0UWQ8 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.68e-57 | 3.48e-36 | 0.9385 |
1. PBF | A8LXX3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.29e-27 | 5.61e-34 | 0.9373 |
1. PBF | Q1ICH9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.94e-43 | 3.10e-31 | 0.945 |
1. PBF | A1ASM0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.22e-62 | 1.51e-45 | 0.9184 |
1. PBF | Q5YTF5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.75e-30 | 6.52e-16 | 0.8998 |
1. PBF | C9RH78 | Hypoxanthine/guanine phosphoribosyltransferase | 1.81e-13 | 5.59e-45 | 9.01e-09 | 0.7908 |
1. PBF | Q0I3U5 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.68e-57 | 3.48e-36 | 0.9385 |
1. PBF | Q98HV0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.03e-52 | 5.78e-35 | 0.943 |
1. PBF | A7I261 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.37e-51 | 6.35e-38 | 0.9347 |
1. PBF | Q3AYP0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.83e-60 | 1.17e-28 | 0.9313 |
1. PBF | B3H0A8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.18e-59 | 1.06e-34 | 0.9318 |
1. PBF | B5XL39 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9635 |
1. PBF | P43856 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.99e-55 | 2.75e-33 | 0.9352 |
1. PBF | A7Z5W2 | Xanthine phosphoribosyltransferase | 3.00e-15 | 7.16e-31 | 0.006 | 0.8233 |
1. PBF | Q48QC3 | Xanthine phosphoribosyltransferase | 2.55e-15 | 5.01e-39 | 1.88e-04 | 0.8136 |
1. PBF | P0DH49 | Xanthine phosphoribosyltransferase | 2.78e-15 | 6.68e-37 | 0.017 | 0.814 |
1. PBF | Q8A2N8 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.58e-51 | 3.97e-25 | 0.9393 |
1. PBF | B7IIS0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.04e-64 | 1.97e-49 | 0.9566 |
1. PBF | G0LH85 | HGPRTase-like protein 2 | 8.09e-14 | 1.34e-48 | 1.76e-10 | 0.7762 |
1. PBF | Q38VB9 | Xanthine phosphoribosyltransferase | 8.99e-15 | 2.70e-34 | 1.47e-04 | 0.7824 |
1. PBF | A5G4S5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.82e-65 | 2.52e-42 | 0.9213 |
1. PBF | A2SPY9 | Hypoxanthine/guanine phosphoribosyltransferase | 6.85e-13 | 2.92e-45 | 9.50e-11 | 0.7313 |
1. PBF | Q7VRB8 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.98e-55 | 9.07e-34 | 0.9285 |
1. PBF | Q5GZA0 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.63e-40 | 1.43e-38 | 0.9414 |
1. PBF | A9L5S5 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.71e-52 | 6.70e-37 | 0.934 |
1. PBF | B6EJ41 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.20e-55 | 1.00e-31 | 0.9403 |
1. PBF | Q87MQ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.81e-54 | 2.18e-32 | 0.9369 |
1. PBF | Q1JBS4 | Xanthine phosphoribosyltransferase | 2.55e-15 | 6.68e-37 | 0.017 | 0.8254 |
1. PBF | Q5HNR6 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.49e-64 | 3.70e-52 | 0.9624 |
1. PBF | B1IME3 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.50e-65 | 5.14e-46 | 0.9524 |
1. PBF | C0ZAP9 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.27e-63 | 5.61e-41 | 0.9437 |
1. PBF | P0CZ62 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9635 |
1. PBF | A1JNC2 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.85e-48 | 3.05e-36 | 0.9318 |
1. PBF | A2RKX0 | Xanthine phosphoribosyltransferase | 2.70e-14 | 1.17e-33 | 8.15e-05 | 0.8462 |
1. PBF | C1KVH1 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.42e-67 | 8.55e-51 | 0.961 |
1. PBF | Q9CHT5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.96e-68 | 4.02e-46 | 0.9686 |
1. PBF | O25296 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.13e-52 | 3.98e-37 | 0.9388 |
1. PBF | Q130R0 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.16e-53 | 5.29e-41 | 0.9342 |
1. PBF | P57841 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.82e-56 | 1.04e-33 | 0.9316 |
1. PBF | Q8AAN7 | Xanthine phosphoribosyltransferase | 4.44e-16 | 1.59e-36 | 8.94e-07 | 0.7467 |
1. PBF | A6LC43 | Xanthine phosphoribosyltransferase | 6.66e-16 | 2.45e-34 | 0.008 | 0.7514 |
1. PBF | A1S560 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.19e-56 | 4.50e-33 | 0.935 |
1. PBF | D1YVK0 | Hypoxanthine/guanine phosphoribosyltransferase | 4.32e-14 | 3.63e-38 | 9.33e-09 | 0.8015 |
1. PBF | A6UBS2 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.95e-54 | 2.29e-35 | 0.9164 |
1. PBF | B2VHU9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.56e-57 | 1.68e-30 | 0.9153 |
1. PBF | A1VZR0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.38e-50 | 3.81e-35 | 0.9353 |
1. PBF | Q8EXN2 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.48e-53 | 9.15e-29 | 0.9352 |
1. PBF | Q6KI92 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.80e-60 | 1.49e-42 | 0.9252 |
1. PBF | Q75FP0 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.48e-53 | 9.15e-29 | 0.9361 |
1. PBF | Q325C7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.923 |
1. PBF | O33174 | Hypoxanthine/guanine phosphoribosyltransferase | 2.75e-12 | 5.10e-38 | 6.37e-05 | 0.775 |
1. PBF | Q8Q0J4 | Orotate phosphoribosyltransferase | 1.30e-11 | 3.41e-24 | 4.30e-09 | 0.696 |
1. PBF | A7Z756 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.69e-67 | 4.81e-49 | 0.9562 |
1. PBF | Q5FSN7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.25e-47 | 6.71e-38 | 0.9421 |
1. PBF | B3QA01 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.77e-53 | 2.98e-38 | 0.9338 |
1. PBF | Q92N62 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.48e-35 | 0.9206 |
1. PBF | A4JHX7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.54e-39 | 3.25e-27 | 0.9353 |
1. PBF | P58859 | Orotate phosphoribosyltransferase | 9.60e-12 | 2.23e-23 | 9.02e-08 | 0.7123 |
1. PBF | Q9KDH2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.25e-63 | 1.07e-49 | 0.9638 |
1. PBF | Q93AJ8 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.60e-53 | 2.64e-34 | 0.9359 |
1. PBF | B5IAJ6 | Hypoxanthine/guanine phosphoribosyltransferase | 2.53e-13 | 4.53e-44 | 1.03e-06 | 0.7554 |
1. PBF | Q8XNJ8 | Xanthine phosphoribosyltransferase 1 | 6.66e-16 | 3.93e-38 | 1.23e-04 | 0.7749 |
1. PBF | Q891I6 | Xanthine phosphoribosyltransferase | 5.55e-15 | 6.11e-38 | 0.004 | 0.7967 |
1. PBF | B9DNG3 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.65e-64 | 1.57e-54 | 0.9626 |
1. PBF | A4VKK1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.64e-40 | 9.64e-31 | 0.9468 |
1. PBF | Q28MD3 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.02e-55 | 1.22e-36 | 0.9298 |
1. PBF | Q82XS2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.98e-58 | 2.03e-37 | 0.9479 |
1. PBF | Q5FJP9 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.01e-61 | 1.01e-42 | 0.9626 |
1. PBF | B9ML31 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.88e-62 | 4.33e-50 | 0.9471 |
1. PBF | B1YJG1 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.46e-66 | 9.28e-47 | 0.9612 |
1. PBF | B5ZY62 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.33e-52 | 2.73e-37 | 0.9371 |
1. PBF | Q1J141 | Xanthine phosphoribosyltransferase | 3.33e-16 | 1.67e-23 | 5.06e-06 | 0.7717 |
1. PBF | Q97GU0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.40e-65 | 5.01e-45 | 0.9375 |
1. PBF | D8JA74 | HGPRTase-like protein 1 | 1.20e-13 | 6.06e-50 | 2.10e-09 | 0.76 |
1. PBF | Q48TL5 | Xanthine phosphoribosyltransferase | 3.33e-15 | 6.68e-37 | 0.017 | 0.8246 |
1. PBF | B1I857 | Xanthine phosphoribosyltransferase | 3.11e-15 | 6.81e-37 | 0.025 | 0.8045 |
1. PBF | A6LJP2 | Orotate phosphoribosyltransferase | 3.25e-13 | 2.67e-19 | 0.002 | 0.7257 |
1. PBF | A6VMZ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.74e-59 | 1.21e-34 | 0.9313 |
1. PBF | C1DBA1 | Xanthine phosphoribosyltransferase | 2.12e-14 | 9.97e-39 | 3.44e-04 | 0.7688 |
1. PBF | Q9JYB4 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.75e-43 | 6.32e-29 | 0.9289 |
1. PBF | A1RIP7 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.24e-52 | 9.28e-35 | 0.9327 |
1. PBF | Q7MT44 | Xanthine phosphoribosyltransferase | 3.33e-16 | 1.95e-34 | 9.32e-07 | 0.8406 |
1. PBF | Q8DNL1 | Xanthine phosphoribosyltransferase | 3.22e-15 | 9.92e-37 | 0.022 | 0.7788 |
1. PBF | Q0KEM6 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.09e-39 | 2.75e-31 | 0.9353 |
1. PBF | Q1CL33 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.77e-49 | 3.25e-40 | 0.9302 |
1. PBF | P68778 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9607 |
1. PBF | Q044A4 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.68e-62 | 2.76e-45 | 0.9647 |
1. PBF | B2AGV9 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.92e-39 | 4.84e-30 | 0.9484 |
1. PBF | B1WQD7 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.27e-58 | 2.33e-41 | 0.9306 |
1. PBF | A9I0U7 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.61e-51 | 1.22e-30 | 0.9356 |
1. PBF | B5Z6U3 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.60e-53 | 1.13e-36 | 0.9385 |
1. PBF | C7P0W1 | HGPRTase-like protein | 9.89e-14 | 4.71e-39 | 3.35e-07 | 0.8185 |
1. PBF | B1LJM6 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9225 |
1. PBF | Q46KW1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.12e-61 | 1.49e-29 | 0.9255 |
1. PBF | Q2A1J5 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.20e-60 | 1.32e-40 | 0.9298 |
1. PBF | C1CLS6 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.01e-68 | 5.93e-43 | 0.9451 |
1. PBF | A7MJV7 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.11e-53 | 4.88e-40 | 0.9271 |
1. PBF | A3PGY5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.94e-56 | 3.34e-32 | 0.9548 |
1. PBF | Q741P3 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.40e-37 | 6.37e-15 | 0.935 |
1. PBF | B9KBW7 | Orotate phosphoribosyltransferase | 1.14e-12 | 3.96e-21 | 1.40e-06 | 0.7433 |
1. PBF | B8DHM4 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.42e-67 | 8.55e-51 | 0.9616 |
1. PBF | Q6CWV0 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.40e-51 | 2.63e-23 | 0.8592 |
1. PBF | P58858 | Orotate phosphoribosyltransferase | 2.22e-12 | 1.57e-24 | 3.72e-06 | 0.7553 |
1. PBF | Q17W08 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.11e-49 | 2.90e-37 | 0.9247 |
1. PBF | Q4QJV7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.99e-55 | 2.75e-33 | 0.9357 |
1. PBF | Q5WHQ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.02e-66 | 4.91e-45 | 0.9568 |
1. PBF | Q39VR8 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.61e-66 | 1.48e-42 | 0.923 |
1. PBF | Q1WT53 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.93e-65 | 1.92e-45 | 0.959 |
1. PBF | Q2YM57 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.31e-50 | 2.26e-27 | 0.9352 |
1. PBF | Q4A8Q0 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.74e-66 | 3.20e-44 | 0.9435 |
1. PBF | Q64VN7 | Xanthine phosphoribosyltransferase | 5.55e-16 | 3.35e-38 | 9.94e-06 | 0.7925 |
1. PBF | C4XU70 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.96e-65 | 2.79e-43 | 0.9661 |
1. PBF | Q3J5E9 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.67e-57 | 8.64e-33 | 0.9457 |
1. PBF | Q7MIV1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.00e-54 | 6.23e-31 | 0.9291 |
1. PBF | Q970X1 | Orotate phosphoribosyltransferase | 3.38e-11 | 2.73e-17 | 5.42e-04 | 0.7071 |
1. PBF | A8AXD5 | Xanthine phosphoribosyltransferase | 3.55e-15 | 3.03e-38 | 0.004 | 0.835 |
1. PBF | A9AYX1 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.34e-59 | 9.16e-42 | 0.9312 |
1. PBF | Q6MPK7 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.68e-54 | 2.00e-38 | 0.9091 |
1. PBF | Q145V4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.47e-41 | 3.39e-27 | 0.9329 |
1. PBF | Q3A4N0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.38e-64 | 6.85e-42 | 0.9318 |
1. PBF | Q2INZ6 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.01e-59 | 2.40e-39 | 0.9281 |
1. PBF | Q6MTD4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.90e-100 | 1.27e-119 | 0.9996 |
1. PBF | P68780 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.96 |
1. PBF | Q2JD90 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.72e-32 | 3.68e-29 | 0.9338 |
1. PBF | A6TQN8 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.83e-69 | 1.58e-52 | 0.9558 |
1. PBF | C4ZUS3 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9229 |
1. PBF | Q9X1A4 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.35e-66 | 6.93e-55 | 0.9642 |
1. PBF | Q3IST1 | HGPRTase-like protein | 1.96e-13 | 5.75e-40 | 1.50e-07 | 0.8223 |
1. PBF | B4EU76 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.77e-53 | 6.70e-34 | 0.9337 |
1. PBF | Q9PQ02 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.61e-56 | 3.20e-49 | 0.9394 |
1. PBF | B5Z3X9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.60e-55 | 6.05e-41 | 0.9279 |
1. PBF | Q49UU6 | Xanthine phosphoribosyltransferase | 6.88e-15 | 7.23e-37 | 0.001 | 0.799 |
1. PBF | A3D5Q5 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.71e-52 | 6.70e-37 | 0.9339 |
1. PBF | B1KNJ9 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.19e-55 | 6.98e-34 | 0.9402 |
1. PBF | Q04NG3 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.43e-53 | 1.06e-27 | 0.9412 |
1. PBF | Q11GC0 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.78e-53 | 1.72e-36 | 0.9351 |
1. PBF | Q24UQ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.04e-63 | 1.25e-47 | 0.9604 |
1. PBF | A4IN63 | Xanthine phosphoribosyltransferase | 8.88e-16 | 1.24e-32 | 6.47e-04 | 0.8497 |
1. PBF | A4TBR2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.00e-45 | 3.20e-25 | 0.9231 |
1. PBF | C4L531 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.36e-63 | 6.79e-45 | 0.962 |
1. PBF | Q5JHF4 | Orotate phosphoribosyltransferase | 6.90e-12 | 1.18e-34 | 4.70e-05 | 0.7089 |
1. PBF | Q0TKH2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9227 |
1. PBF | Q74CZ3 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.54e-61 | 1.30e-41 | 0.942 |
1. PBF | B2TMZ9 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.86e-66 | 1.92e-45 | 0.961 |
1. PBF | Q2RWT4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.39e-60 | 4.34e-38 | 0.9456 |
1. PBF | Q493A5 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.97e-53 | 3.76e-30 | 0.9468 |
1. PBF | A5IK86 | Orotate phosphoribosyltransferase | 9.70e-13 | 3.96e-21 | 1.40e-06 | 0.7541 |
1. PBF | C0QVL4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.23e-67 | 2.42e-49 | 0.9528 |
1. PBF | P47956 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.63e-47 | 4.02e-30 | 0.907 |
1. PBF | Q0SW58 | Xanthine phosphoribosyltransferase 1 | 7.77e-16 | 3.93e-38 | 1.23e-04 | 0.7741 |
1. PBF | Q8EUA8 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.97e-66 | 4.26e-43 | 0.9521 |
1. PBF | A1SX04 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.30e-58 | 1.96e-35 | 0.9207 |
1. PBF | A8ZWU1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.16e-57 | 4.58e-33 | 0.9467 |
1. PBF | B9MS28 | Orotate phosphoribosyltransferase | 3.30e-12 | 8.36e-25 | 3.72e-04 | 0.741 |
1. PBF | A5IMI9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.81e-68 | 3.35e-55 | 0.9653 |
1. PBF | A8Z2G2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9597 |
1. PBF | B8CMY5 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.46e-57 | 7.46e-34 | 0.9386 |
1. PBF | P63542 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.31e-50 | 2.26e-27 | 0.935 |
1. PBF | A7NG77 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.67e-55 | 1.71e-42 | 0.9558 |
1. PBF | A8AWY0 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.99e-70 | 2.47e-44 | 0.9657 |
1. PBF | A1UFB6 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.35e-52 | 4.89e-26 | 0.9294 |
1. PBF | A0PPE4 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.52e-37 | 1.49e-26 | 0.9206 |
1. PBF | A8ESP0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.67e-41 | 3.92e-29 | 0.9216 |
1. PBF | Q01QQ9 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.21e-59 | 3.88e-35 | 0.9409 |
1. PBF | Q8ZC94 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.77e-49 | 3.25e-40 | 0.9305 |
1. PBF | C1FLB0 | Orotate phosphoribosyltransferase | 3.05e-12 | 1.29e-24 | 0.002 | 0.7099 |
1. PBF | A7GHS8 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.50e-65 | 5.14e-46 | 0.9526 |
1. PBF | Q7NRK9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.62e-32 | 5.58e-34 | 0.9427 |
1. PBF | Q12W31 | Hypoxanthine/guanine phosphoribosyltransferase | 1.41e-13 | 2.74e-38 | 9.74e-06 | 0.7472 |
1. PBF | A6LTN5 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.36e-63 | 2.24e-43 | 0.9387 |
1. PBF | C5BCZ7 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-50 | 3.16e-35 | 0.9317 |
1. PBF | A1SJB1 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.41e-45 | 6.46e-35 | 0.94 |
1. PBF | Q2FG92 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9609 |
1. PBF | A4YPM4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.53e-52 | 3.02e-36 | 0.9275 |
1. PBF | A4XI79 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.48e-61 | 1.67e-49 | 0.9489 |
1. PBF | B4TMG1 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.9289 |
1. PBF | A4G043 | Hypoxanthine/guanine phosphoribosyltransferase | 6.61e-13 | 6.66e-44 | 8.48e-10 | 0.7886 |
1. PBF | A8IEI6 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.91e-51 | 2.85e-35 | 0.9436 |
1. PBF | B8GDM8 | Hypoxanthine/guanine phosphoribosyltransferase | 6.29e-14 | 2.28e-47 | 6.99e-05 | 0.7622 |
1. PBF | A7ZCG7 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.87e-52 | 5.85e-36 | 0.9278 |
1. PBF | P47958 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.78e-47 | 1.18e-29 | 0.931 |
1. PBF | Q5F774 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.70e-45 | 2.14e-30 | 0.9444 |
1. PBF | A8F7S9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.66e-64 | 2.36e-55 | 0.9498 |
1. PBF | A5N1Z4 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.10e-64 | 1.21e-47 | 0.9505 |
1. PBF | B4SWX6 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.9291 |
1. PBF | B3DRY2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.10e-34 | 9.60e-29 | 0.9294 |
1. PBF | Q1BTI4 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.01e-39 | 3.46e-28 | 0.9469 |
1. PBF | O08359 | Orotate phosphoribosyltransferase | 1.11e-11 | 5.80e-19 | 0.001 | 0.676 |
1. PBF | A8G657 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.01e-48 | 1.59e-33 | 0.9129 |
1. PBF | Q1QVQ9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.07e-51 | 1.72e-33 | 0.9361 |
1. PBF | B7HHX2 | Xanthine phosphoribosyltransferase | 3.77e-15 | 5.20e-30 | 0.025 | 0.8479 |
1. PBF | C1B4D6 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.61e-44 | 4.18e-31 | 0.9358 |
1. PBF | O51718 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.92e-53 | 2.17e-30 | 0.9445 |
1. PBF | Q8CS95 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.49e-64 | 3.70e-52 | 0.9627 |
1. PBF | Q30RI5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.16e-52 | 1.04e-33 | 0.915 |
1. PBF | C1F3T2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.20e-51 | 5.22e-42 | 0.9595 |
1. PBF | Q1B9P7 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.35e-52 | 4.89e-26 | 0.9277 |
1. PBF | C1CG72 | Xanthine phosphoribosyltransferase | 2.44e-15 | 6.81e-37 | 0.025 | 0.8388 |
1. PBF | A7FY09 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.50e-65 | 5.14e-46 | 0.9508 |
1. PBF | A5FVJ4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.67e-62 | 1.72e-35 | 0.9352 |
1. PBF | Q1J702 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9636 |
1. PBF | Q4AAL9 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.74e-66 | 3.20e-44 | 0.9428 |
1. PBF | Q7UR74 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.74e-34 | 9.01e-47 | 0.9472 |
1. PBF | Q6M0X3 | Hypoxanthine/guanine phosphoribosyltransferase | 2.16e-13 | 4.50e-45 | 8.06e-10 | 0.7949 |
1. PBF | B1ICZ7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.01e-68 | 5.93e-43 | 0.9452 |
1. PBF | Q167V0 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.81e-58 | 5.76e-37 | 0.9338 |
1. PBF | Q031A0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.37e-69 | 3.93e-46 | 0.9687 |
1. PBF | A8GAU8 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.14e-33 | 4.46e-36 | 0.9336 |
1. PBF | B1JBZ0 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.73e-44 | 2.53e-31 | 0.9439 |
1. PBF | B0SIB4 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.57e-55 | 1.84e-30 | 0.9327 |
1. PBF | A9MLY9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.65e-53 | 3.33e-39 | 0.929 |
1. PBF | Q601D6 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.74e-66 | 3.20e-44 | 0.9454 |
1. PBF | Q1GE59 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-60 | 3.25e-35 | 0.9479 |
1. PBF | Q03K92 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.63e-68 | 1.93e-42 | 0.9675 |
1. PBF | Q730C4 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.9528 |
1. PBF | B2SXI3 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.81e-41 | 6.90e-28 | 0.9307 |
1. PBF | A4SX83 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.82e-56 | 4.41e-39 | 0.9209 |
1. PBF | B0KA31 | Orotate phosphoribosyltransferase | 4.97e-12 | 1.85e-25 | 1.14e-04 | 0.7511 |
1. PBF | Q64Z17 | Orotate phosphoribosyltransferase | 5.44e-12 | 3.26e-20 | 0.002 | 0.7301 |
1. PBF | B2V345 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.38e-66 | 2.31e-45 | 0.9608 |
1. PBF | C1CMF7 | Xanthine phosphoribosyltransferase | 2.55e-15 | 2.11e-37 | 0.027 | 0.8313 |
1. PBF | A1A8D5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.923 |
1. PBF | B0TWU0 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.57e-58 | 4.65e-45 | 0.9311 |
1. PBF | D2RVT8 | HGPRTase-like protein 3 | 3.96e-13 | 2.91e-43 | 0.009 | 0.7361 |
1. PBF | Q18IJ5 | HGPRTase-like protein 2 | 2.22e-14 | 1.34e-48 | 1.76e-10 | 0.7589 |
1. PBF | Q3MAA1 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.86e-63 | 7.83e-43 | 0.9469 |
1. PBF | B0K0N0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.07e-63 | 3.74e-42 | 0.9491 |
1. PBF | B1XUX7 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.16e-53 | 2.74e-38 | 0.9375 |
1. PBF | Q9RTY2 | Xanthine phosphoribosyltransferase | 2.22e-16 | 2.18e-36 | 1.39e-04 | 0.7825 |
1. PBF | Q5LEQ1 | Xanthine phosphoribosyltransferase | 4.44e-16 | 3.35e-38 | 9.94e-06 | 0.7937 |
1. PBF | Q88CB6 | Xanthine phosphoribosyltransferase | 2.66e-15 | 8.45e-36 | 9.67e-05 | 0.803 |
1. PBF | A6WZD8 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.57e-49 | 1.16e-26 | 0.9191 |
1. PBF | D7DQT8 | Hypoxanthine/guanine phosphoribosyltransferase | 4.42e-13 | 2.01e-41 | 2.00e-08 | 0.7839 |
1. PBF | C3K148 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.45e-43 | 1.19e-29 | 0.9474 |
1. PBF | B0CHX9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.14e-48 | 2.34e-27 | 0.9215 |
1. PBF | A9BC43 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.05e-51 | 1.20e-28 | 0.9307 |
1. PBF | Q1D1H1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.54e-40 | 7.18e-40 | 0.9543 |
1. PBF | F0T7W2 | Hypoxanthine/guanine phosphoribosyltransferase | 2.63e-13 | 3.03e-38 | 4.34e-09 | 0.7589 |
1. PBF | B7NIG1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9229 |
1. PBF | Q20Y76 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.05e-26 | 3.12e-37 | 0.9408 |
1. PBF | Q3IKN5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.67e-52 | 1.43e-36 | 0.9424 |
1. PBF | P63543 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.31e-50 | 2.26e-27 | 0.9351 |
1. PBF | B1INE1 | Orotate phosphoribosyltransferase | 3.89e-12 | 2.41e-24 | 0.012 | 0.7103 |
1. PBF | Q97P00 | Xanthine phosphoribosyltransferase | 3.66e-15 | 2.32e-36 | 0.021 | 0.8117 |
1. PBF | B7V5I9 | Xanthine phosphoribosyltransferase | 1.07e-14 | 8.13e-36 | 0.001 | 0.8112 |
1. PBF | Q5WI27 | Xanthine phosphoribosyltransferase | 3.44e-15 | 6.98e-29 | 0.011 | 0.7919 |
1. PBF | A1BDK4 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.05e-55 | 3.21e-27 | 0.9398 |
1. PBF | Q5UX13 | HGPRTase-like protein 2 | 1.33e-13 | 1.60e-40 | 1.40e-06 | 0.8186 |
1. PBF | Q2FSD3 | Hypoxanthine/guanine phosphoribosyltransferase | 1.43e-12 | 7.27e-50 | 2.10e-07 | 0.737 |
1. PBF | A1WDB0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.58e-53 | 5.25e-30 | 0.9336 |
1. PBF | A0Q8C6 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.77e-60 | 1.00e-40 | 0.9324 |
1. PBF | A8AJX4 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.03e-55 | 3.56e-40 | 0.9285 |
1. PBF | Q817X3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.04e-64 | 1.97e-49 | 0.9572 |
1. PBF | B0R3M8 | HGPRTase-like protein | 1.85e-13 | 7.61e-41 | 3.74e-11 | 0.8211 |
1. PBF | P54363 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.53e-47 | 5.25e-24 | 0.9156 |
1. PBF | B9K8V0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.14e-66 | 5.07e-55 | 0.9419 |
1. PBF | Q8P8F9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.24e-41 | 3.12e-38 | 0.9468 |
1. PBF | B2ISU6 | Xanthine phosphoribosyltransferase | 3.00e-15 | 2.29e-37 | 0.026 | 0.794 |
1. PBF | Q8EPR5 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.94e-64 | 1.14e-48 | 0.9558 |
1. PBF | Q64427 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.44e-45 | 7.29e-31 | 0.9116 |
1. PBF | G0LHZ8 | HGPRTase-like protein 1 | 2.41e-13 | 2.86e-40 | 2.34e-09 | 0.7899 |
1. PBF | B2HZ61 | Xanthine phosphoribosyltransferase | 1.20e-14 | 8.79e-36 | 0.001 | 0.7952 |
1. PBF | A0QIA9 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.83e-37 | 4.95e-15 | 0.9343 |
1. PBF | A6VXH5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.58e-46 | 5.99e-30 | 0.9364 |
1. PBF | A3N5L9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.78e-43 | 2.28e-29 | 0.9344 |
1. PBF | Q0AJC5 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.68e-57 | 9.78e-37 | 0.9452 |
1. PBF | B7L794 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9224 |
1. PBF | Q7VKQ4 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.14e-56 | 1.65e-34 | 0.9353 |
1. PBF | B8I3F7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.61e-64 | 1.84e-37 | 0.9553 |
1. PBF | A4IRA1 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.10e-67 | 4.09e-53 | 0.9577 |
1. PBF | A5I0Y0 | Xanthine phosphoribosyltransferase 2 | 3.22e-15 | 4.85e-32 | 0.024 | 0.7798 |
1. PBF | A8LPV7 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.33e-58 | 5.86e-36 | 0.9448 |
1. PBF | Q43199 | Adenine phosphoribosyltransferase 1 | 0.00e+00 | 1.63e-46 | 2.70e-38 | 0.9571 |
1. PBF | B8ZN87 | Xanthine phosphoribosyltransferase | 2.22e-15 | 6.81e-37 | 0.025 | 0.7792 |
1. PBF | C7P7L7 | Hypoxanthine/guanine phosphoribosyltransferase | 6.92e-13 | 1.88e-42 | 3.37e-10 | 0.8066 |
1. PBF | O34443 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.50e-68 | 2.95e-50 | 0.9541 |
1. PBF | Q7V7D8 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.66e-58 | 2.59e-42 | 0.9435 |
1. PBF | A6URC7 | Hypoxanthine/guanine phosphoribosyltransferase | 2.36e-13 | 3.84e-42 | 2.27e-09 | 0.797 |
1. PBF | Q7V0X5 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.45e-52 | 3.31e-26 | 0.9121 |
1. PBF | Q04IV9 | Xanthine phosphoribosyltransferase | 3.44e-15 | 9.92e-37 | 0.022 | 0.8383 |
1. PBF | B0S259 | Xanthine phosphoribosyltransferase | 8.88e-16 | 4.92e-41 | 0.019 | 0.8085 |
1. PBF | A3QF54 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.06e-60 | 2.14e-36 | 0.9391 |
1. PBF | Q8DT95 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.93e-65 | 2.00e-44 | 0.9659 |
1. PBF | Q32J49 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9225 |
1. PBF | Q02E64 | Xanthine phosphoribosyltransferase | 9.77e-15 | 8.13e-36 | 0.001 | 0.8091 |
1. PBF | B7JVC2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.12e-59 | 5.55e-42 | 0.955 |
1. PBF | P63548 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9627 |
1. PBF | B2HN75 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.17e-37 | 3.88e-27 | 0.9188 |
1. PBF | A7FL92 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.79e-50 | 1.05e-40 | 0.9286 |
1. PBF | A7H8F4 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.71e-51 | 1.94e-40 | 0.9621 |
1. PBF | Q8RDM9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.31e-69 | 3.04e-53 | 0.9662 |
1. PBF | Q834G6 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.25e-64 | 8.96e-49 | 0.9571 |
1. PBF | Q080R2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.73e-54 | 8.18e-34 | 0.9417 |
1. PBF | B1MZQ2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.60e-60 | 2.91e-42 | 0.9597 |
1. PBF | B5Y0N8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.27e-54 | 1.25e-39 | 0.9153 |
1. PBF | Q57S81 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.9286 |
1. PBF | C3KU81 | Orotate phosphoribosyltransferase | 3.84e-12 | 2.41e-24 | 0.012 | 0.707 |
1. PBF | Q0BBS3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.87e-38 | 1.40e-26 | 0.9346 |
1. PBF | B5EHF2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.97e-62 | 3.92e-40 | 0.9354 |
1. PBF | A1UZL8 | Adenine phosphoribosyltransferase | 3.33e-15 | 2.10e-16 | 1.22e-18 | 0.915 |
1. PBF | Q3B250 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.73e-57 | 9.05e-29 | 0.943 |
1. PBF | A5I6E1 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.50e-65 | 5.14e-46 | 0.9527 |
1. PBF | Q9JT95 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.46e-42 | 8.45e-29 | 0.9285 |
1. PBF | Q1RF67 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9226 |
1. PBF | Q99ZQ0 | Xanthine phosphoribosyltransferase | 3.33e-15 | 6.68e-37 | 0.017 | 0.8695 |
1. PBF | Q183I0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.37e-67 | 4.97e-54 | 0.9614 |
1. PBF | B0KQ69 | Xanthine phosphoribosyltransferase | 2.44e-15 | 8.45e-36 | 9.67e-05 | 0.806 |
1. PBF | Q64414 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.05e-41 | 1.37e-29 | 0.9075 |
1. PBF | B1MCI5 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.24e-46 | 2.67e-24 | 0.9303 |
1. PBF | C1CT78 | Xanthine phosphoribosyltransferase | 2.22e-15 | 2.38e-38 | 0.025 | 0.779 |
1. PBF | C3P995 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.9531 |
1. PBF | Q14JZ2 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.77e-60 | 1.00e-40 | 0.933 |
1. PBF | A5CSP7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.37e-46 | 4.46e-31 | 0.9342 |
1. PBF | A2REX9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.82e-65 | 2.72e-43 | 0.9635 |
1. PBF | Q4ZQW4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.20e-40 | 7.77e-31 | 0.9401 |
1. PBF | A4VVY4 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.17e-70 | 1.20e-42 | 0.9639 |
1. PBF | A2BXB1 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.91e-51 | 1.81e-24 | 0.9255 |
1. PBF | A9A8E9 | Hypoxanthine/guanine phosphoribosyltransferase | 1.87e-13 | 3.03e-43 | 1.28e-09 | 0.7789 |
1. PBF | Q4L6Y0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.74e-62 | 6.31e-52 | 0.9595 |
1. PBF | A1B843 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.07e-48 | 7.69e-37 | 0.938 |
1. PBF | Q7N0N9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.89e-49 | 4.64e-36 | 0.9355 |
1. PBF | Q2NCF5 | Orotate phosphoribosyltransferase | 4.31e-11 | 1.59e-23 | 9.61e-05 | 0.6818 |
1. PBF | Q1MDK6 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.77e-53 | 2.74e-37 | 0.9344 |
1. PBF | B8HS80 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.77e-61 | 1.90e-32 | 0.9367 |
1. PBF | Q48GH3 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.73e-42 | 1.03e-30 | 0.9496 |
1. PBF | A3M938 | Xanthine phosphoribosyltransferase | 2.00e-14 | 8.79e-36 | 0.001 | 0.846 |
1. PBF | Q8RAL9 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.87e-65 | 7.76e-42 | 0.9526 |
1. PBF | A2C2A5 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.00e-63 | 1.77e-29 | 0.923 |
1. PBF | A4J563 | Orotate phosphoribosyltransferase | 2.21e-12 | 3.07e-25 | 0.003 | 0.7152 |
1. PBF | A6L3C5 | Xanthine phosphoribosyltransferase | 2.22e-16 | 2.05e-41 | 2.63e-06 | 0.7938 |
1. PBF | C3L613 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.9526 |
1. PBF | P47518 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.38e-51 | 2.47e-32 | 0.9361 |
1. PBF | A9A3N4 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.89e-62 | 5.99e-29 | 0.9538 |
1. PBF | A0JV33 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.86e-35 | 3.82e-30 | 0.9355 |
1. PBF | B9MIH9 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.45e-54 | 5.78e-30 | 0.9296 |
1. PBF | A0AIX3 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.42e-67 | 8.55e-51 | 0.9614 |
1. PBF | Q9ZEE3 | Xanthine phosphoribosyltransferase (Fragment) | 4.11e-15 | 2.79e-38 | 0.025 | 0.8366 |
1. PBF | D5VT38 | Hypoxanthine/guanine phosphoribosyltransferase | 2.86e-14 | 9.19e-44 | 2.61e-11 | 0.7691 |
1. PBF | A4X5X7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.49e-28 | 8.35e-35 | 0.937 |
1. PBF | A0RVQ8 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.97e-63 | 5.78e-28 | 0.9529 |
1. PBF | E3GW42 | Hypoxanthine/guanine phosphoribosyltransferase | 6.17e-13 | 1.10e-38 | 6.84e-09 | 0.7688 |
1. PBF | Q3SPC5 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.96e-50 | 4.96e-35 | 0.9239 |
1. PBF | Q8Z8T4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.25e-53 | 1.85e-38 | 0.9294 |
1. PBF | Q0STE8 | Xanthine phosphoribosyltransferase 2 | 7.67e-14 | 4.49e-37 | 2.46e-05 | 0.7916 |
1. PBF | A6VID5 | Hypoxanthine/guanine phosphoribosyltransferase | 2.45e-13 | 1.29e-43 | 5.03e-10 | 0.7846 |
1. PBF | Q6A8K3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.20e-57 | 6.82e-41 | 0.9426 |
1. PBF | D7E9E7 | Hypoxanthine/guanine phosphoribosyltransferase | 1.03e-13 | 1.57e-39 | 2.03e-06 | 0.7779 |
1. PBF | A4VGU2 | Xanthine phosphoribosyltransferase | 3.11e-15 | 7.09e-36 | 6.17e-04 | 0.8062 |
1. PBF | C5CIH1 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.89e-70 | 4.00e-53 | 0.9558 |
1. PBF | P0A2X6 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.08e-67 | 2.97e-51 | 0.9583 |
1. PBF | Q47N45 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.65e-54 | 2.19e-40 | 0.9504 |
1. PBF | A1TWI0 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.68e-53 | 3.03e-30 | 0.932 |
1. PBF | B7J0M3 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.99e-53 | 3.81e-30 | 0.9521 |
1. PBF | Q9HRT1 | HGPRTase-like protein | 6.93e-14 | 7.61e-41 | 3.74e-11 | 0.811 |
1. PBF | D4GVW6 | HGPRTase-like protein 2 | 1.77e-13 | 3.97e-49 | 2.68e-09 | 0.795 |
1. PBF | Q88VH0 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.33e-67 | 2.23e-42 | 0.9622 |
1. PBF | A2SMH6 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.17e-34 | 9.39e-30 | 0.934 |
1. PBF | B7JPZ4 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.9499 |
1. PBF | Q0W496 | Hypoxanthine/guanine phosphoribosyltransferase | 1.90e-13 | 1.09e-37 | 1.36e-08 | 0.7873 |
1. PBF | Q8KLQ0 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.33e-48 | 7.31e-38 | 0.9241 |
1. PBF | A9M6K5 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.31e-50 | 2.26e-27 | 0.9221 |
1. PBF | O84001 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.61e-42 | 2.62e-35 | 0.9593 |
1. PBF | Q7VGF2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.23e-59 | 1.26e-29 | 0.9223 |
1. PBF | Q5KWS2 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.33e-67 | 8.41e-52 | 0.9533 |
1. PBF | C4L0T7 | Xanthine phosphoribosyltransferase | 2.78e-15 | 4.58e-33 | 2.50e-04 | 0.8065 |
1. PBF | A9WQH7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.13e-39 | 8.95e-32 | 0.944 |
1. PBF | B0S0M3 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.25e-67 | 5.12e-53 | 0.955 |
1. PBF | Q18JK6 | HGPRTase-like protein 1 | 2.84e-13 | 2.86e-40 | 2.34e-09 | 0.7616 |
1. PBF | B7GR20 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.66e-36 | 1.70e-25 | 0.8659 |
1. PBF | B5QU72 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.929 |
1. PBF | A9GFF3 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.91e-37 | 1.53e-34 | 0.9497 |
1. PBF | P63545 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.01e-68 | 5.93e-43 | 0.9649 |
1. PBF | B8ILP3 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.60e-54 | 6.11e-40 | 0.9193 |
1. PBF | B0KPW6 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.59e-45 | 2.58e-31 | 0.9442 |
1. PBF | Q8KKS1 | Adenine phosphoribosyltransferase 2 | 0.00e+00 | 1.10e-38 | 3.57e-31 | 0.9159 |
1. PBF | Q884U6 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.08e-40 | 1.12e-29 | 0.941 |
1. PBF | B3WDB0 | Xanthine phosphoribosyltransferase | 3.55e-15 | 1.14e-37 | 6.51e-04 | 0.7923 |
1. PBF | A5GSL0 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.47e-49 | 5.63e-33 | 0.9292 |
1. PBF | B7HE42 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.04e-64 | 1.97e-49 | 0.9561 |
1. PBF | B7MDZ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9226 |
1. PBF | D2RT08 | HGPRTase-like protein 2 | 1.36e-13 | 3.43e-50 | 2.45e-11 | 0.7669 |
1. PBF | Q8E4W5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.89e-65 | 1.33e-43 | 0.9641 |
1. PBF | C6BSW0 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.88e-60 | 7.81e-46 | 0.9548 |
1. PBF | Q3K0P8 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.83e-65 | 1.99e-43 | 0.9641 |
1. PBF | A5D3H8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.88e-59 | 3.61e-25 | 0.9306 |
1. PBF | Q8EFG1 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.34e-53 | 5.57e-36 | 0.9347 |
1. PBF | B1AJC8 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.61e-56 | 3.20e-49 | 0.9311 |
1. PBF | P9WQ06 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.68e-05 | 3.55e-22 | 0.9379 |
1. PBF | B4T9H6 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.48e-53 | 9.56e-39 | 0.9292 |
1. PBF | B9E8Y3 | Xanthine phosphoribosyltransferase | 4.11e-15 | 9.95e-31 | 4.31e-04 | 0.8024 |
1. PBF | Q1GBU9 | Xanthine phosphoribosyltransferase | 6.66e-16 | 2.19e-41 | 0.005 | 0.8196 |
1. PBF | A1KLT2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.76e-02 | 4.11e-22 | 0.9356 |
1. PBF | Q2IS06 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.97e-52 | 4.41e-39 | 0.9296 |
1. PBF | B5XLI3 | Xanthine phosphoribosyltransferase | 2.33e-15 | 1.60e-37 | 0.018 | 0.8583 |
1. PBF | Q1G9R7 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.97e-63 | 4.28e-46 | 0.9646 |
1. PBF | B3E683 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.49e-63 | 2.79e-45 | 0.9422 |
1. PBF | B1XL39 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.08e-65 | 6.58e-40 | 0.9301 |
1. PBF | B2K6Z1 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.79e-50 | 1.05e-40 | 0.9285 |
1. PBF | B6JLF4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.21e-52 | 3.31e-37 | 0.9385 |
1. PBF | Q81LI1 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.9506 |
1. PBF | B8JDQ9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.12e-59 | 7.68e-39 | 0.9278 |
1. PBF | Q1QIH5 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.17e-51 | 5.35e-35 | 0.924 |
1. PBF | B2A0H0 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.47e-65 | 4.03e-34 | 0.9595 |
1. PBF | C3K452 | Xanthine phosphoribosyltransferase | 2.44e-14 | 3.64e-35 | 2.51e-05 | 0.7927 |
1. PBF | B1XFQ6 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9232 |
1. PBF | Q8G6B5 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.08e-35 | 6.66e-28 | 0.9286 |
1. PBF | A9VMH5 | Xanthine phosphoribosyltransferase | 2.89e-15 | 1.33e-30 | 0.004 | 0.8105 |
1. PBF | P0DH48 | Xanthine phosphoribosyltransferase | 3.55e-15 | 6.68e-37 | 0.017 | 0.8695 |
1. PBF | B9DM01 | Xanthine phosphoribosyltransferase | 5.22e-15 | 1.59e-36 | 0.014 | 0.802 |
1. PBF | B8CXF1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.75e-66 | 2.08e-52 | 0.9626 |
1. PBF | B2SHR3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.81e-40 | 1.95e-38 | 0.9379 |
1. PBF | A7GXJ2 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.90e-51 | 1.35e-35 | 0.9312 |
1. PBF | P47957 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.36e-46 | 1.71e-30 | 0.9088 |
1. PBF | Q2KUE4 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.78e-47 | 4.98e-30 | 0.9325 |
1. PBF | Q6LX60 | Orotate phosphoribosyltransferase | 4.98e-11 | 4.15e-28 | 7.59e-04 | 0.6754 |
1. PBF | Q2K5T4 | Adenine phosphoribosyltransferase 1 | 0.00e+00 | 2.58e-51 | 3.86e-36 | 0.9356 |
1. PBF | B1L1E1 | Orotate phosphoribosyltransferase | 4.09e-12 | 3.14e-24 | 0.012 | 0.7071 |
1. PBF | P47952 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.44e-41 | 2.66e-29 | 0.9277 |
1. PBF | B7VL95 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.40e-58 | 4.69e-33 | 0.9279 |
1. PBF | A4XNV9 | Xanthine phosphoribosyltransferase | 2.82e-14 | 1.52e-35 | 7.99e-06 | 0.8037 |
1. PBF | B0K2E4 | Orotate phosphoribosyltransferase | 6.49e-12 | 1.85e-25 | 1.14e-04 | 0.7501 |
1. PBF | C1C8G8 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.01e-68 | 5.93e-43 | 0.9653 |
1. PBF | A1T894 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.16e-56 | 5.38e-26 | 0.927 |
1. PBF | Q1JH84 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9635 |
1. PBF | Q5QWS1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.87e-47 | 2.93e-40 | 0.9315 |
1. PBF | Q63XK0 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.05e-43 | 6.36e-29 | 0.9343 |
1. PBF | Q3JW68 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.05e-43 | 6.36e-29 | 0.9299 |
1. PBF | O27888 | Orotate phosphoribosyltransferase | 1.49e-11 | 1.18e-31 | 0.003 | 0.6981 |
1. PBF | A6VJW6 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.12e-65 | 5.99e-42 | 0.9623 |
1. PBF | Q8UD91 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.49e-52 | 1.48e-37 | 0.9253 |
1. PBF | B7KY35 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.31e-53 | 7.92e-39 | 0.9358 |
1. PBF | P47202 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.50e-41 | 5.10e-32 | 0.9461 |
1. PBF | B7MQI4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9231 |
1. PBF | B5FKY7 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.9297 |
1. PBF | A8FX87 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.55e-53 | 3.84e-34 | 0.9302 |
1. PBF | B1L9F7 | Orotate phosphoribosyltransferase | 9.50e-13 | 3.96e-21 | 1.40e-06 | 0.7437 |
1. PBF | A8FFQ0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.44e-65 | 2.15e-50 | 0.9578 |
1. PBF | Q756E2 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.78e-52 | 1.23e-18 | 0.8993 |
1. PBF | Q8XJ22 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.77e-61 | 7.75e-49 | 0.9523 |
1. PBF | P63546 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9627 |
1. PBF | Q2P2B0 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.63e-40 | 1.43e-38 | 0.9413 |
1. PBF | Q03EG0 | Xanthine phosphoribosyltransferase | 1.11e-15 | 1.32e-38 | 0.012 | 0.7953 |
1. PBF | Q5XC74 | Xanthine phosphoribosyltransferase | 3.33e-15 | 6.68e-37 | 0.017 | 0.8701 |
1. PBF | B5Y8Y0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.27e-61 | 3.55e-38 | 0.9421 |
1. PBF | A7ZXC7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9371 |
1. PBF | Q827T5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.52e-51 | 4.53e-38 | 0.9485 |
1. PBF | B4U3L7 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.54e-66 | 1.00e-43 | 0.9652 |
1. PBF | B9E5P8 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.10e-64 | 1.21e-47 | 0.9512 |
1. PBF | A9MW92 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.9291 |
1. PBF | A2RIW0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.08e-67 | 2.54e-46 | 0.9704 |
1. PBF | A4TPB0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.77e-49 | 3.25e-40 | 0.9304 |
1. PBF | P69504 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9221 |
1. PBF | Q4A577 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.18e-59 | 1.96e-43 | 0.9607 |
1. PBF | Q7TTW1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-60 | 5.71e-33 | 0.9559 |
1. PBF | B3EMG7 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.72e-56 | 4.47e-37 | 0.9482 |
1. PBF | Q65ZZ7 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.63e-54 | 2.04e-30 | 0.9622 |
1. PBF | B2UTQ6 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.21e-52 | 3.31e-37 | 0.9388 |
1. PBF | C0MDK3 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.54e-66 | 1.00e-43 | 0.9649 |
1. PBF | B2SEZ5 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.77e-60 | 1.00e-40 | 0.9328 |
1. PBF | Q04JH1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.01e-68 | 5.93e-43 | 0.9451 |
1. PBF | Q48TY5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9626 |
1. PBF | A9VIN4 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.29e-66 | 3.40e-50 | 0.9576 |
1. PBF | Q0TUB1 | Xanthine phosphoribosyltransferase 1 | 7.77e-16 | 3.93e-38 | 1.23e-04 | 0.7835 |
1. PBF | B7I9E1 | Xanthine phosphoribosyltransferase | 1.77e-14 | 8.79e-36 | 0.001 | 0.798 |
1. PBF | B2JCQ7 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.55e-43 | 5.27e-27 | 0.9467 |
1. PBF | A8YVP7 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.10e-64 | 1.88e-41 | 0.9651 |
1. PBF | Q6CA53 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.84e-45 | 1.43e-27 | 0.8944 |
1. PBF | Q04F01 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.37e-61 | 2.27e-45 | 0.9421 |
1. PBF | Q3K4P7 | Xanthine phosphoribosyltransferase | 2.55e-15 | 5.17e-34 | 1.61e-05 | 0.8142 |
1. PBF | P59959 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.76e-02 | 4.11e-22 | 0.9301 |
1. PBF | D3SY73 | HGPRTase-like protein 1 | 2.26e-13 | 4.77e-35 | 2.80e-08 | 0.813 |
1. PBF | A8H2P5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.91e-55 | 4.22e-33 | 0.9349 |
1. PBF | Q60AN2 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.26e-60 | 1.58e-36 | 0.9519 |
1. PBF | Q9RFQ2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.88e-62 | 2.69e-42 | 0.9504 |
1. PBF | B0RS13 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.64e-41 | 2.98e-38 | 0.9464 |
1. PBF | A4FBB2 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.73e-37 | 3.64e-33 | 0.9279 |
1. PBF | B1JHN6 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.79e-50 | 1.05e-40 | 0.929 |
1. PBF | Q5LIY6 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.52e-51 | 8.41e-27 | 0.9322 |
1. PBF | Q8DGH9 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.94e-61 | 8.14e-35 | 0.9405 |
1. PBF | Q8Y2B9 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.68e-30 | 1.41e-30 | 0.933 |
1. PBF | F6BB32 | Hypoxanthine/guanine phosphoribosyltransferase | 3.29e-13 | 4.43e-44 | 4.82e-08 | 0.7934 |
1. PBF | Q46C14 | Hypoxanthine/guanine phosphoribosyltransferase | 7.32e-13 | 4.09e-39 | 8.54e-08 | 0.7003 |
1. PBF | Q88BA5 | Xanthine phosphoribosyltransferase | 2.89e-15 | 2.48e-37 | 2.04e-04 | 0.8128 |
1. PBF | Q8XKV0 | Xanthine phosphoribosyltransferase 2 | 6.93e-14 | 4.49e-37 | 2.46e-05 | 0.7974 |
1. PBF | Q5XCH4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.962 |
1. PBF | C6DB82 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.09e-49 | 1.93e-34 | 0.9282 |
1. PBF | B2S4S6 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.61e-42 | 2.62e-35 | 0.9596 |
1. PBF | Q5PFK3 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.9294 |
1. PBF | Q2NV62 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.32e-52 | 2.60e-39 | 0.9364 |
1. PBF | A7FT29 | Xanthine phosphoribosyltransferase 2 | 3.00e-15 | 4.85e-32 | 0.024 | 0.781 |
1. PBF | Q6HDB8 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.951 |
1. PBF | A7NEG0 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.20e-60 | 1.32e-40 | 0.9296 |
1. PBF | B8ZLT9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.01e-68 | 5.93e-43 | 0.9452 |
1. PBF | A4Y7U1 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.24e-52 | 9.28e-35 | 0.9328 |
1. PBF | Q892A7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.42e-68 | 1.85e-48 | 0.9561 |
1. PBF | A5FFL9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.32e-62 | 1.71e-41 | 0.9473 |
1. PBF | B8DUE5 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.76e-32 | 5.92e-28 | 0.9118 |
1. PBF | B2S701 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.31e-50 | 2.26e-27 | 0.9349 |
1. PBF | B2RH69 | Xanthine phosphoribosyltransferase | 3.33e-16 | 1.95e-34 | 9.32e-07 | 0.8411 |
1. PBF | Q2YT95 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.70e-62 | 6.96e-51 | 0.9607 |
1. PBF | Q3AAI8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.92e-62 | 8.27e-47 | 0.958 |
1. PBF | A7ZIM8 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9226 |
1. PBF | Q1IKJ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.60e-50 | 1.39e-38 | 0.9617 |
1. PBF | A4SGB1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.46e-55 | 1.58e-24 | 0.9284 |
1. PBF | Q74IU0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.12e-59 | 1.55e-45 | 0.9653 |
1. PBF | Q04WP5 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.43e-53 | 1.06e-27 | 0.9361 |
1. PBF | Q2GAK1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.69e-57 | 1.69e-25 | 0.932 |
1. PBF | B1L0A2 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.47e-65 | 9.77e-46 | 0.951 |
1. PBF | Q8DZA4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.89e-65 | 1.33e-43 | 0.9641 |
1. PBF | Q56JW4 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.31e-40 | 4.86e-29 | 0.9083 |
1. PBF | C1CSJ8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.77e-68 | 1.97e-42 | 0.9453 |
1. PBF | Q31JG9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.33e-52 | 8.01e-36 | 0.8854 |
1. PBF | Q6F1J0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.05e-71 | 4.10e-81 | 0.9935 |
1. PBF | A7HLE2 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.05e-66 | 1.97e-50 | 0.9712 |
1. PBF | B9KM05 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.39e-56 | 7.27e-33 | 0.9466 |
1. PBF | B6IT90 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.17e-60 | 1.45e-37 | 0.9362 |
1. PBF | C0ZJ16 | Xanthine phosphoribosyltransferase | 7.66e-15 | 6.68e-33 | 1.87e-06 | 0.7911 |
1. PBF | Q88F33 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.59e-45 | 2.58e-31 | 0.9434 |
1. PBF | F6D512 | Hypoxanthine/guanine phosphoribosyltransferase | 1.12e-12 | 8.48e-39 | 1.31e-08 | 0.7273 |
1. PBF | A4QEM8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.02e-42 | 1.99e-29 | 0.937 |
1. PBF | Q04GD7 | Xanthine phosphoribosyltransferase | 7.22e-15 | 7.87e-30 | 0.004 | 0.8097 |
1. PBF | Q5HUN2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.67e-50 | 4.16e-35 | 0.9381 |
1. PBF | B0UKF2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.62e-53 | 1.04e-39 | 0.9265 |
1. PBF | Q3AT37 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.78e-57 | 2.57e-26 | 0.9332 |
1. PBF | Q1GTG6 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.34e-49 | 6.33e-33 | 0.9476 |
1. PBF | Q7WEY7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.75e-33 | 4.78e-29 | 0.9358 |
1. PBF | Q1JM38 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9633 |
1. PBF | B0BSS1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.18e-59 | 1.06e-34 | 0.9305 |
1. PBF | Q8XD48 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.60e-55 | 6.05e-41 | 0.9279 |
1. PBF | B7M3W1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9232 |
1. PBF | B2IBU5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.35e-54 | 3.89e-34 | 0.9409 |
1. PBF | Q8PVT4 | Hypoxanthine/guanine phosphoribosyltransferase | 7.92e-13 | 5.11e-39 | 4.79e-08 | 0.7432 |
1. PBF | P63544 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.01e-68 | 5.93e-43 | 0.9449 |
1. PBF | B5E1V8 | Xanthine phosphoribosyltransferase | 2.44e-15 | 6.81e-37 | 0.025 | 0.8391 |
1. PBF | P0A2X5 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.08e-67 | 2.97e-51 | 0.9607 |
1. PBF | B3EPT5 | Orotate phosphoribosyltransferase | 1.19e-12 | 3.87e-23 | 0.003 | 0.7521 |
1. PBF | Q5V125 | HGPRTase-like protein 1 | 5.20e-14 | 1.63e-47 | 0.007 | 0.7806 |
1. PBF | Q476D8 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.01e-42 | 6.17e-31 | 0.9352 |
1. PBF | A9KTA4 | Xanthine phosphoribosyltransferase | 2.22e-16 | 2.52e-31 | 1.30e-04 | 0.7885 |
1. PBF | C0Q807 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.929 |
1. PBF | Q8TSS8 | Hypoxanthine/guanine phosphoribosyltransferase | 6.46e-13 | 3.33e-39 | 2.78e-08 | 0.7361 |
1. PBF | Q7NGZ0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.18e-57 | 1.26e-36 | 0.9386 |
1. PBF | B7UVH9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.25e-47 | 5.61e-33 | 0.9361 |
1. PBF | Q8DB25 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.00e-54 | 6.23e-31 | 0.9377 |
1. PBF | A9HEW1 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.20e-53 | 1.67e-37 | 0.9511 |
1. PBF | Q6G8T4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9605 |
1. PBF | P0CZ63 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9628 |
1. PBF | Q5HFC8 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9616 |
1. PBF | A5ITF9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9606 |
1. PBF | B0CBF7 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.19e-63 | 2.69e-35 | 0.9363 |
1. PBF | P68781 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9603 |
1. PBF | A6V7V8 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.49e-48 | 4.42e-33 | 0.9395 |
1. PBF | A5VRR9 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.31e-50 | 2.26e-27 | 0.9349 |
1. PBF | A5IZD7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.35e-62 | 5.01e-44 | 0.9243 |
1. PBF | Q0RNU1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.04e-31 | 3.03e-30 | 0.9277 |
1. PBF | Q9KCQ5 | Xanthine phosphoribosyltransferase | 3.66e-15 | 2.96e-30 | 0.008 | 0.8056 |
1. PBF | Q8ZRA2 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.9292 |
1. PBF | Q5NII9 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.77e-60 | 1.00e-40 | 0.9382 |
1. PBF | B1YN34 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.87e-38 | 1.40e-26 | 0.9348 |
1. PBF | Q1CTV4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.21e-52 | 3.31e-37 | 0.9387 |
1. PBF | Q66DQ2 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.79e-50 | 1.12e-40 | 0.938 |
1. PBF | A0LUK1 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.24e-54 | 1.59e-33 | 0.9446 |
1. PBF | Q7W089 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.70e-48 | 4.06e-28 | 0.9357 |
1. PBF | A3DF48 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.12e-65 | 8.51e-42 | 0.9463 |
1. PBF | B0TCJ8 | Xanthine phosphoribosyltransferase | 2.66e-15 | 4.79e-36 | 3.26e-04 | 0.8477 |
1. PBF | Q1JGV7 | Xanthine phosphoribosyltransferase | 3.22e-15 | 6.68e-37 | 0.017 | 0.8702 |
1. PBF | Q4JVE4 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.78e-11 | 2.39e-33 | 0.9302 |
1. PBF | P73935 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.36e-61 | 2.26e-43 | 0.9283 |
1. PBF | Q0TP22 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.77e-61 | 7.75e-49 | 0.9322 |
1. PBF | D3S8C7 | Hypoxanthine/guanine phosphoribosyltransferase | 6.59e-13 | 1.42e-32 | 1.78e-10 | 0.7908 |
1. PBF | A6UX50 | Hypoxanthine/guanine phosphoribosyltransferase | 7.55e-13 | 2.35e-45 | 3.12e-09 | 0.7385 |
1. PBF | Q97KP4 | Xanthine phosphoribosyltransferase | 4.33e-15 | 1.03e-34 | 0.002 | 0.8028 |
1. PBF | Q3AIK3 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.91e-55 | 4.39e-30 | 0.927 |
1. PBF | B1LUP7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.33e-54 | 2.76e-37 | 0.9417 |
1. PBF | B0JR14 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.89e-60 | 4.60e-40 | 0.9303 |
1. PBF | A7HVC7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.12e-56 | 5.08e-38 | 0.9291 |
1. PBF | C4L8U7 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.36e-57 | 2.06e-37 | 0.9216 |
1. PBF | A4J6I7 | Xanthine phosphoribosyltransferase | 1.44e-15 | 7.06e-40 | 6.58e-04 | 0.7832 |
1. PBF | A4XVK6 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.87e-45 | 6.52e-30 | 0.9367 |
1. PBF | A3MX27 | Orotate phosphoribosyltransferase | 6.19e-11 | 3.12e-18 | 4.29e-04 | 0.6427 |
1. PBF | A0KAK7 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.01e-39 | 3.46e-28 | 0.9462 |
1. PBF | Q57BX7 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.31e-50 | 2.26e-27 | 0.9351 |
1. PBF | B7LLQ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.91e-55 | 1.02e-40 | 0.9284 |
1. PBF | Q71ZE6 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.42e-67 | 8.55e-51 | 0.9605 |
1. PBF | A6WPL2 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.71e-52 | 6.70e-37 | 0.9334 |
1. PBF | B9LMX4 | HGPRTase-like protein | 4.22e-13 | 2.90e-37 | 1.13e-08 | 0.8045 |
1. PBF | D2RXU5 | HGPRTase-like protein 1 | 2.17e-13 | 9.73e-37 | 1.82e-09 | 0.8113 |
1. PBF | A4J2G8 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.99e-59 | 7.65e-48 | 0.9336 |
1. PBF | Q98QN9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-63 | 4.00e-53 | 0.9498 |
1. PBF | Q5M3Y6 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.63e-68 | 1.93e-42 | 0.9666 |
1. PBF | Q03QP8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.16e-64 | 1.11e-41 | 0.9597 |
1. PBF | Q2JT47 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.92e-59 | 2.30e-39 | 0.9576 |
1. PBF | C6E585 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.32e-62 | 2.62e-40 | 0.9352 |
1. PBF | A3MYY8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.18e-59 | 1.06e-34 | 0.9303 |
1. PBF | Q9RQF8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.40e-54 | 1.42e-37 | 0.9299 |
1. PBF | Q1GTA2 | Orotate phosphoribosyltransferase | 2.33e-11 | 4.56e-20 | 0.015 | 0.6983 |
1. PBF | Q31AA3 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.66e-52 | 3.96e-26 | 0.9311 |
1. PBF | C1C9B2 | Xanthine phosphoribosyltransferase | 2.22e-15 | 6.81e-37 | 0.025 | 0.8399 |
1. PBF | C7NST3 | HGPRTase-like protein | 1.88e-13 | 8.26e-38 | 7.55e-08 | 0.8186 |
1. PBF | Q119D0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.94e-60 | 3.62e-36 | 0.9626 |
1. PBF | D4GVR1 | HGPRTase-like protein 1 | 1.54e-12 | 7.61e-41 | 1.15e-08 | 0.7927 |
1. PBF | Q0SM77 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.37e-52 | 8.75e-32 | 0.9561 |
1. PBF | Q4K3U3 | Xanthine phosphoribosyltransferase | 2.78e-15 | 5.57e-35 | 1.06e-05 | 0.8017 |
1. PBF | B5EXM5 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.929 |
1. PBF | Q9KT52 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.33e-57 | 4.69e-37 | 0.9287 |
1. PBF | B0TNZ8 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.13e-55 | 3.91e-33 | 0.9141 |
1. PBF | C0MAM5 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.54e-66 | 1.00e-43 | 0.9637 |
1. PBF | E4NQE5 | HGPRTase-like protein | 1.66e-13 | 2.00e-39 | 8.89e-12 | 0.803 |
1. PBF | Q0HU91 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.36e-53 | 1.03e-34 | 0.9345 |
1. PBF | A6QHH7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9616 |
1. PBF | B1LBU1 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.21e-68 | 2.87e-55 | 0.9639 |
1. PBF | Q7CN84 | Xanthine phosphoribosyltransferase | 3.33e-15 | 6.68e-37 | 0.017 | 0.8701 |
1. PBF | Q0T7B5 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.57e-55 | 1.16e-40 | 0.9282 |
1. PBF | Q47XQ8 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.01e-57 | 7.22e-34 | 0.9178 |
1. PBF | Q7W3L2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.75e-33 | 4.78e-29 | 0.9355 |
1. PBF | Q65U83 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.06e-58 | 4.94e-35 | 0.9339 |
1. PBF | Q21QM7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.75e-33 | 4.52e-30 | 0.9396 |
1. PBF | C0MBC1 | Xanthine phosphoribosyltransferase | 3.33e-15 | 5.18e-36 | 3.39e-04 | 0.8164 |
1. PBF | A7MUE7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.98e-55 | 4.80e-33 | 0.9369 |
1. PBF | Q0BVB8 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.46e-60 | 4.78e-37 | 0.9387 |
1. PBF | A5UF74 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.99e-55 | 2.75e-33 | 0.9352 |
1. PBF | Q2W3C2 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.57e-58 | 7.37e-37 | 0.9445 |
1. PBF | A2C9I6 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.34e-59 | 1.28e-41 | 0.9426 |
1. PBF | A1KV71 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.83e-44 | 2.57e-30 | 0.94 |
1. PBF | Q6LTE9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.66e-53 | 1.05e-30 | 0.9347 |
1. PBF | A5I6W5 | Orotate phosphoribosyltransferase | 3.35e-12 | 2.41e-24 | 0.012 | 0.7457 |
1. PBF | A0QWJ5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.93e-41 | 2.64e-20 | 0.9303 |
1. PBF | Q8PJY6 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.51e-40 | 1.59e-38 | 0.9221 |
1. PBF | Q2SRZ3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.64e-89 | 1.07e-107 | 0.9981 |
1. PBF | Q1J6M6 | Xanthine phosphoribosyltransferase | 2.55e-15 | 6.68e-37 | 0.017 | 0.8258 |
1. PBF | B8FQU0 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.00e-67 | 2.85e-48 | 0.9549 |
1. PBF | B1JYN1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.27e-38 | 3.70e-28 | 0.934 |
1. PBF | Q9HTQ6 | Xanthine phosphoribosyltransferase | 1.38e-14 | 2.88e-35 | 0.001 | 0.8105 |
1. PBF | Q3BSE4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.53e-41 | 2.96e-40 | 0.9452 |
1. PBF | B0RGV9 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.40e-24 | 4.56e-30 | 0.9321 |
1. PBF | Q0S1C1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.20e-45 | 8.99e-32 | 0.936 |
1. PBF | A3PE89 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.11e-53 | 8.95e-31 | 0.9148 |
1. PBF | Q7M8W8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.31e-49 | 1.91e-32 | 0.9334 |
1. PBF | Q5N1I0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.80e-61 | 1.48e-44 | 0.9499 |
1. PBF | B2IU50 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.04e-61 | 7.75e-40 | 0.9518 |
1. PBF | A5W0U8 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.59e-45 | 2.58e-31 | 0.944 |
1. PBF | Q81FL2 | Xanthine phosphoribosyltransferase | 3.55e-15 | 1.57e-30 | 0.010 | 0.8475 |
1. PBF | A9NGG3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.26e-66 | 7.22e-52 | 0.9741 |
1. PBF | A5EE90 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.60e-53 | 2.93e-36 | 0.9385 |
1. PBF | B7N922 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.923 |
1. PBF | Q7VAL5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.31e-50 | 2.40e-27 | 0.9057 |
1. PBF | A1BJI2 | Orotate phosphoribosyltransferase | 7.33e-13 | 1.81e-22 | 5.29e-05 | 0.7679 |
1. PBF | B1ZKA1 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.86e-53 | 6.17e-39 | 0.9357 |
1. PBF | P0CL78 | Orotate phosphoribosyltransferase | 1.13e-11 | 1.57e-37 | 3.19e-10 | 0.712 |
1. PBF | A4SGU2 | Orotate phosphoribosyltransferase | 1.31e-12 | 1.43e-20 | 2.72e-05 | 0.7668 |
1. PBF | A5F2N2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.33e-57 | 4.69e-37 | 0.9286 |
1. PBF | A8FLX6 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.67e-50 | 4.16e-35 | 0.9353 |
1. PBF | Q4KFF5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.23e-47 | 8.01e-30 | 0.9498 |
1. PBF | B3DXQ2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.22e-50 | 1.35e-25 | 0.9194 |
1. PBF | Q3Z4T0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9225 |
1. PBF | P68779 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9596 |
1. PBF | B7HQG7 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.9529 |
1. PBF | Q1LRM9 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.37e-42 | 3.72e-32 | 0.9478 |
1. PBF | A6KZN9 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.00e-59 | 5.68e-31 | 0.9441 |
1. PBF | Q1GYN9 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.88e-53 | 8.43e-27 | 0.9379 |
1. PBF | C5D514 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.11e-65 | 7.44e-49 | 0.9554 |
1. PBF | Q6NGY0 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.23e-43 | 3.35e-32 | 0.9396 |
1. PBF | A8MGN2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.72e-68 | 2.01e-50 | 0.9559 |
1. PBF | Q1AW34 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.29e-51 | 1.20e-47 | 0.9414 |
1. PBF | A7GT90 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.46e-64 | 6.11e-48 | 0.9553 |
1. PBF | O87330 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.89e-43 | 2.93e-29 | 0.9052 |
1. PBF | B5BD49 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.06e-53 | 1.83e-38 | 0.9288 |
1. PBF | A8KZE2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.69e-41 | 1.39e-32 | 0.9303 |
1. PBF | F4BT36 | Hypoxanthine/guanine phosphoribosyltransferase | 1.04e-13 | 2.00e-39 | 4.71e-11 | 0.7692 |
1. PBF | F7XQS2 | Hypoxanthine/guanine phosphoribosyltransferase | 1.09e-11 | 1.56e-38 | 7.13e-05 | 0.7448 |
1. PBF | Q8YNI3 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.95e-64 | 1.46e-41 | 0.9492 |
1. PBF | A5GLQ5 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.48e-60 | 3.84e-42 | 0.9338 |
1. PBF | B9IYY2 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.19e-65 | 5.19e-49 | 0.9578 |
1. PBF | Q67LM3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.46e-64 | 5.07e-44 | 0.9618 |
1. PBF | Q11TJ3 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.96e-49 | 5.96e-37 | 0.9505 |
1. PBF | Q38W53 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.29e-66 | 8.77e-42 | 0.9569 |
1. PBF | Q6LZG8 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.14e-65 | 6.90e-42 | 0.9642 |
1. PBF | A9KIA0 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.13e-66 | 2.95e-49 | 0.9191 |
1. PBF | Q0IAT7 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.62e-61 | 3.15e-42 | 0.9406 |
1. PBF | B2U4S2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.923 |
1. PBF | Q8FPL0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.57e-29 | 3.09e-25 | 0.9125 |
1. PBF | Q0SRP2 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.77e-61 | 7.75e-49 | 0.9536 |
1. PBF | D8J663 | HGPRTase-like protein 2 | 1.03e-13 | 8.09e-38 | 1.34e-08 | 0.7929 |
1. PBF | A3CMY9 | Xanthine phosphoribosyltransferase | 4.11e-15 | 1.80e-37 | 0.019 | 0.8551 |
1. PBF | A0Q2P2 | Xanthine phosphoribosyltransferase | 6.00e-15 | 2.43e-38 | 0.011 | 0.7588 |
1. PBF | A9AF06 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.18e-38 | 3.01e-27 | 0.934 |
1. PBF | A6WCH4 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.24e-41 | 1.73e-36 | 0.9585 |
1. PBF | P75388 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.66e-54 | 2.91e-33 | 0.9471 |
1. PBF | D3DYU7 | Hypoxanthine/guanine phosphoribosyltransferase | 2.21e-13 | 2.58e-41 | 2.09e-05 | 0.8066 |
1. PBF | Q6F7W2 | Xanthine phosphoribosyltransferase | 2.09e-14 | 6.30e-36 | 0.003 | 0.7965 |
1. PBF | Q0ARQ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.94e-55 | 1.87e-36 | 0.9412 |
1. PBF | Q049X1 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.97e-63 | 4.28e-46 | 0.9642 |
1. PBF | C1CZX7 | Xanthine phosphoribosyltransferase | 1.11e-16 | 9.88e-34 | 4.19e-06 | 0.7536 |
1. PBF | A9WCV7 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.47e-65 | 2.54e-43 | 0.9555 |
1. PBF | A5WAY3 | Xanthine phosphoribosyltransferase | 2.44e-15 | 8.45e-36 | 9.67e-05 | 0.8056 |
1. PBF | Q04CA6 | Xanthine phosphoribosyltransferase | 6.66e-16 | 2.19e-41 | 0.005 | 0.8204 |
1. PBF | C3LTV0 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.33e-57 | 4.69e-37 | 0.9285 |
1. PBF | A6LP26 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.43e-59 | 5.69e-53 | 0.9674 |
1. PBF | A5URA4 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.23e-59 | 1.53e-45 | 0.9614 |
1. PBF | A3NRB5 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.05e-43 | 6.36e-29 | 0.9304 |
1. PBF | A1A1K5 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.18e-36 | 3.38e-24 | 0.9366 |
1. PBF | B0K969 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.76e-64 | 2.15e-42 | 0.9479 |
1. PBF | B7IEY2 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.11e-70 | 3.04e-54 | 0.9685 |
1. PBF | B9E711 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.54e-66 | 5.58e-53 | 0.9393 |
1. PBF | A0RQ44 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.41e-50 | 3.90e-35 | 0.9365 |
1. PBF | A6Q809 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.43e-44 | 5.50e-23 | 0.9208 |
1. PBF | D5E7U7 | Hypoxanthine/guanine phosphoribosyltransferase | 1.97e-13 | 4.68e-37 | 8.20e-08 | 0.7467 |
1. PBF | A9BG28 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.32e-63 | 5.96e-53 | 0.9597 |
1. PBF | Q3KFA3 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.64e-38 | 3.49e-30 | 0.95 |
1. PBF | Q6BZF9 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.71e-50 | 1.22e-26 | 0.914 |
1. PBF | Q1JLQ7 | Xanthine phosphoribosyltransferase | 2.44e-15 | 6.68e-37 | 0.017 | 0.8148 |
1. PBF | Q8KFM9 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.37e-58 | 2.91e-27 | 0.9431 |
1. PBF | A7H3C4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.67e-50 | 4.16e-35 | 0.9353 |
1. PBF | A4W292 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.17e-70 | 1.20e-42 | 0.9642 |
1. PBF | Q39CV8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.50e-37 | 3.78e-28 | 0.9422 |
1. PBF | B9DS40 | Xanthine phosphoribosyltransferase | 4.00e-15 | 1.28e-37 | 0.017 | 0.7541 |
1. PBF | Q49Y73 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.77e-62 | 1.72e-51 | 0.9613 |
1. PBF | Q650H6 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.81e-51 | 2.05e-26 | 0.9315 |
1. PBF | A0B870 | Hypoxanthine/guanine phosphoribosyltransferase | 3.87e-13 | 7.77e-41 | 9.69e-07 | 0.7897 |
1. PBF | A6U2A3 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9604 |
1. PBF | B7IPE6 | Xanthine phosphoribosyltransferase | 3.33e-15 | 1.43e-30 | 0.010 | 0.8093 |
1. PBF | A9M1N3 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.70e-45 | 2.14e-30 | 0.9306 |
1. PBF | A3CNR3 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.10e-70 | 9.95e-44 | 0.9654 |
1. PBF | A2BRV3 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.75e-52 | 2.87e-31 | 0.9113 |
1. PBF | Q9WYG6 | Orotate phosphoribosyltransferase | 9.54e-13 | 2.29e-21 | 1.04e-07 | 0.7554 |
1. PBF | A3PYX7 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.35e-52 | 4.89e-26 | 0.9283 |
1. PBF | Q5LNY7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.08e-58 | 6.56e-33 | 0.9497 |
1. PBF | A5EVW7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.25e-63 | 1.23e-46 | 0.9391 |
1. PBF | B3EFG3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.53e-55 | 3.66e-26 | 0.9427 |
1. PBF | A6Q2W2 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.02e-51 | 1.28e-27 | 0.937 |
1. PBF | Q0TQZ9 | Xanthine phosphoribosyltransferase 2 | 3.46e-14 | 4.49e-37 | 2.46e-05 | 0.7999 |
1. PBF | Q12LL4 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.90e-54 | 2.40e-34 | 0.938 |
1. PBF | B4SCV2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.19e-56 | 6.52e-28 | 0.9338 |
1. PBF | Q65GQ8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.65e-67 | 6.06e-51 | 0.957 |
1. PBF | A9R0Q1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.77e-49 | 3.25e-40 | 0.9302 |
1. PBF | Q6N1B4 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.77e-53 | 2.98e-38 | 0.9265 |
1. PBF | Q4UVM8 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.24e-41 | 3.12e-38 | 0.9413 |
1. PBF | Q3JEP4 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.02e-57 | 1.59e-39 | 0.9601 |
1. PBF | Q89SB5 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.10e-52 | 1.51e-35 | 0.93 |
1. PBF | A0PZW4 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.48e-64 | 7.59e-51 | 0.9601 |
1. PBF | Q4FLB9 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.34e-59 | 3.20e-35 | 0.9573 |
1. PBF | Q9ZLQ9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.98e-54 | 7.88e-37 | 0.9377 |
1. PBF | C4LIX2 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.16e-43 | 4.38e-29 | 0.9397 |
1. PBF | A4XKT8 | Orotate phosphoribosyltransferase | 3.15e-12 | 1.35e-23 | 5.10e-05 | 0.7527 |
1. PBF | A9W0A8 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.31e-53 | 7.92e-39 | 0.9354 |
1. PBF | B5R607 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.09e-53 | 3.11e-37 | 0.9295 |
1. PBF | B4S5W8 | Orotate phosphoribosyltransferase | 1.49e-12 | 5.15e-22 | 3.61e-07 | 0.7455 |
1. PBF | A1U4H0 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.26e-53 | 1.90e-35 | 0.9262 |
1. PBF | A7X350 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9609 |
1. PBF | A0KKD3 | Adenine phosphoribosyltransferase | 0.00e+00 | 9.92e-58 | 4.38e-43 | 0.928 |
1. PBF | A6T5N2 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.54e-55 | 1.86e-39 | 0.9156 |
1. PBF | Q9CGF0 | Xanthine phosphoribosyltransferase | 6.84e-14 | 8.37e-33 | 7.76e-05 | 0.8389 |
1. PBF | A4FYD7 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.35e-62 | 1.70e-41 | 0.9654 |
1. PBF | A6USF2 | Adenine phosphoribosyltransferase | 0.00e+00 | 4.90e-61 | 6.88e-42 | 0.9393 |
1. PBF | A4IW38 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.69e-61 | 7.57e-41 | 0.9294 |
1. PBF | Q0BK98 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.20e-60 | 1.32e-40 | 0.9301 |
1. PBF | A2S6D4 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.10e-16 | 1.22e-18 | 0.914 |
1. PBF | A5D197 | Orotate phosphoribosyltransferase | 7.17e-12 | 2.05e-25 | 1.09e-04 | 0.6965 |
1. PBF | B4UE87 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.12e-59 | 7.68e-39 | 0.9631 |
1. PBF | Q2N669 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.54e-55 | 2.80e-25 | 0.927 |
1. PBF | Q1JC56 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.48e-66 | 2.31e-43 | 0.9638 |
1. PBF | A7FYI6 | Orotate phosphoribosyltransferase | 4.02e-12 | 2.41e-24 | 0.012 | 0.707 |
1. PBF | Q6GG69 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | 0.9604 |
1. PBF | D3SRA6 | HGPRTase-like protein 2 | 1.73e-13 | 5.66e-50 | 3.27e-12 | 0.7804 |
1. PBF | C0MF03 | Xanthine phosphoribosyltransferase | 3.77e-15 | 2.56e-36 | 1.48e-04 | 0.8281 |
1. PBF | Q2NFI3 | Orotate phosphoribosyltransferase | 7.30e-12 | 5.64e-38 | 5.46e-04 | 0.7039 |
1. PBF | B7GW49 | Xanthine phosphoribosyltransferase | 1.68e-14 | 8.79e-36 | 0.001 | 0.7978 |
1. PBF | A4W7F3 | Adenine phosphoribosyltransferase | 0.00e+00 | 6.41e-57 | 6.83e-40 | 0.9293 |
1. PBF | Q6D800 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.87e-48 | 1.84e-35 | 0.9264 |
1. PBF | Q03A64 | Xanthine phosphoribosyltransferase | 3.55e-15 | 1.14e-37 | 6.51e-04 | 0.7843 |
1. PBF | Q0HHZ1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.34e-53 | 4.61e-35 | 0.9349 |
1. PBF | A4SMN3 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.65e-58 | 1.69e-41 | 0.9264 |
1. PBF | B1IZC5 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9227 |
1. PBF | Q2YAI3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.94e-55 | 7.04e-28 | 0.9401 |
1. PBF | Q65I86 | Xanthine phosphoribosyltransferase | 6.66e-16 | 4.67e-32 | 0.003 | 0.8233 |
1. PBF | Q03F39 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.08e-65 | 1.10e-39 | 0.9636 |
1. PBF | A4WQ67 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.63e-56 | 1.26e-32 | 0.9329 |
1. PBF | Q9PP06 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.81e-50 | 1.55e-35 | 0.9368 |
1. PBF | C4ZF43 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.53e-67 | 1.96e-44 | 0.9391 |
1. PBF | Q5E463 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.08e-56 | 9.59e-33 | 0.9386 |
1. PBF | F8AJL1 | Hypoxanthine/guanine phosphoribosyltransferase | 2.18e-13 | 5.56e-46 | 1.41e-07 | 0.7937 |
1. PBF | B1HV83 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.10e-64 | 1.33e-49 | 0.9476 |
1. PBF | A0LYK2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.70e-60 | 4.37e-40 | 0.9314 |
1. PBF | Q02Z29 | Xanthine phosphoribosyltransferase | 4.92e-14 | 8.06e-33 | 5.96e-05 | 0.8409 |
1. PBF | Q1I2W1 | Xanthine phosphoribosyltransferase | 2.44e-15 | 1.20e-35 | 1.19e-04 | 0.815 |
1. PBF | O31060 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.12e-48 | 3.64e-38 | 0.9108 |
1. PBF | A6VEA3 | Xanthine phosphoribosyltransferase | 1.61e-14 | 8.03e-35 | 0.001 | 0.8104 |
1. PBF | B7UKE9 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.9234 |
1. PBF | B6I0C1 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | 0.923 |
1. PBF | B8E700 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.71e-52 | 6.70e-37 | 0.9339 |
1. PBF | Q1C4P3 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.77e-49 | 3.25e-40 | 0.9301 |
1. PBF | A5UBP3 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.43e-54 | 2.36e-33 | 0.936 |
1. PBF | B9M4Z1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.56e-65 | 3.32e-41 | 0.9432 |
1. PBF | Q73M27 | Adenine phosphoribosyltransferase | 0.00e+00 | 7.91e-44 | 4.61e-37 | 0.9542 |
1. PBF | B3QQD1 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.49e-56 | 3.73e-27 | 0.9378 |
1. PBF | A7GIH6 | Orotate phosphoribosyltransferase | 3.04e-12 | 3.41e-24 | 0.012 | 0.7491 |
1. PBF | Q02K26 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.25e-47 | 5.61e-33 | 0.9364 |
1. PBF | B9DUP2 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.73e-67 | 5.99e-42 | 0.9637 |
1. PBF | A2REI4 | Xanthine phosphoribosyltransferase | 3.33e-15 | 3.30e-36 | 0.019 | 0.8129 |
2. PF | P0A8F3 | Uracil phosphoribosyltransferase | 3.36e-07 | 1.22e-11 | NA | 0.4876 |
2. PF | P61499 | Orotate phosphoribosyltransferase | 2.85e-12 | 4.05e-26 | NA | 0.7188 |
2. PF | B7GMG3 | Uracil phosphoribosyltransferase | 4.21e-07 | 1.63e-12 | NA | 0.6054 |
2. PF | A6U5N7 | Orotate phosphoribosyltransferase | 1.84e-10 | 5.38e-12 | NA | 0.6826 |
2. PF | Q03UJ4 | Xanthine phosphoribosyltransferase | 1.55e-15 | 6.68e-36 | NA | 0.8642 |
2. PF | A5VD53 | Orotate phosphoribosyltransferase | 8.64e-11 | 2.22e-21 | NA | 0.6563 |
2. PF | P9WHK8 | Orotate phosphoribosyltransferase | 7.16e-11 | 1.13e-35 | NA | 0.6264 |
2. PF | B9KMA3 | Orotate phosphoribosyltransferase | 9.50e-11 | 2.59e-10 | NA | 0.6957 |
2. PF | C3L8M1 | Xanthine phosphoribosyltransferase | 8.88e-16 | 3.55e-30 | NA | 0.8485 |
2. PF | A4G0B2 | PyrE-like protein | 8.09e-10 | 1.88e-06 | NA | 0.6551 |
2. PF | A8YXG4 | Xanthine phosphoribosyltransferase | 7.77e-16 | 2.63e-38 | NA | 0.7846 |
2. PF | Q3K111 | Xanthine phosphoribosyltransferase | 3.89e-15 | 6.62e-35 | NA | 0.8243 |
2. PF | A8FEE7 | Xanthine phosphoribosyltransferase | 3.89e-15 | 2.97e-29 | NA | 0.8133 |
2. PF | Q046I4 | Xanthine phosphoribosyltransferase | 5.55e-16 | 1.92e-35 | NA | 0.7908 |
2. PF | C3NFT0 | Uracil phosphoribosyltransferase | 5.88e-06 | 6.06e-13 | NA | 0.4812 |
2. PF | Q7A1T6 | Xanthine phosphoribosyltransferase | 6.55e-15 | 1.31e-33 | NA | 0.7951 |
2. PF | Q6GC84 | Xanthine phosphoribosyltransferase | 6.33e-15 | 1.31e-33 | NA | 0.7954 |
2. PF | Q82EU1 | Orotate phosphoribosyltransferase | 1.08e-10 | 1.75e-30 | NA | 0.6725 |
2. PF | B2TL11 | Xanthine phosphoribosyltransferase | 3.95e-14 | 5.33e-33 | NA | 0.7822 |
2. PF | Q6L2K9 | Orotate phosphoribosyltransferase | 8.55e-12 | 3.04e-40 | NA | 0.71 |
2. PF | Q3BS29 | Uracil phosphoribosyltransferase | 3.33e-07 | 9.23e-11 | NA | 0.5535 |
2. PF | C3MRJ6 | Uracil phosphoribosyltransferase | 5.80e-06 | 6.06e-13 | NA | 0.5093 |
2. PF | C4ZX73 | Uracil phosphoribosyltransferase | 3.38e-07 | 1.22e-11 | NA | 0.4875 |
2. PF | B7JHT4 | Xanthine phosphoribosyltransferase | 3.33e-15 | 3.55e-30 | NA | 0.8089 |
2. PF | C3MZM1 | Uracil phosphoribosyltransferase | 5.74e-06 | 6.06e-13 | NA | 0.5097 |
2. PF | Q6AQH2 | Uracil phosphoribosyltransferase | 3.67e-07 | 5.72e-12 | NA | 0.5528 |
2. PF | A5VLG9 | Xanthine phosphoribosyltransferase | 2.00e-15 | 3.93e-35 | NA | 0.7897 |
2. PF | Q4JAV0 | Uracil phosphoribosyltransferase | 1.53e-06 | 3.30e-12 | NA | 0.4924 |
2. PF | Q2J1V2 | Orotate phosphoribosyltransferase | 4.92e-11 | 1.91e-32 | NA | 0.6152 |
2. PF | C6BW21 | Orotate phosphoribosyltransferase | 2.24e-10 | 1.99e-11 | NA | 0.6614 |
2. PF | Q74EM9 | Uracil phosphoribosyltransferase | 2.88e-07 | 3.16e-11 | NA | 0.536 |
2. PF | Q73AS5 | Xanthine phosphoribosyltransferase | 3.22e-15 | 4.29e-31 | NA | 0.8592 |
2. PF | O28533 | Orotate phosphoribosyltransferase | 2.93e-11 | 2.02e-34 | NA | 0.649 |
2. PF | Q71YD1 | Xanthine phosphoribosyltransferase | 4.44e-16 | 2.91e-34 | NA | 0.8134 |
2. PF | B9IVT8 | Xanthine phosphoribosyltransferase | 8.88e-16 | 3.55e-30 | NA | 0.8481 |
2. PF | A9A8L2 | PyrE-like protein | 6.94e-10 | 1.65e-06 | NA | 0.6389 |
2. PF | Q2NS69 | Uracil phosphoribosyltransferase | 3.91e-07 | 5.13e-14 | NA | 0.5215 |
2. PF | Q831Y0 | Xanthine phosphoribosyltransferase | 1.78e-15 | 4.27e-34 | NA | 0.8486 |
2. PF | P43857 | Uracil phosphoribosyltransferase | 4.43e-07 | 7.15e-13 | NA | 0.4814 |
2. PF | B2G8U2 | Xanthine phosphoribosyltransferase | 2.44e-15 | 3.93e-35 | NA | 0.7894 |
2. PF | P65918 | Orotate phosphoribosyltransferase | 3.19e-11 | 4.55e-18 | NA | 0.6746 |
2. PF | Q8E5B5 | Xanthine phosphoribosyltransferase | 3.89e-15 | 6.62e-35 | NA | 0.8236 |
2. PF | C4ZA66 | Xanthine phosphoribosyltransferase | 3.00e-15 | 2.67e-32 | NA | 0.7936 |
2. PF | C1DJZ2 | Xanthine phosphoribosyltransferase | 2.44e-15 | 2.61e-39 | NA | 0.8095 |
2. PF | A3PH80 | Orotate phosphoribosyltransferase | 1.72e-10 | 7.53e-11 | NA | 0.6932 |
2. PF | Q6HKZ0 | Xanthine phosphoribosyltransferase | 9.99e-16 | 3.55e-30 | NA | 0.8479 |
2. PF | P65917 | Orotate phosphoribosyltransferase | 3.12e-11 | 4.55e-18 | NA | 0.6757 |
2. PF | Q45918 | Orotate phosphoribosyltransferase | 1.47e-10 | 2.85e-17 | NA | 0.6689 |
2. PF | C1KWI4 | Xanthine phosphoribosyltransferase | 5.55e-16 | 3.59e-33 | NA | 0.8119 |
2. PF | Q9HM15 | Orotate phosphoribosyltransferase | 5.93e-12 | 1.52e-35 | NA | 0.6808 |
2. PF | Q7A7I5 | Xanthine phosphoribosyltransferase | 6.22e-15 | 1.31e-33 | NA | 0.7958 |
2. PF | Q8CUP6 | Xanthine phosphoribosyltransferase | 5.88e-15 | 1.42e-33 | NA | 0.8225 |
2. PF | Q74LF9 | Xanthine phosphoribosyltransferase | 5.55e-16 | 1.77e-35 | NA | 0.8027 |
2. PF | A7GCI1 | Xanthine phosphoribosyltransferase 2 | 2.44e-15 | 3.38e-31 | NA | 0.7823 |
2. PF | Q18FD1 | Orotate phosphoribosyltransferase | 4.47e-11 | 5.04e-28 | NA | 0.6748 |
2. PF | C1ENK3 | Xanthine phosphoribosyltransferase | 3.44e-15 | 1.18e-31 | NA | 0.855 |
2. PF | B2FLX2 | Uracil phosphoribosyltransferase | 3.13e-07 | 4.83e-10 | NA | 0.5072 |
2. PF | A5IPW7 | Xanthine phosphoribosyltransferase | 6.88e-15 | 1.20e-32 | NA | 0.7949 |
2. PF | C1KWD9 | Bifunctional protein PyrR | 4.24e-07 | 2.78e-09 | NA | 0.5883 |
2. PF | Q81SQ5 | Xanthine phosphoribosyltransferase | 8.88e-16 | 3.55e-30 | NA | 0.8483 |
2. PF | C4KIV1 | Uracil phosphoribosyltransferase | 5.82e-06 | 6.54e-13 | NA | 0.5092 |
2. PF | A5A6I1 | Hypoxanthine-guanine phosphoribosyltransferase | 1.04e-02 | 5.06e-09 | NA | 0.6221 |
2. PF | A6TYN9 | Xanthine phosphoribosyltransferase | 6.88e-15 | 1.20e-32 | NA | 0.7951 |
2. PF | A3D3D2 | Uracil phosphoribosyltransferase | 3.68e-07 | 4.12e-11 | NA | 0.4833 |
2. PF | A9MHP1 | Uracil phosphoribosyltransferase | 3.10e-07 | 1.05e-11 | NA | 0.4873 |
2. PF | A6VI67 | PyrE-like protein | 4.27e-10 | 1.83e-06 | NA | 0.6564 |
2. PF | Q18CS5 | Orotate phosphoribosyltransferase | 8.42e-12 | 3.98e-20 | NA | 0.6952 |
2. PF | Q5FMD9 | Xanthine phosphoribosyltransferase | 8.88e-16 | 1.60e-39 | NA | 0.7891 |
2. PF | Q0TRB3 | Orotate phosphoribosyltransferase | 2.51e-12 | 4.74e-24 | NA | 0.7093 |
2. PF | Q3IT15 | Orotate phosphoribosyltransferase | 5.89e-11 | 4.77e-35 | NA | 0.6619 |
2. PF | Q2YVL8 | Xanthine phosphoribosyltransferase | 6.22e-15 | 4.03e-34 | NA | 0.7952 |
2. PF | Q28RK4 | Orotate phosphoribosyltransferase | 1.07e-10 | 1.48e-13 | NA | 0.6791 |
2. PF | Q8G5W1 | Xanthine phosphoribosyltransferase | 2.89e-15 | 3.32e-31 | NA | 0.789 |
2. PF | Q3AN25 | Orotate phosphoribosyltransferase | 4.27e-11 | 1.62e-27 | NA | 0.6346 |
2. PF | Q980Q4 | Uracil phosphoribosyltransferase | 5.08e-06 | 3.07e-12 | NA | 0.5106 |
2. PF | C5CLM9 | Uracil phosphoribosyltransferase | 5.48e-05 | 2.59e-10 | NA | 0.6009 |
2. PF | Q8TXQ0 | Hypoxanthine/guanine phosphoribosyltransferase | 2.79e-13 | 2.58e-38 | NA | 0.7632 |
2. PF | Q2G9W6 | Orotate phosphoribosyltransferase | 5.06e-11 | 5.74e-21 | NA | 0.6862 |
2. PF | Q3K146 | Orotate phosphoribosyltransferase | 3.07e-11 | 1.49e-17 | NA | 0.6761 |
2. PF | Q3J555 | Orotate phosphoribosyltransferase | 1.68e-10 | 7.09e-11 | NA | 0.6887 |
2. PF | O27375 | Hypoxanthine/guanine phosphoribosyltransferase | 4.36e-13 | 1.14e-36 | NA | 0.7522 |
2. PF | Q6GJQ9 | Xanthine phosphoribosyltransferase | 6.44e-15 | 9.70e-34 | NA | 0.7949 |
2. PF | B9LCT9 | Xanthine phosphoribosyltransferase | 1.22e-15 | 2.62e-24 | NA | 0.801 |
2. PF | Q9JV58 | Uracil phosphoribosyltransferase | 3.06e-07 | 2.59e-13 | NA | 0.5263 |
2. PF | C3MY92 | Uracil phosphoribosyltransferase | 5.90e-06 | 6.06e-13 | NA | 0.5093 |
2. PF | A2SQ87 | Orotate phosphoribosyltransferase | 4.10e-11 | 1.05e-37 | NA | 0.6463 |
2. PF | A1A190 | Xanthine phosphoribosyltransferase | 2.89e-15 | 1.60e-37 | NA | 0.784 |
2. PF | Q8YM41 | Orotate phosphoribosyltransferase | 8.72e-11 | 4.50e-14 | NA | 0.6463 |
2. PF | B1YHS1 | Xanthine phosphoribosyltransferase | 2.66e-15 | 1.84e-37 | NA | 0.8088 |
2. PF | Q9AGS1 | Xanthine phosphoribosyltransferase | 2.08e-14 | 3.27e-39 | NA | 0.7824 |
2. PF | B0TDZ8 | Orotate phosphoribosyltransferase | 1.21e-11 | 2.53e-24 | NA | 0.6997 |
2. PF | Q3IC38 | Uracil phosphoribosyltransferase | 3.66e-07 | 2.57e-11 | NA | 0.513 |
2. PF | O29861 | PyrE-like protein | 4.42e-10 | 7.84e-09 | NA | 0.6764 |
2. PF | Q0STN9 | Orotate phosphoribosyltransferase | 2.65e-12 | 4.74e-24 | NA | 0.7358 |
2. PF | A3CU84 | Orotate phosphoribosyltransferase | 2.27e-11 | 2.36e-34 | NA | 0.6786 |
2. PF | C3N7P3 | Uracil phosphoribosyltransferase | 5.23e-06 | 6.06e-13 | NA | 0.508 |
2. PF | Q8Y617 | Xanthine phosphoribosyltransferase | 4.44e-16 | 2.91e-34 | NA | 0.8132 |
2. PF | Q03Q10 | Xanthine phosphoribosyltransferase | 1.44e-15 | 9.73e-33 | NA | 0.86 |
2. PF | A6UR69 | PyrE-like protein | 1.47e-09 | 2.76e-06 | NA | 0.6773 |
2. PF | Q12V34 | PyrE-like protein | 2.88e-10 | 2.49e-05 | NA | 0.6551 |
2. PF | B3DSF5 | Xanthine phosphoribosyltransferase | 2.78e-15 | 3.32e-31 | NA | 0.7897 |
2. PF | A5UF76 | Uracil phosphoribosyltransferase | 4.40e-07 | 7.15e-13 | NA | 0.4848 |
2. PF | Q975Z7 | Uracil phosphoribosyltransferase | 1.56e-06 | 6.24e-12 | NA | 0.4618 |
2. PF | Q6M139 | PyrE-like protein | 5.80e-10 | 1.83e-06 | NA | 0.6792 |
2. PF | Q891J4 | Orotate phosphoribosyltransferase | 4.09e-12 | 6.48e-23 | NA | 0.7473 |
2. PF | A5TZA9 | Orotate phosphoribosyltransferase | 7.72e-11 | 1.13e-35 | NA | 0.6267 |
2. PF | P42085 | Xanthine phosphoribosyltransferase | 3.11e-15 | 1.67e-32 | NA | 0.8047 |
2. PF | C1DC78 | Uracil phosphoribosyltransferase | 3.50e-07 | 6.36e-11 | NA | 0.5635 |
2. PF | A0RC17 | Xanthine phosphoribosyltransferase | 3.00e-15 | 1.18e-31 | NA | 0.8488 |
2. PF | Q7CNQ9 | Hypoxanthine-guanine phosphoribosyltransferase | 1.86e-06 | 6.66e-03 | NA | 0.6413 |
2. PF | Q1GFQ6 | Orotate phosphoribosyltransferase | 5.63e-11 | 4.50e-15 | NA | 0.6858 |
2. PF | A1SPW6 | Orotate phosphoribosyltransferase | 1.35e-11 | 8.31e-32 | NA | 0.6329 |
2. PF | A4Y5T9 | Uracil phosphoribosyltransferase | 3.61e-07 | 4.82e-11 | NA | 0.4843 |
2. PF | A5HYL0 | Xanthine phosphoribosyltransferase 1 | 3.22e-15 | 5.15e-31 | NA | 0.8214 |
2. PF | Q9X8R7 | Orotate phosphoribosyltransferase | 1.15e-10 | 1.56e-29 | NA | 0.6568 |
2. PF | C3P5T8 | Xanthine phosphoribosyltransferase | 2.89e-15 | 3.55e-30 | NA | 0.8097 |
2. PF | Q5SHI8 | Orotate phosphoribosyltransferase | 2.73e-12 | 2.12e-26 | NA | 0.7187 |
2. PF | A1KFK3 | Orotate phosphoribosyltransferase | 7.78e-11 | 1.13e-35 | NA | 0.6475 |
2. PF | A6QE68 | Xanthine phosphoribosyltransferase | 6.33e-15 | 1.31e-33 | NA | 0.795 |
2. PF | A4YL97 | Orotate phosphoribosyltransferase | 7.77e-11 | 2.13e-28 | NA | 0.6969 |
2. PF | A7FPI7 | Xanthine phosphoribosyltransferase 1 | 2.55e-15 | 5.15e-31 | NA | 0.8039 |
2. PF | Q92AC4 | Xanthine phosphoribosyltransferase | 5.55e-16 | 1.49e-35 | NA | 0.8111 |
2. PF | A7GNB6 | Xanthine phosphoribosyltransferase | 3.66e-15 | 1.26e-30 | NA | 0.849 |
2. PF | Q8CQR0 | Xanthine phosphoribosyltransferase | 7.77e-15 | 1.47e-36 | NA | 0.7716 |
2. PF | A8Z0Q8 | Xanthine phosphoribosyltransferase | 6.33e-15 | 1.31e-33 | NA | 0.7947 |
2. PF | B3E677 | Uracil phosphoribosyltransferase | 3.52e-07 | 2.41e-14 | NA | 0.5164 |
2. PF | Q2RKK1 | Xanthine phosphoribosyltransferase | 1.32e-14 | 8.62e-36 | NA | 0.7634 |
2. PF | B3QLE2 | Orotate phosphoribosyltransferase | 1.50e-12 | 3.69e-23 | NA | 0.7627 |
2. PF | Q2FJM8 | Xanthine phosphoribosyltransferase | 6.44e-15 | 1.31e-33 | NA | 0.7953 |
2. PF | B2V327 | Xanthine phosphoribosyltransferase | 3.15e-14 | 3.34e-32 | NA | 0.7826 |
2. PF | Q7NS06 | Uracil phosphoribosyltransferase | 3.11e-07 | 1.39e-12 | NA | 0.5138 |
2. PF | Q8Y668 | Orotate phosphoribosyltransferase | 3.39e-11 | 5.23e-21 | NA | 0.7158 |
2. PF | Q4L383 | Xanthine phosphoribosyltransferase | 8.33e-15 | 8.85e-35 | NA | 0.8016 |
2. PF | Q9CB28 | Orotate phosphoribosyltransferase | 5.96e-11 | 5.17e-34 | NA | 0.6373 |
2. PF | Q163V5 | Orotate phosphoribosyltransferase | 7.49e-11 | 4.53e-16 | NA | 0.6907 |
2. PF | A4VPB2 | Uracil phosphoribosyltransferase | 3.50e-07 | 1.44e-12 | NA | 0.5433 |
2. PF | Q5HRX4 | Xanthine phosphoribosyltransferase | 7.55e-15 | 1.47e-36 | NA | 0.7716 |
2. PF | Q5KUI3 | Uracil phosphoribosyltransferase | 3.88e-07 | 1.57e-12 | NA | 0.5977 |
2. PF | Q185K4 | Xanthine phosphoribosyltransferase | 2.11e-15 | 9.13e-38 | NA | 0.7606 |
2. PF | A0AJZ0 | Xanthine phosphoribosyltransferase | 5.55e-16 | 3.94e-36 | NA | 0.8266 |
2. PF | Q13CJ6 | Orotate phosphoribosyltransferase | 8.25e-11 | 1.42e-32 | NA | 0.6148 |
2. PF | Q88XQ4 | Xanthine phosphoribosyltransferase | 9.99e-16 | 2.27e-34 | NA | 0.8638 |
2. PF | A9WA88 | Xanthine phosphoribosyltransferase | 2.28e-13 | 2.62e-24 | NA | 0.7291 |
2. PF | Q9UX09 | Orotate phosphoribosyltransferase | 6.99e-11 | 1.73e-16 | NA | 0.6847 |
2. PF | Q89BL4 | Orotate phosphoribosyltransferase | 5.14e-11 | 4.34e-32 | NA | 0.6521 |
2. PF | Q2FPD8 | PyrE-like protein | 2.05e-10 | 8.59e-11 | NA | 0.6632 |
2. PF | B2GDT2 | Xanthine phosphoribosyltransferase | 8.66e-15 | 4.85e-33 | NA | 0.7754 |
2. PF | Q5HIQ9 | Xanthine phosphoribosyltransferase | 6.11e-15 | 1.31e-33 | NA | 0.795 |
2. PF | A4WPB6 | Orotate phosphoribosyltransferase | 1.16e-10 | 3.24e-10 | NA | 0.696 |
2. PF | B8DUR4 | Xanthine phosphoribosyltransferase | 1.67e-15 | 5.37e-34 | NA | 0.7914 |
2. PF | B7HL82 | Xanthine phosphoribosyltransferase | 8.88e-16 | 3.55e-30 | NA | 0.8551 |
2. PF | Q8XL65 | Orotate phosphoribosyltransferase | 2.36e-12 | 4.74e-24 | NA | 0.7363 |
2. PF | A7GA73 | Xanthine phosphoribosyltransferase 1 | 4.11e-15 | 3.44e-31 | NA | 0.7904 |
2. PF | B8I1G1 | Xanthine phosphoribosyltransferase | 3.08e-14 | 2.41e-36 | NA | 0.7514 |
2. PF | B7GSB6 | Xanthine phosphoribosyltransferase | 2.78e-15 | 9.60e-31 | NA | 0.782 |
2. PF | Q5LQ42 | Orotate phosphoribosyltransferase | 6.06e-11 | 1.07e-13 | NA | 0.7035 |
2. PF | Q1QVR2 | Uracil phosphoribosyltransferase | 4.01e-07 | 2.34e-13 | NA | 0.5037 |
2. PF | A6TTD6 | Xanthine phosphoribosyltransferase | 8.88e-16 | 2.08e-26 | NA | 0.7632 |
2. PF | Q99WJ1 | Xanthine phosphoribosyltransferase | 6.66e-15 | 1.31e-33 | NA | 0.7951 |
2. PF | Q8DZL5 | Xanthine phosphoribosyltransferase | 4.00e-15 | 6.62e-35 | NA | 0.8678 |
2. PF | D4GZW2 | Orotate phosphoribosyltransferase | 6.05e-11 | 7.34e-33 | NA | 0.6642 |
2. PF | Q98GV3 | Uracil phosphoribosyltransferase | 3.59e-05 | 3.04e-09 | NA | 0.5968 |
2. PF | C6DZH8 | Uracil phosphoribosyltransferase | 2.17e-07 | 4.28e-13 | NA | 0.5242 |
2. PF | A6LW55 | Xanthine phosphoribosyltransferase | 3.33e-15 | 6.19e-31 | NA | 0.8101 |
2. PF | Q63DG7 | Xanthine phosphoribosyltransferase | 1.11e-15 | 2.96e-30 | NA | 0.8531 |
2. PF | A9N2Y1 | Uracil phosphoribosyltransferase | 3.06e-07 | 1.05e-11 | NA | 0.4872 |
2. PF | B0T3H5 | Orotate phosphoribosyltransferase | 1.43e-11 | 8.02e-22 | NA | 0.679 |
2. PF | A7WY89 | Xanthine phosphoribosyltransferase | 6.33e-15 | 1.31e-33 | NA | 0.7951 |
2. PF | Q8NKQ2 | PyrE-like protein | 2.82e-10 | 1.56e-08 | NA | 0.6466 |
2. PF | Q6N0N8 | Orotate phosphoribosyltransferase | 6.24e-11 | 1.74e-31 | NA | 0.6153 |
2. PF | A2SGT8 | Uracil phosphoribosyltransferase | 2.41e-07 | 2.17e-10 | NA | 0.5174 |
2. PF | P61498 | Orotate phosphoribosyltransferase | 3.04e-12 | 4.05e-26 | NA | 0.7182 |
2. PF | Q97CT9 | Orotate phosphoribosyltransferase | 3.33e-12 | 3.15e-38 | NA | 0.6979 |
2. PF | Q71WP0 | Uracil phosphoribosyltransferase | 2.90e-05 | 4.18e-13 | NA | 0.5911 |
3. BF | P37551 | Pur operon repressor | 6.79e-14 | NA | 1.54e-05 | 0.8367 |
3. BF | P65832 | Pur operon repressor | 1.50e-14 | NA | 4.49e-05 | 0.8507 |
3. BF | P65833 | Pur operon repressor | 1.50e-14 | NA | 4.49e-05 | 0.8513 |
3. BF | A5U5T4 | Adenine phosphoribosyltransferase | 0.00e+00 | NA | 3.76e-21 | 0.9288 |
4. PB | P46534 | Orotate phosphoribosyltransferase | 8.54e-11 | 4.92e-20 | 0.003 | NA |
4. PB | A4WLH7 | Orotate phosphoribosyltransferase | 4.67e-11 | 1.29e-18 | 4.00e-04 | NA |
4. PB | P0CL79 | Orotate phosphoribosyltransferase | 1.50e-11 | 1.05e-36 | 4.97e-09 | NA |
4. PB | C5A1Y3 | Orotate phosphoribosyltransferase | 2.77e-11 | 1.39e-31 | 4.19e-06 | NA |
4. PB | P49435 | Adenine phosphoribosyltransferase 1 | 0.00e+00 | 3.14e-48 | 2.33e-19 | NA |
4. PB | B7GV69 | Orotate phosphoribosyltransferase | 2.45e-09 | 4.14e-17 | 0.022 | NA |
4. PB | Q8ZTG3 | Orotate phosphoribosyltransferase | 4.53e-11 | 2.58e-17 | 1.22e-05 | NA |
4. PB | A8FK23 | Orotate phosphoribosyltransferase | 4.16e-11 | 8.15e-15 | 2.24e-04 | NA |
4. PB | Q42563 | Adenine phosphoribosyltransferase 2 | 0.00e+00 | 8.68e-35 | 2.47e-32 | NA |
4. PB | A7H149 | Orotate phosphoribosyltransferase | 4.37e-11 | 6.93e-15 | 3.15e-05 | NA |
4. PB | P69503 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.24e-55 | 1.34e-40 | NA |
4. PB | A8AXM7 | Orotate phosphoribosyltransferase | 4.91e-11 | 1.15e-18 | 0.037 | NA |
4. PB | P58861 | Orotate phosphoribosyltransferase | 9.46e-12 | 7.93e-38 | 6.12e-07 | NA |
4. PB | B5E6M0 | Adenine phosphoribosyltransferase | NA | 1.22e-69 | 2.89e-43 | NA |
4. PB | Q17Z49 | Orotate phosphoribosyltransferase | 5.64e-11 | 1.59e-15 | 0.022 | NA |
4. PB | P12426 | Adenine phosphoribosyltransferase | 0.00e+00 | 3.43e-44 | 8.17e-24 | NA |
4. PB | A5CVN5 | Orotate phosphoribosyltransferase | 1.13e-09 | 1.52e-18 | 0.024 | NA |
4. PB | A1VXV5 | Orotate phosphoribosyltransferase | 3.57e-11 | 1.19e-14 | 3.56e-04 | NA |
4. PB | P58860 | Orotate phosphoribosyltransferase | 2.28e-11 | 9.29e-32 | 0.046 | NA |
4. PB | P08030 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.36e-46 | 1.71e-30 | NA |
4. PB | Q58509 | Orotate phosphoribosyltransferase | 2.32e-11 | 4.96e-37 | 1.38e-04 | NA |
4. PB | A6Q639 | Orotate phosphoribosyltransferase | 4.80e-11 | 3.07e-16 | 0.007 | NA |
4. PB | Q0W2K2 | PyrE-like protein | 3.98e-10 | 1.65e-09 | 2.49e-04 | NA |
4. PB | Q9SU38 | Adenine phosphoribosyltransferase 4 | 0.00e+00 | 2.07e-43 | 1.08e-36 | NA |
4. PB | A7HZX7 | Orotate phosphoribosyltransferase | 3.68e-11 | 1.11e-15 | 0.012 | NA |
4. PB | Q30NT9 | Orotate phosphoribosyltransferase | 3.68e-11 | 2.78e-16 | 0.004 | NA |
4. PB | A7H1T2 | Orotate phosphoribosyltransferase | 4.14e-11 | 2.83e-14 | 1.43e-04 | NA |
4. PB | B9LUS0 | PyrE-like protein | 2.68e-10 | 1.80e-07 | 0.013 | NA |
4. PB | A6Q687 | Orotate phosphoribosyltransferase | 4.16e-11 | 6.34e-17 | 0.005 | NA |
4. PB | A5ULL0 | PyrE-like protein | 3.64e-10 | 7.41e-09 | 0.008 | NA |
4. PB | Q8A1D5 | Orotate phosphoribosyltransferase | 5.93e-12 | 8.63e-20 | 0.002 | NA |
4. PB | Q2FXU0 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.41e-62 | 1.48e-51 | NA |
4. PB | Q3AC07 | Orotate phosphoribosyltransferase | 2.06e-12 | 1.24e-23 | 6.68e-06 | NA |
4. PB | P36973 | Adenine phosphoribosyltransferase 2 | 0.00e+00 | 1.48e-44 | 6.41e-11 | NA |
4. PB | Q5HWM9 | Orotate phosphoribosyltransferase | 4.01e-11 | 2.20e-14 | 1.27e-04 | NA |
4. PB | Q7MUX4 | Orotate phosphoribosyltransferase | 2.75e-11 | 7.24e-21 | 6.92e-04 | NA |
4. PB | Q5ALX8 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.04e-47 | 1.17e-28 | NA |
4. PB | Q9PIR1 | Orotate phosphoribosyltransferase | 3.67e-11 | 1.51e-14 | 1.58e-04 | NA |
4. PB | Q59049 | Hypoxanthine/guanine phosphoribosyltransferase | 3.49e-13 | 1.34e-42 | 1.99e-09 | NA |
4. PB | A4G1L0 | Orotate phosphoribosyltransferase | 1.20e-09 | 4.49e-11 | 0.044 | NA |
4. PB | B7ICE9 | Orotate phosphoribosyltransferase | 2.06e-09 | 4.14e-17 | 0.022 | NA |
4. PB | A7ZGD3 | Orotate phosphoribosyltransferase | 2.32e-11 | 1.73e-14 | 1.24e-05 | NA |
4. PB | P9WQ07 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.39e-04 | 3.03e-21 | NA |
4. PB | Q55C82 | Probable adenine phosphoribosyltransferase | 0.00e+00 | 5.63e-40 | 1.86e-19 | NA |
4. PB | B2I1J9 | Orotate phosphoribosyltransferase | 1.96e-09 | 4.32e-17 | 0.040 | NA |
4. PB | A2SBW1 | Orotate phosphoribosyltransferase | 3.34e-09 | 2.33e-12 | 0.002 | NA |
4. PB | Q9SUW2 | Adenine phosphoribosyltransferase 3 | 0.00e+00 | 1.79e-38 | 5.76e-36 | NA |
4. PB | O42842 | Adenine phosphoribosyltransferase | 0.00e+00 | 1.84e-49 | 1.42e-36 | NA |
4. PB | Q5LI12 | Orotate phosphoribosyltransferase | 5.53e-12 | 3.26e-20 | 0.002 | NA |
4. PB | Q9LFP0 | Adenine phosphoribosyltransferase 5 | 0.00e+00 | 8.84e-40 | 1.74e-38 | NA |
4. PB | B9KE25 | Orotate phosphoribosyltransferase | 4.38e-11 | 3.43e-15 | 1.47e-04 | NA |
4. PB | O58855 | Orotate phosphoribosyltransferase | 1.60e-11 | 7.09e-36 | 1.83e-06 | NA |
4. PB | A3CN88 | Orotate phosphoribosyltransferase | 5.33e-11 | 6.18e-18 | 0.046 | NA |
4. PB | P36972 | Adenine phosphoribosyltransferase | 0.00e+00 | 2.45e-48 | 1.06e-30 | NA |
4. PB | A3DM49 | Orotate phosphoribosyltransferase | 2.23e-11 | 2.88e-19 | 0.003 | NA |
4. PB | P91455 | Adenine phosphoribosyltransferase | 0.00e+00 | 5.44e-49 | 4.11e-27 | NA |
4. PB | P07741 | Adenine phosphoribosyltransferase | 0.00e+00 | 8.01e-42 | 1.11e-28 | NA |
4. PB | A1RRV2 | Orotate phosphoribosyltransferase | 2.99e-11 | 8.16e-19 | 1.09e-04 | NA |
4. PB | A6KYP1 | Orotate phosphoribosyltransferase | 4.97e-12 | 5.07e-16 | 1.71e-04 | NA |
5. P | Q72XD8 | Uracil phosphoribosyltransferase | 4.62e-07 | 2.40e-13 | NA | NA |
5. P | B1ZJQ5 | Orotate phosphoribosyltransferase | 4.07e-11 | 1.03e-20 | NA | NA |
5. P | Q5SIQ7 | Uracil phosphoribosyltransferase | 9.73e-07 | 2.49e-13 | NA | NA |
5. P | A9MY09 | Xanthine-guanine phosphoribosyltransferase | 4.27e-06 | 1.67e-08 | NA | NA |
5. P | B2JE33 | Uracil phosphoribosyltransferase | 4.77e-05 | 1.06e-09 | NA | NA |
5. P | B5Y1E0 | Xanthine-guanine phosphoribosyltransferase | 5.05e-06 | 1.92e-08 | NA | NA |
5. P | P0DH34 | Uracil phosphoribosyltransferase | 5.20e-07 | 1.81e-12 | NA | NA |
5. P | A5H0J4 | Uracil phosphoribosyltransferase | 2.30e-05 | 5.99e-07 | NA | NA |
5. P | B2UV21 | Orotate phosphoribosyltransferase | 3.50e-11 | 4.20e-15 | NA | NA |
5. P | A0AJU5 | Bifunctional protein PyrR | 4.34e-07 | 5.12e-09 | NA | NA |
5. P | A5UG90 | Orotate phosphoribosyltransferase | 2.03e-09 | 9.58e-15 | NA | NA |
5. P | Q0HTW9 | Uracil phosphoribosyltransferase | 3.41e-07 | 5.19e-11 | NA | NA |
5. P | P57339 | Xanthine-guanine phosphoribosyltransferase | 3.82e-06 | 2.17e-07 | NA | NA |
5. P | Q02WM7 | Uracil phosphoribosyltransferase | 5.07e-07 | 8.72e-12 | NA | NA |
5. P | Q3ISU0 | Uracil phosphoribosyltransferase | 1.44e-04 | 5.51e-12 | NA | NA |
5. P | P0CQ41 | Orotate phosphoribosyltransferase | 2.82e-08 | 1.04e-12 | NA | NA |
5. P | A8AKQ0 | Xanthine-guanine phosphoribosyltransferase | 4.48e-06 | 2.17e-08 | NA | NA |
5. P | Q62IJ1 | Uracil phosphoribosyltransferase | 4.41e-05 | 2.88e-10 | NA | NA |
5. P | A9MKN3 | Orotate phosphoribosyltransferase | 1.61e-09 | 4.80e-14 | NA | NA |
5. P | P50926 | Uracil phosphoribosyltransferase | 4.31e-07 | 1.38e-11 | NA | NA |
5. P | B6EIE9 | Xanthine-guanine phosphoribosyltransferase | 2.59e-06 | 1.27e-07 | NA | NA |
5. P | A2CCL7 | Orotate phosphoribosyltransferase | 5.76e-11 | 1.79e-24 | NA | NA |
5. P | Q8YV98 | Bifunctional protein PyrR | 3.62e-07 | 2.30e-10 | NA | NA |
5. P | A7HX43 | Orotate phosphoribosyltransferase | 9.11e-12 | 5.83e-21 | NA | NA |
5. P | A1W0S0 | Uracil phosphoribosyltransferase | 6.22e-05 | 1.58e-13 | NA | NA |
5. P | Q7N7B4 | Xanthine-guanine phosphoribosyltransferase | 3.83e-06 | 7.74e-08 | NA | NA |
5. P | B1JQX7 | Orotate phosphoribosyltransferase | 2.93e-09 | 3.89e-14 | NA | NA |
5. P | B7IUP2 | Orotate phosphoribosyltransferase | 6.09e-11 | 1.20e-17 | NA | NA |
5. P | Q8U1G7 | Uracil phosphoribosyltransferase | 6.90e-05 | 1.43e-10 | NA | NA |
5. P | Q3SQJ9 | Xanthine-guanine phosphoribosyltransferase | 1.11e-06 | 2.33e-11 | NA | NA |
5. P | C3KYI1 | Uracil phosphoribosyltransferase | 5.72e-07 | 1.37e-13 | NA | NA |
5. P | A5CNC6 | Uracil phosphoribosyltransferase | 4.20e-07 | 6.24e-12 | NA | NA |
5. P | A3DIL9 | Uracil phosphoribosyltransferase | 5.43e-05 | 2.08e-14 | NA | NA |
5. P | P9WHK2 | Bifunctional protein PyrR | 6.47e-05 | 3.36e-10 | NA | NA |
5. P | Q5HTC1 | Uracil phosphoribosyltransferase | 5.69e-05 | 1.00e-13 | NA | NA |
5. P | Q8P469 | Orotate phosphoribosyltransferase | 1.68e-09 | 1.85e-12 | NA | NA |
5. P | B5RCX0 | Uracil phosphoribosyltransferase | 3.29e-07 | 1.05e-11 | NA | NA |
5. P | B1LHT4 | Xanthine-guanine phosphoribosyltransferase | 4.90e-06 | 2.86e-08 | NA | NA |
5. P | A5IS83 | Bifunctional protein PyrR | 8.04e-07 | 2.42e-08 | NA | NA |
5. P | Q8E7Y1 | Hypoxanthine-guanine phosphoribosyltransferase | 2.01e-06 | 5.88e-03 | NA | NA |
5. P | A8A2Z0 | Uracil phosphoribosyltransferase | 3.35e-07 | 1.22e-11 | NA | NA |
5. P | B2TXS3 | Uracil phosphoribosyltransferase | 3.46e-07 | 1.22e-11 | NA | NA |
5. P | B9J8H7 | Orotate phosphoribosyltransferase | 1.96e-10 | 1.76e-11 | NA | NA |
5. P | Q72J35 | Uracil phosphoribosyltransferase | 9.49e-07 | 2.49e-13 | NA | NA |
5. P | A4QEI8 | Bifunctional protein PyrR | 3.62e-05 | 3.24e-07 | NA | NA |
5. P | A9VTD1 | Bifunctional protein PyrR | 8.69e-07 | 1.66e-09 | NA | NA |
5. P | Q4ZZ69 | Bifunctional protein PyrR | 3.15e-07 | 8.51e-07 | NA | NA |
5. P | A2S4B1 | Uracil phosphoribosyltransferase | 4.46e-05 | 2.88e-10 | NA | NA |
5. P | B5Z8Q2 | Orotate phosphoribosyltransferase | 3.99e-11 | 3.87e-15 | NA | NA |
5. P | A6LQG6 | Uracil phosphoribosyltransferase | 5.81e-07 | 3.03e-13 | NA | NA |
5. P | B7NEU6 | Orotate phosphoribosyltransferase | 1.81e-09 | 6.59e-14 | NA | NA |
5. P | A0KNR2 | Xanthine-guanine phosphoribosyltransferase | 2.06e-06 | 4.49e-05 | NA | NA |
5. P | B5BI16 | Orotate phosphoribosyltransferase | 1.98e-09 | 3.49e-13 | NA | NA |
5. P | P07833 | Hypoxanthine-guanine-xanthine phosphoribosyltransferase | 8.33e-05 | 1.00e-06 | NA | NA |
5. P | C4ZXN4 | Orotate phosphoribosyltransferase | 2.03e-09 | 6.59e-14 | NA | NA |
5. P | Q88PV2 | Uracil phosphoribosyltransferase | 3.67e-07 | 4.93e-12 | NA | NA |
5. P | B2TNF7 | Orotate phosphoribosyltransferase | 2.79e-09 | 9.20e-15 | NA | NA |
5. P | B1MZJ0 | Bifunctional protein PyrR | 6.07e-07 | 2.10e-08 | NA | NA |
5. P | Q5HE88 | Uracil phosphoribosyltransferase | 5.64e-07 | 1.48e-12 | NA | NA |
5. P | Q9A810 | Orotate phosphoribosyltransferase | 1.44e-11 | 2.45e-22 | NA | NA |
5. P | Q03FM3 | Bifunctional protein PyrR | 7.93e-05 | 9.80e-09 | NA | NA |
5. P | A0RR59 | Uracil phosphoribosyltransferase | 4.96e-05 | 1.95e-12 | NA | NA |
5. P | C1C7Q6 | Bifunctional protein PyrR | 4.24e-07 | 3.67e-08 | NA | NA |
5. P | Q7VM31 | Bifunctional protein PyrR | 1.47e-06 | 1.51e-08 | NA | NA |
5. P | Q48MT3 | Uracil phosphoribosyltransferase | 3.55e-07 | 3.52e-11 | NA | NA |
5. P | A7H0F9 | Uracil phosphoribosyltransferase | 3.90e-05 | 1.85e-13 | NA | NA |
5. P | Q5FAK5 | Orotate phosphoribosyltransferase | 9.43e-10 | 1.05e-15 | NA | NA |
5. P | P0A9M2 | Hypoxanthine phosphoribosyltransferase | 1.73e-06 | 1.47e-02 | NA | NA |
5. P | C4Z9S1 | Uracil phosphoribosyltransferase | 6.18e-07 | 1.97e-13 | NA | NA |
5. P | Q6AQG4 | Xanthine-guanine phosphoribosyltransferase | 3.89e-06 | 1.78e-07 | NA | NA |
5. P | Q3SM42 | Orotate phosphoribosyltransferase | 1.33e-09 | 4.60e-16 | NA | NA |
5. P | B5XTG0 | Orotate phosphoribosyltransferase | 1.41e-09 | 8.83e-15 | NA | NA |
5. P | A6VQ76 | Uracil phosphoribosyltransferase | 3.96e-07 | 2.63e-13 | NA | NA |
5. P | A4QC29 | Uracil phosphoribosyltransferase | 3.49e-07 | 3.14e-12 | NA | NA |
5. P | Q329L4 | Orotate phosphoribosyltransferase | 2.68e-09 | 5.00e-14 | NA | NA |
5. P | Q7VM34 | Uracil phosphoribosyltransferase | 3.97e-07 | 5.51e-12 | NA | NA |
5. P | Q2KWB3 | Uracil phosphoribosyltransferase | 5.25e-07 | 1.56e-11 | NA | NA |
5. P | Q9CJW4 | Orotate phosphoribosyltransferase | 1.40e-09 | 1.58e-13 | NA | NA |
5. P | Q6NIX4 | Uracil phosphoribosyltransferase | 2.75e-07 | 1.25e-11 | NA | NA |
5. P | Q6A910 | Orotate phosphoribosyltransferase | 5.05e-11 | 2.30e-17 | NA | NA |
5. P | Q9KXR1 | Bifunctional protein PyrR | 5.36e-05 | 3.24e-06 | NA | NA |
5. P | B1YU48 | Uracil phosphoribosyltransferase | 4.34e-05 | 3.91e-10 | NA | NA |
5. P | A7FQG8 | Uracil phosphoribosyltransferase | 5.77e-07 | 1.37e-13 | NA | NA |
5. P | P51354 | Uracil phosphoribosyltransferase homolog | 1.02e-06 | 3.92e-02 | NA | NA |
5. P | P65944 | Bifunctional protein PyrR | 6.92e-07 | 2.42e-08 | NA | NA |
5. P | A8MJX1 | Uracil phosphoribosyltransferase | 4.84e-07 | 1.13e-13 | NA | NA |
5. P | P67400 | Uracil phosphoribosyltransferase | 6.19e-07 | 1.81e-12 | NA | NA |
5. P | Q3JUF6 | Uracil phosphoribosyltransferase | 4.44e-05 | 2.88e-10 | NA | NA |
5. P | Q82FS4 | Uracil phosphoribosyltransferase | 4.15e-07 | 9.23e-11 | NA | NA |
5. P | B1GYY9 | Bifunctional protein PyrR | 7.70e-07 | 2.85e-10 | NA | NA |
5. P | B7VHJ8 | Orotate phosphoribosyltransferase | 1.92e-09 | 7.89e-16 | NA | NA |
5. P | Q8CPJ9 | Bifunctional protein PyrR | 1.06e-06 | 5.36e-09 | NA | NA |
5. P | B6I018 | Xanthine-guanine phosphoribosyltransferase | 3.02e-06 | 2.86e-08 | NA | NA |
5. P | Q7N3F8 | Uracil phosphoribosyltransferase | 3.85e-07 | 2.86e-11 | NA | NA |
5. P | A8LRS7 | Orotate phosphoribosyltransferase | 9.36e-11 | 3.36e-14 | NA | NA |
5. P | A9MCZ3 | Uracil phosphoribosyltransferase | 2.21e-07 | 7.50e-08 | NA | NA |
5. P | Q0BD86 | Uracil phosphoribosyltransferase | 5.22e-05 | 1.35e-09 | NA | NA |
5. P | A7GV65 | Uracil phosphoribosyltransferase | 4.53e-07 | 1.28e-12 | NA | NA |
5. P | Q6F210 | Uracil phosphoribosyltransferase | 1.04e-06 | 6.71e-13 | NA | NA |
5. P | P0A278 | Xanthine-guanine phosphoribosyltransferase | 4.34e-06 | 1.67e-08 | NA | NA |
5. P | B4STF6 | Orotate phosphoribosyltransferase | 1.61e-09 | 1.55e-12 | NA | NA |
5. P | B0R3D9 | PyrE-like protein | 2.70e-10 | 1.65e-08 | NA | NA |
5. P | A6LTU0 | Bifunctional protein PyrR | 9.30e-07 | 1.43e-11 | NA | NA |
5. P | Q81WF6 | Orotate phosphoribosyltransferase | 8.01e-11 | 4.32e-17 | NA | NA |
5. P | B3PXN0 | Uracil phosphoribosyltransferase | 2.85e-05 | 2.09e-11 | NA | NA |
5. P | Q12MF1 | Uracil phosphoribosyltransferase | 3.87e-07 | 3.10e-12 | NA | NA |
5. P | B2FJX2 | Orotate phosphoribosyltransferase | 1.25e-09 | 2.33e-12 | NA | NA |
5. P | Q8DYV9 | Bifunctional protein PyrR | 3.30e-07 | 3.40e-08 | NA | NA |
5. P | Q9V0K1 | Uracil phosphoribosyltransferase | 7.15e-05 | 3.61e-11 | NA | NA |
5. P | B2SDI9 | Uracil phosphoribosyltransferase | 5.87e-07 | 8.95e-15 | NA | NA |
5. P | B1J356 | Bifunctional protein PyrR | 3.30e-07 | 3.01e-05 | NA | NA |
5. P | B3DS55 | Orotate phosphoribosyltransferase | 1.10e-08 | 3.35e-12 | NA | NA |
5. P | B4T7Q0 | Xanthine-guanine phosphoribosyltransferase | 4.18e-06 | 1.67e-08 | NA | NA |
5. P | B3H0R2 | Uracil phosphoribosyltransferase | 4.00e-07 | 2.74e-12 | NA | NA |
5. P | A6QIV6 | Uracil phosphoribosyltransferase | 5.59e-07 | 1.48e-12 | NA | NA |
5. P | A1VIL5 | Orotate phosphoribosyltransferase | 4.36e-09 | 1.01e-08 | NA | NA |
5. P | C0M7M9 | Uracil phosphoribosyltransferase | 4.68e-07 | 2.13e-12 | NA | NA |
5. P | A7MWU9 | Xanthine-guanine phosphoribosyltransferase | 2.02e-06 | 2.98e-07 | NA | NA |
5. P | Q636D5 | Bifunctional protein PyrR | 4.86e-07 | 2.34e-09 | NA | NA |
5. P | Q48U09 | Orotate phosphoribosyltransferase | 5.20e-11 | 2.13e-19 | NA | NA |
5. P | Q57IA0 | Orotate phosphoribosyltransferase | 1.97e-09 | 8.35e-14 | NA | NA |
5. P | C3PLD0 | Uracil phosphoribosyltransferase | 2.98e-07 | 1.51e-12 | NA | NA |
5. P | A5U7Y3 | Uracil phosphoribosyltransferase | 5.68e-05 | 6.07e-11 | NA | NA |
5. P | B7GZA8 | Uracil phosphoribosyltransferase | 6.70e-07 | 3.98e-11 | NA | NA |
5. P | A7Z4G7 | Bifunctional protein PyrR | 6.28e-07 | 2.32e-09 | NA | NA |
5. P | Q57LL1 | Uracil phosphoribosyltransferase | 3.22e-07 | 1.05e-11 | NA | NA |
5. P | A1JNY0 | Xanthine-guanine phosphoribosyltransferase | 3.36e-06 | 2.15e-08 | NA | NA |
5. P | Q97F73 | Uracil phosphoribosyltransferase | 4.52e-07 | 2.61e-14 | NA | NA |
5. P | Q4UVY0 | Uracil phosphoribosyltransferase | 3.48e-07 | 1.49e-10 | NA | NA |
5. P | A8FMZ1 | Uracil phosphoribosyltransferase | 6.21e-05 | 1.58e-13 | NA | NA |
5. P | A9QZW6 | Uracil phosphoribosyltransferase | 4.00e-07 | 6.48e-12 | NA | NA |
5. P | B2UD27 | Orotate phosphoribosyltransferase | 1.75e-09 | 2.11e-11 | NA | NA |
5. P | Q6G086 | Orotate phosphoribosyltransferase | 2.76e-11 | 3.60e-21 | NA | NA |
5. P | Q7VZ79 | Uracil phosphoribosyltransferase | 4.63e-07 | 2.67e-12 | NA | NA |
5. P | Q7MN62 | Xanthine-guanine phosphoribosyltransferase | 2.15e-06 | 9.72e-07 | NA | NA |
5. P | Q9A076 | Orotate phosphoribosyltransferase | 7.32e-11 | 4.37e-19 | NA | NA |
5. P | Q03EK5 | Uracil phosphoribosyltransferase | 5.66e-07 | 2.64e-12 | NA | NA |
5. P | Q5X5W4 | Orotate phosphoribosyltransferase | 4.78e-10 | 1.55e-15 | NA | NA |
5. P | C0RMK4 | Uracil phosphoribosyltransferase | 2.50e-07 | 5.20e-08 | NA | NA |
5. P | Q5WUK0 | Uracil phosphoribosyltransferase | 1.37e-04 | 8.09e-11 | NA | NA |
5. P | B1IYV8 | Orotate phosphoribosyltransferase | 1.41e-09 | 6.59e-14 | NA | NA |
5. P | Q8CRN4 | Uracil phosphoribosyltransferase | 5.58e-07 | 2.54e-12 | NA | NA |
5. P | A6U117 | Bifunctional protein PyrR | 8.55e-07 | 2.42e-08 | NA | NA |
5. P | A6USD4 | Uracil phosphoribosyltransferase | 6.36e-05 | 3.44e-10 | NA | NA |
5. P | Q1XDD3 | Uracil phosphoribosyltransferase homolog | 1.18e-06 | 3.21e-04 | NA | NA |
5. P | Q741H6 | Bifunctional protein PyrR | 4.53e-05 | 2.22e-08 | NA | NA |
5. P | O13867 | Uracil phosphoribosyltransferase 1 | 3.21e-05 | 2.29e-07 | NA | NA |
5. P | Q4UPQ3 | Orotate phosphoribosyltransferase | 1.68e-09 | 1.85e-12 | NA | NA |
5. P | Q3JE54 | Bifunctional protein PyrR | 7.84e-07 | 2.92e-07 | NA | NA |
5. P | B0R7K0 | Uracil phosphoribosyltransferase | 1.03e-03 | 2.19e-09 | NA | NA |
5. P | A2BJ25 | Orotate phosphoribosyltransferase | 3.61e-11 | 1.58e-19 | NA | NA |
5. P | Q1J888 | Uracil phosphoribosyltransferase | 5.89e-07 | 1.81e-12 | NA | NA |
5. P | Q8YH64 | Xanthine-guanine phosphoribosyltransferase | 2.77e-06 | 3.68e-05 | NA | NA |
5. P | A9A7A5 | Uracil phosphoribosyltransferase | 1.29e-04 | 3.16e-11 | NA | NA |
5. P | B4RCV1 | Orotate phosphoribosyltransferase | 2.92e-11 | 3.58e-20 | NA | NA |
5. P | P00494 | Hypoxanthine-guanine phosphoribosyltransferase | 6.93e-03 | 1.37e-09 | NA | NA |
5. P | B7MQ74 | Xanthine-guanine phosphoribosyltransferase | 4.52e-06 | 1.46e-08 | NA | NA |
5. P | Q2YUJ2 | Uracil phosphoribosyltransferase | 5.65e-07 | 1.48e-12 | NA | NA |
5. P | Q66GE0 | Orotate phosphoribosyltransferase | 3.38e-09 | 3.89e-14 | NA | NA |
5. P | B8F5N2 | Uracil phosphoribosyltransferase | 4.66e-07 | 1.18e-12 | NA | NA |
5. P | P0DD68 | Orotate phosphoribosyltransferase | 5.40e-11 | 5.07e-19 | NA | NA |
5. P | Q163Y8 | Xanthine-guanine phosphoribosyltransferase | 3.34e-06 | 2.28e-15 | NA | NA |
5. P | B9IVW8 | Bifunctional protein PyrR | 7.03e-07 | 2.34e-09 | NA | NA |
5. P | B1IE69 | Uracil phosphoribosyltransferase | 5.68e-07 | 1.37e-13 | NA | NA |
5. P | B2A3H5 | Uracil phosphoribosyltransferase | 3.64e-07 | 2.84e-13 | NA | NA |
5. P | C6BSG3 | Uracil phosphoribosyltransferase | 2.82e-07 | 3.12e-11 | NA | NA |
5. P | Q02XW4 | Bifunctional protein PyrR | 2.88e-07 | 3.55e-08 | NA | NA |
5. P | Q8Y660 | Bifunctional protein PyrR | 3.84e-07 | 2.84e-09 | NA | NA |
5. P | B8IT23 | Orotate phosphoribosyltransferase | 7.57e-11 | 2.94e-21 | NA | NA |
5. P | Q49WY6 | Orotate phosphoribosyltransferase | 6.49e-11 | 5.57e-21 | NA | NA |
5. P | C5D9M4 | Uracil phosphoribosyltransferase | 4.14e-07 | 5.47e-13 | NA | NA |
5. P | B9JQW1 | Orotate phosphoribosyltransferase | 2.46e-10 | 1.24e-13 | NA | NA |
5. P | A1SVA9 | Uracil phosphoribosyltransferase | 4.07e-07 | 3.84e-12 | NA | NA |
5. P | Q1JC80 | Orotate phosphoribosyltransferase | 4.57e-11 | 8.53e-19 | NA | NA |
5. P | B5ZAU8 | Uracil phosphoribosyltransferase | 1.07e-06 | 2.22e-13 | NA | NA |
5. P | C1ARF7 | Uracil phosphoribosyltransferase | 1.60e-06 | 4.27e-11 | NA | NA |
5. P | A0ZZM2 | Uracil phosphoribosyltransferase | 6.69e-07 | 2.30e-11 | NA | NA |
5. P | B1LNE8 | Uracil phosphoribosyltransferase | 3.34e-07 | 1.22e-11 | NA | NA |
5. P | A4XKS9 | Bifunctional protein PyrR | 2.51e-07 | 1.58e-07 | NA | NA |
5. P | Q3Z599 | Xanthine-guanine phosphoribosyltransferase | 5.04e-06 | 2.86e-08 | NA | NA |
5. P | Q8DTV2 | Orotate phosphoribosyltransferase | 6.10e-11 | 3.66e-18 | NA | NA |
5. P | B4EY88 | Uracil phosphoribosyltransferase | 3.94e-07 | 1.92e-12 | NA | NA |
5. P | B9MJ16 | Uracil phosphoribosyltransferase | 7.93e-05 | 3.08e-11 | NA | NA |
5. P | A4WRD6 | Xanthine-guanine phosphoribosyltransferase | 1.62e-06 | 1.82e-09 | NA | NA |
5. P | Q9HVE6 | Uracil phosphoribosyltransferase | 4.30e-07 | 4.63e-13 | NA | NA |
5. P | B6JN97 | Orotate phosphoribosyltransferase | 4.40e-11 | 4.32e-15 | NA | NA |
5. P | Q5JGQ6 | Uracil phosphoribosyltransferase | 6.12e-05 | 1.20e-11 | NA | NA |
5. P | Q7VRS9 | Uracil phosphoribosyltransferase | 4.37e-07 | 4.34e-13 | NA | NA |
5. P | A4JGH4 | Uracil phosphoribosyltransferase | 3.91e-05 | 5.24e-10 | NA | NA |
5. P | B8D880 | Orotate phosphoribosyltransferase | 1.57e-09 | 3.62e-15 | NA | NA |
5. P | Q8DDX5 | Orotate phosphoribosyltransferase | 2.39e-09 | 1.05e-14 | NA | NA |
5. P | P0DD40 | Hypoxanthine-guanine phosphoribosyltransferase | 1.85e-06 | 6.66e-03 | NA | NA |
5. P | B9E8F4 | Uracil phosphoribosyltransferase | 2.97e-07 | 1.40e-12 | NA | NA |
5. P | A8AD93 | Uracil phosphoribosyltransferase | 3.46e-07 | 6.89e-12 | NA | NA |
5. P | Q180X8 | Uracil phosphoribosyltransferase | 5.01e-07 | 5.63e-14 | NA | NA |
5. P | B0VU43 | Uracil phosphoribosyltransferase | 6.85e-07 | 3.98e-11 | NA | NA |
5. P | A5VVW9 | Uracil phosphoribosyltransferase | 2.57e-07 | 8.35e-08 | NA | NA |
5. P | A4TSE1 | Orotate phosphoribosyltransferase | 3.44e-09 | 3.89e-14 | NA | NA |
5. P | Q98AN7 | Orotate phosphoribosyltransferase 1 | 1.50e-10 | 1.91e-24 | NA | NA |
5. P | Q7MPT2 | Orotate phosphoribosyltransferase | 1.53e-09 | 1.19e-14 | NA | NA |
5. P | P0C939 | Uracil phosphoribosyltransferase | 4.81e-05 | 1.86e-07 | NA | NA |
5. P | Q97TC4 | Hypoxanthine-guanine phosphoribosyltransferase | 2.17e-06 | 7.24e-03 | NA | NA |
5. P | P36399 | Uracil phosphoribosyltransferase | 5.06e-07 | 1.92e-11 | NA | NA |
5. P | Q0I1C0 | Xanthine-guanine phosphoribosyltransferase | 3.53e-06 | 3.87e-07 | NA | NA |
5. P | Q1QK75 | Xanthine-guanine phosphoribosyltransferase | 1.26e-06 | 1.45e-10 | NA | NA |
5. P | Q98NH3 | Xanthine-guanine phosphoribosyltransferase | 3.41e-04 | 1.11e-06 | NA | NA |
5. P | P56162 | Orotate phosphoribosyltransferase | 3.81e-11 | 1.26e-15 | NA | NA |
5. P | P59001 | Uracil phosphoribosyltransferase | 3.72e-07 | 2.28e-10 | NA | NA |
5. P | B9JYP9 | Uracil phosphoribosyltransferase | 3.31e-05 | 1.45e-10 | NA | NA |
5. P | Q2KU70 | Orotate phosphoribosyltransferase | 1.79e-09 | 5.13e-14 | NA | NA |
5. P | Q6NH12 | Bifunctional protein PyrR | 2.50e-07 | 3.86e-09 | NA | NA |
5. P | A9NEQ2 | Uracil phosphoribosyltransferase | 1.53e-06 | 2.58e-14 | NA | NA |
5. P | Q3M8F0 | Bifunctional protein PyrR | 3.21e-07 | 1.49e-10 | NA | NA |
5. P | A4T0F4 | Orotate phosphoribosyltransferase | 1.57e-09 | 3.02e-14 | NA | NA |
5. P | B5FFE3 | Orotate phosphoribosyltransferase | 1.89e-09 | 4.43e-15 | NA | NA |
5. P | Q6L1V2 | PyrE-like protein | 1.45e-10 | 1.28e-07 | NA | NA |
5. P | Q03WF7 | Bifunctional protein PyrR | 3.56e-07 | 3.75e-08 | NA | NA |
5. P | B7N680 | Uracil phosphoribosyltransferase | 3.34e-07 | 1.22e-11 | NA | NA |
5. P | B2G680 | Uracil phosphoribosyltransferase | 2.26e-07 | 6.72e-12 | NA | NA |
5. P | B5RG81 | Orotate phosphoribosyltransferase | 1.74e-09 | 8.35e-14 | NA | NA |
5. P | P65911 | Orotate phosphoribosyltransferase | 4.06e-11 | 2.19e-21 | NA | NA |
5. P | Q8EUY4 | Orotate phosphoribosyltransferase | 5.05e-11 | 1.22e-16 | NA | NA |
5. P | P0A8F2 | Uracil phosphoribosyltransferase | 3.50e-07 | 1.22e-11 | NA | NA |
5. P | B7M7K2 | Uracil phosphoribosyltransferase | 3.45e-07 | 1.22e-11 | NA | NA |
5. P | C3P652 | Orotate phosphoribosyltransferase | 8.29e-11 | 4.32e-17 | NA | NA |
5. P | A8YUJ4 | Uracil phosphoribosyltransferase | 4.54e-07 | 1.15e-12 | NA | NA |
5. P | A6VLF2 | Orotate phosphoribosyltransferase | 2.49e-09 | 4.43e-15 | NA | NA |
5. P | A1S7E5 | Uracil phosphoribosyltransferase | 3.84e-07 | 4.17e-11 | NA | NA |
5. P | Q2IV51 | Xanthine-guanine phosphoribosyltransferase | 2.67e-06 | 1.95e-13 | NA | NA |
5. P | A3CPK9 | Uracil phosphoribosyltransferase | 4.77e-07 | 5.06e-13 | NA | NA |
5. P | B6IW12 | Uracil phosphoribosyltransferase | 4.86e-05 | 2.17e-10 | NA | NA |
5. P | B2TS13 | Bifunctional protein PyrR | 1.73e-06 | 9.06e-09 | NA | NA |
5. P | B2TJY9 | Uracil phosphoribosyltransferase | 5.41e-07 | 1.72e-12 | NA | NA |
5. P | C0ME81 | Bifunctional protein PyrR | 3.32e-07 | 1.67e-08 | NA | NA |
5. P | Q7WMM5 | Uracil phosphoribosyltransferase | 4.29e-07 | 2.99e-12 | NA | NA |
5. P | A0JSM6 | Uracil phosphoribosyltransferase | 6.01e-07 | 5.12e-12 | NA | NA |
5. P | B1J4L6 | Orotate phosphoribosyltransferase | 1.86e-09 | 7.10e-17 | NA | NA |
5. P | B7KKJ9 | Bifunctional protein PyrR | 1.82e-07 | 1.08e-09 | NA | NA |
5. P | Q1C263 | Orotate phosphoribosyltransferase | 3.43e-09 | 3.89e-14 | NA | NA |
5. P | Q6HET2 | Orotate phosphoribosyltransferase | 5.08e-11 | 1.35e-17 | NA | NA |
5. P | A2SRI7 | PyrE-like protein | 2.51e-10 | 1.10e-10 | NA | NA |
5. P | O67914 | Uracil phosphoribosyltransferase | 6.15e-07 | 3.36e-13 | NA | NA |
5. P | B5FJW9 | Xanthine-guanine phosphoribosyltransferase | 4.45e-06 | 1.67e-08 | NA | NA |
5. P | P93394 | Uracil phosphoribosyltransferase | 1.35e-04 | 3.58e-13 | NA | NA |
5. P | Q1JMD0 | Bifunctional protein PyrR | 5.10e-07 | 3.15e-09 | NA | NA |
5. P | Q7NBH2 | Uracil phosphoribosyltransferase | 4.29e-06 | 2.40e-13 | NA | NA |
5. P | Q55GQ6 | Uracil phosphoribosyltransferase | 1.97e-07 | 1.29e-08 | NA | NA |
5. P | Q1JCF0 | Bifunctional protein PyrR | 4.17e-07 | 3.15e-09 | NA | NA |
5. P | A4YCQ1 | Uracil phosphoribosyltransferase | 3.01e-06 | 9.68e-11 | NA | NA |
5. P | Q7MY25 | Orotate phosphoribosyltransferase | 1.47e-09 | 1.24e-14 | NA | NA |
5. P | B7GNR5 | Uracil phosphoribosyltransferase | 8.33e-07 | 1.45e-11 | NA | NA |
5. P | C1KYV5 | Uracil phosphoribosyltransferase | 2.90e-05 | 4.18e-13 | NA | NA |
5. P | A1KIG8 | Bifunctional protein PyrR | 5.83e-05 | 3.36e-10 | NA | NA |
5. P | Q465U8 | PyrE-like protein 2 | 4.27e-10 | 2.13e-06 | NA | NA |
5. P | Q8ZCX9 | Uracil phosphoribosyltransferase | 3.92e-07 | 6.48e-12 | NA | NA |
5. P | C3K476 | Orotate phosphoribosyltransferase | 7.55e-09 | 1.16e-15 | NA | NA |
5. P | Q9CL73 | Xanthine-guanine phosphoribosyltransferase | 2.65e-06 | 3.31e-07 | NA | NA |
5. P | Q8YDE5 | Uracil phosphoribosyltransferase | 2.41e-07 | 5.20e-08 | NA | NA |
5. P | A9MB59 | Xanthine-guanine phosphoribosyltransferase | 1.63e-06 | 1.19e-07 | NA | NA |
5. P | P0A8F0 | Uracil phosphoribosyltransferase | 3.36e-07 | 1.22e-11 | NA | NA |
5. P | A7Z9Q8 | Uracil phosphoribosyltransferase | 3.75e-07 | 1.04e-11 | NA | NA |
5. P | B7V5M2 | Orotate phosphoribosyltransferase | 2.14e-09 | 1.80e-15 | NA | NA |
5. P | P41923 | Orotate phosphoribosyltransferase | 2.67e-09 | 1.32e-13 | NA | NA |
5. P | B1IWG2 | Uracil phosphoribosyltransferase | 3.46e-07 | 1.22e-11 | NA | NA |
5. P | B1JW40 | Uracil phosphoribosyltransferase | 4.46e-05 | 3.91e-10 | NA | NA |
5. P | Q92SC6 | Orotate phosphoribosyltransferase | 1.81e-10 | 2.27e-11 | NA | NA |
5. P | A8FIC0 | Uracil phosphoribosyltransferase | 4.20e-07 | 3.03e-12 | NA | NA |
5. P | Q03S48 | Bifunctional protein PyrR | 6.51e-07 | 3.26e-09 | NA | NA |
5. P | Q83H88 | Orotate phosphoribosyltransferase | 4.91e-10 | 3.88e-11 | NA | NA |
5. P | A3M9Y5 | Orotate phosphoribosyltransferase | 1.93e-09 | 5.19e-17 | NA | NA |
5. P | Q20WV6 | Orotate phosphoribosyltransferase | 7.87e-11 | 1.22e-32 | NA | NA |
5. P | Q985B1 | Orotate phosphoribosyltransferase 2 | 2.87e-11 | 1.19e-20 | NA | NA |
5. P | B7H6M7 | Bifunctional protein PyrR | 3.11e-07 | 2.34e-09 | NA | NA |
5. P | P0A9M7 | Xanthine-guanine phosphoribosyltransferase | 4.89e-06 | 2.86e-08 | NA | NA |
5. P | Q5HMB1 | Uracil phosphoribosyltransferase | 5.84e-07 | 2.54e-12 | NA | NA |
5. P | A4IM28 | Bifunctional protein PyrR | 1.32e-06 | 2.65e-08 | NA | NA |
5. P | Q8EUA1 | Uracil phosphoribosyltransferase | 1.51e-06 | 1.88e-15 | NA | NA |
5. P | B2IQ70 | Bifunctional protein PyrR | 5.34e-07 | 3.67e-08 | NA | NA |
5. P | Q5FUI1 | Xanthine-guanine phosphoribosyltransferase | 1.63e-06 | 1.31e-09 | NA | NA |
5. P | C0MGT4 | Uracil phosphoribosyltransferase | 4.61e-07 | 2.13e-12 | NA | NA |
5. P | A4WD70 | Uracil phosphoribosyltransferase | 3.91e-07 | 1.61e-12 | NA | NA |
5. P | Q8R9R3 | Bifunctional protein PyrR | 1.69e-06 | 3.57e-09 | NA | NA |
5. P | A6VSX4 | Orotate phosphoribosyltransferase | 1.60e-09 | 6.14e-15 | NA | NA |
5. P | Q142L5 | Uracil phosphoribosyltransferase | 4.99e-05 | 2.82e-10 | NA | NA |
5. P | Q6N7S7 | Xanthine-guanine phosphoribosyltransferase | 2.40e-06 | 1.80e-13 | NA | NA |
5. P | Q1WTX5 | Bifunctional protein PyrR | 1.40e-06 | 3.67e-08 | NA | NA |
5. P | A5IJ64 | Uracil phosphoribosyltransferase | 4.35e-05 | 3.16e-11 | NA | NA |
5. P | Q5E6W3 | Xanthine-guanine phosphoribosyltransferase | 2.88e-06 | 2.92e-07 | NA | NA |
5. P | Q65DW6 | Uracil phosphoribosyltransferase | 4.44e-07 | 2.57e-12 | NA | NA |
5. P | Q3Z788 | Bifunctional protein PyrR | 5.69e-07 | 2.98e-07 | NA | NA |
5. P | Q9HN05 | Uracil phosphoribosyltransferase | 2.67e-04 | 2.19e-09 | NA | NA |
5. P | Q0KF45 | Orotate phosphoribosyltransferase | 1.89e-09 | 4.87e-13 | NA | NA |
5. P | C1D6F5 | Orotate phosphoribosyltransferase | 1.18e-09 | 5.98e-13 | NA | NA |
5. P | A9AVM2 | Bifunctional protein PyrR | 5.86e-07 | 9.33e-07 | NA | NA |
5. P | A3NT50 | Uracil phosphoribosyltransferase | 4.44e-05 | 2.88e-10 | NA | NA |
5. P | C1CX80 | Bifunctional protein PyrR | 2.53e-07 | 5.20e-08 | NA | NA |
5. P | Q3BNB6 | Orotate phosphoribosyltransferase | 1.74e-09 | 3.43e-12 | NA | NA |
5. P | P44722 | Bifunctional protein PyrR | 8.73e-07 | 2.91e-09 | NA | NA |
5. P | P25972 | Orotate phosphoribosyltransferase | 5.55e-11 | 1.23e-18 | NA | NA |
5. P | Q084L0 | Uracil phosphoribosyltransferase | 3.88e-07 | 6.01e-12 | NA | NA |
5. P | Q88BD7 | Orotate phosphoribosyltransferase | 1.29e-09 | 5.07e-16 | NA | NA |
5. P | Q7W3H5 | Orotate phosphoribosyltransferase | 2.25e-09 | 8.26e-15 | NA | NA |
5. P | Q64531 | Hypoxanthine-guanine phosphoribosyltransferase (Fragment) | 2.25e-04 | 1.31e-09 | NA | NA |
5. P | A6LS60 | Orotate phosphoribosyltransferase | 2.71e-09 | 3.11e-15 | NA | NA |
5. P | Q9K048 | Uracil phosphoribosyltransferase | 2.67e-07 | 2.49e-13 | NA | NA |
5. P | Q89AN2 | Xanthine-guanine phosphoribosyltransferase | 5.67e-06 | 6.92e-07 | NA | NA |
5. P | A8Z3N5 | Bifunctional protein PyrR | 7.72e-07 | 2.42e-08 | NA | NA |
5. P | B7LNG2 | Xanthine-guanine phosphoribosyltransferase | 4.40e-06 | 1.71e-08 | NA | NA |
5. P | A4W6X0 | Xanthine-guanine phosphoribosyltransferase | 4.70e-06 | 1.72e-07 | NA | NA |
5. P | B5R560 | Uracil phosphoribosyltransferase | 3.18e-07 | 1.05e-11 | NA | NA |
5. P | B5YDB8 | Uracil phosphoribosyltransferase | 2.71e-07 | 3.94e-12 | NA | NA |
5. P | Q2YQ27 | Xanthine-guanine phosphoribosyltransferase | 3.02e-06 | 3.68e-05 | NA | NA |
5. P | Q1I2T8 | Orotate phosphoribosyltransferase | 1.36e-09 | 7.10e-17 | NA | NA |
5. P | B9KAQ6 | Uracil phosphoribosyltransferase | 4.60e-05 | 1.46e-12 | NA | NA |
5. P | Q97N11 | Orotate phosphoribosyltransferase | 5.41e-09 | 2.68e-14 | NA | NA |
5. P | A7HJR3 | Uracil phosphoribosyltransferase | 5.91e-07 | 6.16e-12 | NA | NA |
5. P | Q7VKV3 | Orotate phosphoribosyltransferase | 1.34e-09 | 7.22e-14 | NA | NA |
5. P | C4XJX5 | Uracil phosphoribosyltransferase | 2.68e-07 | 1.15e-12 | NA | NA |
5. P | B7UJC6 | Xanthine-guanine phosphoribosyltransferase | 4.69e-06 | 1.46e-08 | NA | NA |
5. P | Q2KCZ1 | Orotate phosphoribosyltransferase | 3.78e-10 | 1.22e-13 | NA | NA |
5. P | A0RLA2 | Uracil phosphoribosyltransferase | 4.60e-07 | 3.82e-13 | NA | NA |
5. P | B0KM22 | Bifunctional protein PyrR | 4.08e-07 | 1.52e-05 | NA | NA |
5. P | A5UAL7 | Orotate phosphoribosyltransferase | 2.01e-09 | 1.45e-14 | NA | NA |
5. P | A9MVN7 | Orotate phosphoribosyltransferase | 1.47e-09 | 8.35e-14 | NA | NA |
5. P | Q6AHB4 | Uracil phosphoribosyltransferase | 6.27e-07 | 1.27e-10 | NA | NA |
5. P | Q74J27 | Orotate phosphoribosyltransferase | 4.39e-11 | 1.06e-17 | NA | NA |
5. P | A5EST0 | Orotate phosphoribosyltransferase | 9.55e-11 | 5.07e-29 | NA | NA |
5. P | Q02ZC9 | Orotate phosphoribosyltransferase | 5.81e-11 | 1.27e-18 | NA | NA |
5. P | Q02U09 | Bifunctional protein PyrR | 1.93e-07 | 1.92e-05 | NA | NA |
5. P | Q3J3Y6 | Xanthine-guanine phosphoribosyltransferase | 1.73e-06 | 2.29e-09 | NA | NA |
5. P | B2HNE5 | Bifunctional protein PyrR | 5.40e-07 | 1.13e-09 | NA | NA |
5. P | Q1JID6 | Uracil phosphoribosyltransferase | 5.77e-07 | 1.81e-12 | NA | NA |
5. P | Q03NE4 | Orotate phosphoribosyltransferase | 5.33e-11 | 4.08e-17 | NA | NA |
5. P | Q5ZTB9 | Uracil phosphoribosyltransferase | 1.55e-04 | 5.92e-11 | NA | NA |
5. P | Q927V5 | Uracil phosphoribosyltransferase | 2.66e-05 | 3.58e-13 | NA | NA |
5. P | B1VF60 | Uracil phosphoribosyltransferase | 3.08e-07 | 4.77e-11 | NA | NA |
5. P | Q1GAX2 | Uracil phosphoribosyltransferase | 6.02e-07 | 5.13e-13 | NA | NA |
5. P | B4S200 | Orotate phosphoribosyltransferase | 1.22e-09 | 3.79e-14 | NA | NA |
5. P | Q5NGW1 | Uracil phosphoribosyltransferase | 6.81e-07 | 1.62e-14 | NA | NA |
5. P | P99144 | Orotate phosphoribosyltransferase | 5.68e-11 | 3.10e-22 | NA | NA |
5. P | B5BDQ2 | Xanthine-guanine phosphoribosyltransferase | 4.33e-06 | 1.67e-08 | NA | NA |
5. P | Q0T7Q9 | Xanthine-guanine phosphoribosyltransferase | 2.71e-06 | 2.86e-08 | NA | NA |
5. P | C1EPQ5 | Bifunctional protein PyrR | 6.71e-07 | 2.34e-09 | NA | NA |
5. P | P13298 | Orotate phosphoribosyltransferase 1 | 1.99e-09 | 1.09e-16 | NA | NA |
5. P | B1IC68 | Bifunctional protein PyrR | 4.24e-07 | 3.67e-08 | NA | NA |
5. P | B8DBH1 | Uracil phosphoribosyltransferase | 2.81e-05 | 4.18e-13 | NA | NA |
5. P | Q15ZS0 | Uracil phosphoribosyltransferase | 3.55e-07 | 4.75e-13 | NA | NA |
5. P | Q9PR28 | Uracil phosphoribosyltransferase | 9.61e-07 | 3.40e-13 | NA | NA |
5. P | C0QHT9 | Uracil phosphoribosyltransferase | 3.67e-07 | 4.40e-12 | NA | NA |
5. P | Q4K3R9 | Orotate phosphoribosyltransferase | 5.46e-09 | 2.24e-15 | NA | NA |
5. P | A6T532 | Xanthine-guanine phosphoribosyltransferase | 4.64e-06 | 1.92e-08 | NA | NA |
5. P | B9DU60 | Bifunctional protein PyrR | 3.03e-07 | 3.37e-09 | NA | NA |
5. P | Q6HAX0 | Uracil phosphoribosyltransferase | 4.58e-07 | 2.40e-13 | NA | NA |
5. P | B7IDR9 | Uracil phosphoribosyltransferase | 5.42e-07 | 3.70e-11 | NA | NA |
5. P | B0KQ92 | Orotate phosphoribosyltransferase | 2.05e-09 | 8.06e-17 | NA | NA |
5. P | Q1DNB0 | Orotate phosphoribosyltransferase | 9.43e-09 | 9.84e-13 | NA | NA |
5. P | Q8Y342 | Orotate phosphoribosyltransferase | 2.07e-09 | 1.10e-10 | NA | NA |
5. P | Q26998 | Uracil phosphoribosyltransferase | 6.78e-05 | 4.81e-04 | NA | NA |
5. P | Q3SZ18 | Hypoxanthine-guanine phosphoribosyltransferase | 6.07e-04 | 3.08e-08 | NA | NA |
5. P | Q6D7S0 | Uracil phosphoribosyltransferase | 3.75e-07 | 3.61e-12 | NA | NA |
5. P | B1KSR7 | Uracil phosphoribosyltransferase | 5.89e-07 | 1.37e-13 | NA | NA |
5. P | A6W572 | Uracil phosphoribosyltransferase | 6.38e-07 | 2.69e-10 | NA | NA |
5. P | A1VEW8 | Uracil phosphoribosyltransferase | 3.84e-07 | 5.31e-11 | NA | NA |
5. P | B2VHN3 | Xanthine-guanine phosphoribosyltransferase | 4.74e-06 | 1.31e-07 | NA | NA |
5. P | O13474 | Orotate phosphoribosyltransferase | 2.37e-09 | 4.11e-16 | NA | NA |
5. P | Q4QN84 | Bifunctional protein PyrR | 8.54e-07 | 2.60e-09 | NA | NA |
5. P | B0UWV5 | Xanthine-guanine phosphoribosyltransferase | 3.65e-06 | 3.87e-07 | NA | NA |
5. P | C1CEN2 | Bifunctional protein PyrR | 4.01e-07 | 3.67e-08 | NA | NA |
5. P | Q325P8 | Xanthine-guanine phosphoribosyltransferase | 2.92e-06 | 2.86e-08 | NA | NA |
5. P | A7GRK7 | Orotate phosphoribosyltransferase | 8.75e-11 | 3.50e-18 | NA | NA |
5. P | C0Q6T6 | Xanthine-guanine phosphoribosyltransferase | 4.39e-06 | 1.67e-08 | NA | NA |
5. P | A0B5B7 | PyrE-like protein | 3.24e-10 | 4.53e-07 | NA | NA |
5. P | P0A9M5 | Xanthine-guanine phosphoribosyltransferase | 4.80e-06 | 2.86e-08 | NA | NA |
5. P | B1AIA5 | Uracil phosphoribosyltransferase | 1.01e-06 | 3.40e-13 | NA | NA |
5. P | C4KYT2 | Uracil phosphoribosyltransferase | 4.21e-07 | 3.18e-12 | NA | NA |
5. P | B0K2F0 | Bifunctional protein PyrR | 1.51e-06 | 1.21e-10 | NA | NA |
5. P | P0DD74 | Bifunctional protein PyrR | 5.03e-07 | 3.15e-09 | NA | NA |
5. P | Q9KPY7 | Uracil phosphoribosyltransferase | 3.32e-07 | 8.77e-13 | NA | NA |
5. P | Q6GA15 | Bifunctional protein PyrR | 7.40e-07 | 2.42e-08 | NA | NA |
5. P | Q8K9R8 | Xanthine-guanine phosphoribosyltransferase | 2.48e-06 | 1.56e-11 | NA | NA |
5. P | Q1QVR0 | Xanthine-guanine phosphoribosyltransferase | 1.56e-03 | 1.25e-07 | NA | NA |
5. P | Q8DUP7 | Bifunctional protein PyrR | 5.72e-07 | 1.28e-06 | NA | NA |
5. P | C4LC66 | Uracil phosphoribosyltransferase | 3.47e-07 | 1.16e-11 | NA | NA |
5. P | P72753 | Uracil phosphoribosyltransferase | 4.96e-05 | 1.89e-11 | NA | NA |
5. P | Q5M4H9 | Orotate phosphoribosyltransferase | 5.30e-11 | 1.95e-19 | NA | NA |
5. P | P67398 | Uracil phosphoribosyltransferase | 4.74e-07 | 6.97e-13 | NA | NA |
5. P | Q6G7J8 | Uracil phosphoribosyltransferase | 5.63e-07 | 1.48e-12 | NA | NA |
5. P | B0K7G1 | Uracil phosphoribosyltransferase | 3.86e-05 | 3.64e-14 | NA | NA |
5. P | Q9WZI0 | Uracil phosphoribosyltransferase | 5.42e-05 | 3.88e-11 | NA | NA |
5. P | Q732H8 | Bifunctional protein PyrR | NA | 2.66e-09 | NA | NA |
5. P | A0KM23 | Uracil phosphoribosyltransferase | 3.30e-07 | 2.73e-13 | NA | NA |
5. P | A1W748 | Uracil phosphoribosyltransferase | 8.67e-05 | 9.01e-11 | NA | NA |
5. P | A1WQN5 | Uracil phosphoribosyltransferase | 1.20e-06 | 3.52e-10 | NA | NA |
5. P | C0Q1X4 | Orotate phosphoribosyltransferase | 1.99e-09 | 8.35e-14 | NA | NA |
5. P | Q3J6V6 | Orotate phosphoribosyltransferase | 2.15e-09 | 2.10e-12 | NA | NA |
5. P | B5F173 | Uracil phosphoribosyltransferase | 3.20e-07 | 1.05e-11 | NA | NA |
5. P | Q8G661 | Orotate phosphoribosyltransferase | 9.54e-09 | 2.38e-12 | NA | NA |
5. P | B0TPW8 | Uracil phosphoribosyltransferase | 2.77e-07 | 4.40e-12 | NA | NA |
5. P | A5UGX0 | Bifunctional protein PyrR | 1.59e-04 | 2.60e-09 | NA | NA |
5. P | A6LMU0 | Uracil phosphoribosyltransferase | 7.07e-07 | 7.71e-12 | NA | NA |
5. P | Q1AVY5 | Bifunctional protein PyrR | 6.22e-05 | 2.86e-11 | NA | NA |
5. P | B4TZ85 | Xanthine-guanine phosphoribosyltransferase | 4.23e-06 | 1.67e-08 | NA | NA |
5. P | Q3K0E8 | Bifunctional protein PyrR | 3.23e-07 | 3.40e-08 | NA | NA |
5. P | Q65RC3 | Uracil phosphoribosyltransferase | 3.91e-07 | 8.44e-13 | NA | NA |
5. P | P45078 | Hypoxanthine phosphoribosyltransferase | 1.52e-06 | 6.98e-04 | NA | NA |
5. P | P0A659 | Uracil phosphoribosyltransferase | 6.78e-05 | 6.07e-11 | NA | NA |
5. P | B9DX75 | Uracil phosphoribosyltransferase | 4.62e-07 | 1.02e-13 | NA | NA |
5. P | Q11RP3 | Orotate phosphoribosyltransferase | 2.43e-11 | 1.26e-20 | NA | NA |
5. P | A6UET4 | Uracil phosphoribosyltransferase | 3.43e-05 | 4.65e-11 | NA | NA |
5. P | Q5V3K1 | PyrE-like protein | 3.40e-10 | 1.22e-09 | NA | NA |
5. P | Q8XXC7 | Uracil phosphoribosyltransferase | 5.45e-05 | 4.40e-10 | NA | NA |
5. P | B5ZNS6 | Orotate phosphoribosyltransferase | 2.86e-10 | 1.54e-11 | NA | NA |
5. P | Q4K6B5 | Uracil phosphoribosyltransferase | 3.66e-07 | 6.81e-12 | NA | NA |
5. P | Q898X9 | Uracil phosphoribosyltransferase | 7.29e-07 | 7.13e-14 | NA | NA |
5. P | B9IRU7 | Uracil phosphoribosyltransferase | 4.48e-07 | 2.40e-13 | NA | NA |
5. P | A3MI49 | Uracil phosphoribosyltransferase | 5.21e-05 | 2.88e-10 | NA | NA |
5. P | A0RY85 | Orotate phosphoribosyltransferase | 8.31e-11 | 1.13e-21 | NA | NA |
5. P | Q1I3U3 | Bifunctional protein PyrR | 3.28e-07 | 1.81e-05 | NA | NA |
5. P | Q819R8 | Bifunctional protein PyrR | 5.82e-07 | 2.34e-09 | NA | NA |
5. P | Q8XD99 | Orotate phosphoribosyltransferase | 2.77e-09 | 9.77e-14 | NA | NA |
5. P | Q32J21 | Xanthine-guanine phosphoribosyltransferase | 5.16e-06 | 2.86e-08 | NA | NA |
5. P | A4FYB9 | Uracil phosphoribosyltransferase | 1.34e-04 | 6.01e-12 | NA | NA |
5. P | A4XQU8 | Uracil phosphoribosyltransferase | 3.42e-07 | 3.84e-12 | NA | NA |
5. P | A0Q5K6 | Uracil phosphoribosyltransferase | 7.03e-07 | 1.62e-14 | NA | NA |
5. P | A6TRX7 | Bifunctional protein PyrR | 3.59e-07 | 3.17e-07 | NA | NA |
5. P | Q1GHI7 | Xanthine-guanine phosphoribosyltransferase | 2.81e-06 | 1.66e-16 | NA | NA |
5. P | B5EXE6 | Orotate phosphoribosyltransferase | 1.45e-09 | 7.82e-14 | NA | NA |
5. P | A9WDU6 | Bifunctional protein PyrR | 4.06e-07 | 2.71e-07 | NA | NA |
5. P | C3L735 | Bifunctional protein PyrR | 8.16e-07 | 2.34e-09 | NA | NA |
5. P | A9R2X4 | Xanthine-guanine phosphoribosyltransferase | 1.16e-03 | 1.76e-08 | NA | NA |
5. P | Q5XCS1 | Bifunctional protein PyrR | 3.88e-07 | 2.37e-09 | NA | NA |
5. P | P0DD69 | Orotate phosphoribosyltransferase | 5.37e-11 | 5.07e-19 | NA | NA |
5. P | A5UA30 | Bifunctional protein PyrR | 1.37e-04 | 2.60e-09 | NA | NA |
5. P | B7MHX9 | Uracil phosphoribosyltransferase | 3.44e-07 | 1.22e-11 | NA | NA |
5. P | Q04R73 | Orotate phosphoribosyltransferase | 9.93e-07 | 2.30e-32 | NA | NA |
5. P | A6TK51 | Uracil phosphoribosyltransferase | 3.95e-07 | 3.23e-14 | NA | NA |
5. P | P18134 | Hypoxanthine phosphoribosyltransferase | 1.51e-06 | 4.85e-04 | NA | NA |
5. P | Q31MH4 | Uracil phosphoribosyltransferase | 3.98e-07 | 6.25e-14 | NA | NA |
5. P | A1B467 | Uracil phosphoribosyltransferase | 5.23e-07 | 6.89e-12 | NA | NA |
5. P | Q6A5S3 | Uracil phosphoribosyltransferase | 3.98e-07 | 1.85e-11 | NA | NA |
5. P | B4RK50 | Uracil phosphoribosyltransferase | 2.63e-07 | 2.69e-13 | NA | NA |
5. P | A8AX86 | Bifunctional protein PyrR | 2.50e-07 | 3.44e-08 | NA | NA |
5. P | A2RLC0 | Orotate phosphoribosyltransferase | 5.74e-11 | 3.07e-18 | NA | NA |
5. P | Q0HHL7 | Uracil phosphoribosyltransferase | 3.37e-07 | 5.19e-11 | NA | NA |
5. P | A5F642 | Uracil phosphoribosyltransferase | 3.62e-07 | 6.01e-12 | NA | NA |
5. P | A8GLE9 | Orotate phosphoribosyltransferase | 1.36e-09 | 2.44e-14 | NA | NA |
5. P | P9WHK9 | Orotate phosphoribosyltransferase | 7.97e-11 | 1.13e-35 | NA | NA |
5. P | Q5M5U5 | Uracil phosphoribosyltransferase | 5.02e-07 | 6.64e-12 | NA | NA |
5. P | A7MQA9 | Orotate phosphoribosyltransferase | 1.39e-09 | 1.41e-14 | NA | NA |
5. P | Q6GHN7 | Bifunctional protein PyrR | 8.09e-07 | 2.42e-08 | NA | NA |
5. P | P96794 | Hypoxanthine-guanine phosphoribosyltransferase | 1.62e-03 | 1.87e-06 | NA | NA |
5. P | Q252Z2 | Orotate phosphoribosyltransferase | 3.72e-10 | 8.25e-20 | NA | NA |
5. P | P58998 | Uracil phosphoribosyltransferase | 4.90e-05 | 3.14e-12 | NA | NA |
5. P | A7X4V6 | Uracil phosphoribosyltransferase | 5.90e-07 | 1.48e-12 | NA | NA |
5. P | Q8PFS5 | Orotate phosphoribosyltransferase | 1.73e-09 | 7.15e-12 | NA | NA |
5. P | Q8E4G7 | Bifunctional protein PyrR | 3.24e-07 | 3.40e-08 | NA | NA |
5. P | Q0W6Q2 | Orotate phosphoribosyltransferase | 7.51e-12 | 6.02e-34 | NA | NA |
5. P | B1LK79 | Orotate phosphoribosyltransferase | 2.63e-09 | 1.04e-13 | NA | NA |
5. P | A9R670 | Orotate phosphoribosyltransferase | 3.44e-09 | 3.89e-14 | NA | NA |
5. P | P39149 | Uracil phosphoribosyltransferase | 4.05e-07 | 2.74e-12 | NA | NA |
5. P | A5U281 | Bifunctional protein PyrR | 5.74e-05 | 3.36e-10 | NA | NA |
5. P | B0BT67 | Orotate phosphoribosyltransferase | 2.17e-09 | 6.39e-15 | NA | NA |
5. P | B7V3Z0 | Bifunctional protein PyrR | 1.97e-07 | 1.92e-05 | NA | NA |
5. P | B7V0J2 | Uracil phosphoribosyltransferase | 4.12e-07 | 4.63e-13 | NA | NA |
5. P | P00492 | Hypoxanthine-guanine phosphoribosyltransferase | 1.10e-02 | 1.08e-08 | NA | NA |
5. P | P0A8F1 | Uracil phosphoribosyltransferase | 3.50e-07 | 1.22e-11 | NA | NA |
5. P | Q8DWM8 | Hypoxanthine-guanine phosphoribosyltransferase | 1.84e-06 | 1.19e-02 | NA | NA |
5. P | A1A7U9 | Xanthine-guanine phosphoribosyltransferase | 4.56e-06 | 2.27e-08 | NA | NA |
5. P | P18904 | Orotate phosphoribosyltransferase | 7.27e-09 | 1.55e-15 | NA | NA |
5. P | B5R4S1 | Xanthine-guanine phosphoribosyltransferase | 4.75e-06 | 1.67e-08 | NA | NA |
5. P | C6DIC6 | Orotate phosphoribosyltransferase | 1.81e-09 | 3.15e-13 | NA | NA |
5. P | Q7VSN4 | Orotate phosphoribosyltransferase | 2.31e-09 | 3.45e-14 | NA | NA |
5. P | P0A7E3 | Orotate phosphoribosyltransferase | 1.75e-09 | 6.59e-14 | NA | NA |
5. P | B0CGJ6 | Xanthine-guanine phosphoribosyltransferase | 1.81e-06 | 1.71e-07 | NA | NA |
5. P | Q9PN13 | Uracil phosphoribosyltransferase | 4.99e-05 | 1.08e-13 | NA | NA |
5. P | B1HM47 | Uracil phosphoribosyltransferase | 4.45e-07 | 3.40e-13 | NA | NA |
5. P | A5UQV0 | Uracil phosphoribosyltransferase | 9.95e-07 | 4.28e-13 | NA | NA |
5. P | Q1JN85 | Uracil phosphoribosyltransferase | 6.02e-07 | 1.81e-12 | NA | NA |
5. P | O67742 | Orotate phosphoribosyltransferase | 4.95e-11 | 2.20e-28 | NA | NA |
5. P | Q4QMM6 | Xanthine-guanine phosphoribosyltransferase 2 | 3.42e-06 | 8.77e-07 | NA | NA |
5. P | O61790 | Orotate phosphoribosyltransferase | 3.40e-10 | 1.81e-12 | NA | NA |
5. P | B2TTV6 | Orotate phosphoribosyltransferase | 1.52e-09 | 9.77e-14 | NA | NA |
5. P | Q5MZF4 | Uracil phosphoribosyltransferase | 2.98e-07 | 6.25e-14 | NA | NA |
5. P | A4TMP2 | Uracil phosphoribosyltransferase | 4.06e-07 | 6.48e-12 | NA | NA |
5. P | B2SC51 | Uracil phosphoribosyltransferase | 2.53e-07 | 3.71e-08 | NA | NA |
5. P | B4U3B2 | Bifunctional protein PyrR | 3.34e-07 | 1.51e-08 | NA | NA |
5. P | P42719 | Orotate phosphoribosyltransferase | 1.97e-10 | 1.17e-13 | NA | NA |
5. P | Q9RGY8 | Uracil phosphoribosyltransferase | 4.72e-07 | 7.63e-13 | NA | NA |
5. P | Q24MM7 | Uracil phosphoribosyltransferase | 5.78e-07 | 3.36e-14 | NA | NA |
5. P | Q71YI5 | Orotate phosphoribosyltransferase | 3.47e-11 | 5.74e-21 | NA | NA |
5. P | P0A5U1 | Orotate phosphoribosyltransferase | 6.62e-11 | 1.13e-35 | NA | NA |
5. P | Q1MHW9 | Xanthine-guanine phosphoribosyltransferase | 1.72e-06 | 9.10e-08 | NA | NA |
5. P | C3LPM9 | Uracil phosphoribosyltransferase | 3.55e-07 | 6.01e-12 | NA | NA |
5. P | A4SL29 | Uracil phosphoribosyltransferase | 3.48e-07 | 3.62e-13 | NA | NA |
5. P | Q5SK65 | Bifunctional protein PyrR | 2.82e-07 | 1.02e-06 | NA | NA |
5. P | B3PM96 | Uracil phosphoribosyltransferase | 3.21e-07 | 7.34e-13 | NA | NA |
5. P | A8AYQ0 | Uracil phosphoribosyltransferase | 4.37e-07 | 4.28e-13 | NA | NA |
5. P | B7L766 | Orotate phosphoribosyltransferase | 1.57e-09 | 6.59e-14 | NA | NA |
5. P | C3KAJ8 | Uracil phosphoribosyltransferase | 4.23e-07 | 4.52e-12 | NA | NA |
5. P | A7NLW5 | Bifunctional protein PyrR | 3.35e-07 | 3.56e-07 | NA | NA |
5. P | Q6KHA6 | Uracil phosphoribosyltransferase | 4.42e-07 | 6.50e-16 | NA | NA |
5. P | A0KYA2 | Uracil phosphoribosyltransferase | 3.28e-07 | 4.82e-11 | NA | NA |
5. P | P65942 | Bifunctional protein PyrR | 5.82e-05 | 3.36e-10 | NA | NA |
5. P | A9AJK1 | Uracil phosphoribosyltransferase | 4.06e-05 | 1.22e-09 | NA | NA |
5. P | A9HZV9 | Uracil phosphoribosyltransferase | 4.73e-07 | 1.12e-12 | NA | NA |
5. P | Q18DK8 | Uracil phosphoribosyltransferase | 1.86e-04 | 1.95e-09 | NA | NA |
5. P | Q3K4M3 | Orotate phosphoribosyltransferase | 5.83e-09 | 8.00e-16 | NA | NA |
5. P | A5F5Y8 | Xanthine-guanine phosphoribosyltransferase | 2.02e-06 | 1.05e-07 | NA | NA |
5. P | O27186 | Uracil phosphoribosyltransferase | 1.28e-06 | 4.99e-12 | NA | NA |
5. P | C1FQA3 | Uracil phosphoribosyltransferase | 5.33e-07 | 1.37e-13 | NA | NA |
5. P | B8FNN4 | Orotate phosphoribosyltransferase | 2.91e-11 | 1.62e-31 | NA | NA |
5. P | Q03KS5 | Orotate phosphoribosyltransferase | 5.27e-11 | 4.92e-19 | NA | NA |
5. P | Q8Y4B3 | Uracil phosphoribosyltransferase | 2.90e-05 | 4.18e-13 | NA | NA |
5. P | B2U8Z0 | Uracil phosphoribosyltransferase | 4.49e-05 | 8.84e-10 | NA | NA |
5. P | P41007 | Bifunctional protein PyrR | 1.57e-06 | 4.92e-08 | NA | NA |
5. P | Q824L3 | Orotate phosphoribosyltransferase | 3.45e-10 | 8.99e-21 | NA | NA |
5. P | Q053K4 | Orotate phosphoribosyltransferase | 1.18e-09 | 3.10e-32 | NA | NA |
5. P | Q5LZW8 | Orotate phosphoribosyltransferase | 5.26e-11 | 1.95e-19 | NA | NA |
5. P | A1ADZ1 | Uracil phosphoribosyltransferase | 3.41e-07 | 1.22e-11 | NA | NA |
5. P | Q8RG90 | Bifunctional protein PyrR | 2.04e-06 | 2.98e-08 | NA | NA |
5. P | Q8Z2H5 | Orotate phosphoribosyltransferase | 1.47e-09 | 1.71e-13 | NA | NA |
5. P | Q8FUZ2 | Uracil phosphoribosyltransferase | 2.50e-07 | 7.50e-08 | NA | NA |
5. P | B3H0G3 | Orotate phosphoribosyltransferase | 2.17e-09 | 6.39e-15 | NA | NA |
5. P | A1KNZ5 | Uracil phosphoribosyltransferase | 6.06e-05 | 6.07e-11 | NA | NA |
5. P | Q492F3 | Uracil phosphoribosyltransferase | 3.56e-07 | 1.76e-12 | NA | NA |
5. P | Q9YEN3 | Uracil phosphoribosyltransferase | 6.65e-07 | 4.99e-12 | NA | NA |
5. P | P65920 | Orotate phosphoribosyltransferase | 5.21e-11 | 5.07e-19 | NA | NA |
5. P | B7MFK3 | Orotate phosphoribosyltransferase | 1.50e-09 | 2.66e-13 | NA | NA |
5. P | Q8UJ06 | Uracil phosphoribosyltransferase | 3.68e-05 | 3.12e-11 | NA | NA |
5. P | A3DE09 | Bifunctional protein PyrR | 4.37e-07 | 3.84e-08 | NA | NA |
5. P | Q04LJ2 | Orotate phosphoribosyltransferase | 6.75e-11 | 6.25e-17 | NA | NA |
5. P | Q8FKM7 | Xanthine-guanine phosphoribosyltransferase | 4.70e-06 | 1.46e-08 | NA | NA |
5. P | Q8UEM6 | Xanthine-guanine phosphoribosyltransferase | 1.43e-06 | 1.01e-08 | NA | NA |
5. P | Q8YVB5 | Uracil phosphoribosyltransferase | 4.56e-05 | 2.54e-12 | NA | NA |
5. P | Q7UYX5 | Orotate phosphoribosyltransferase | 9.38e-11 | 3.63e-23 | NA | NA |
5. P | Q87T92 | Orotate phosphoribosyltransferase | 2.41e-09 | 1.90e-15 | NA | NA |
5. P | B1X976 | Orotate phosphoribosyltransferase | 1.79e-09 | 6.59e-14 | NA | NA |
5. P | B9MS19 | Bifunctional protein PyrR | 2.49e-07 | 6.44e-07 | NA | NA |
5. P | A7X1E5 | Bifunctional protein PyrR | 6.91e-07 | 2.42e-08 | NA | NA |
5. P | Q7RVF7 | Orotate phosphoribosyltransferase | 5.12e-09 | 5.78e-14 | NA | NA |
5. P | A8YY79 | Uracil phosphoribosyltransferase | 5.43e-07 | 1.48e-12 | NA | NA |
5. P | Q8CXH9 | Bifunctional protein PyrR | 6.48e-07 | 1.08e-08 | NA | NA |
5. P | P65943 | Bifunctional protein PyrR | 8.35e-07 | 2.42e-08 | NA | NA |
5. P | Q7WEU9 | Orotate phosphoribosyltransferase | 2.39e-09 | 1.05e-14 | NA | NA |
5. P | Q9AK76 | Uracil phosphoribosyltransferase | 2.86e-07 | 3.06e-10 | NA | NA |
5. P | B7JGP0 | Uracil phosphoribosyltransferase | 4.64e-07 | 2.40e-13 | NA | NA |
5. P | Q9HNG2 | Orotate phosphoribosyltransferase | 7.16e-11 | 7.98e-37 | NA | NA |
5. P | A6VJY4 | Uracil phosphoribosyltransferase | 1.17e-04 | 2.27e-11 | NA | NA |
5. P | Q4L5Q7 | Orotate phosphoribosyltransferase | 6.10e-11 | 6.80e-23 | NA | NA |
5. P | Q9K9V4 | Bifunctional protein PyrR | 9.57e-07 | 1.19e-07 | NA | NA |
5. P | Q9KPT5 | Xanthine-guanine phosphoribosyltransferase | 2.15e-06 | 1.05e-07 | NA | NA |
5. P | B0BTQ3 | Uracil phosphoribosyltransferase | 3.89e-07 | 2.74e-12 | NA | NA |
5. P | P0A5T1 | Hypoxanthine-guanine phosphoribosyltransferase | 1.11e-03 | 1.07e-06 | NA | NA |
5. P | A6UYL3 | Bifunctional protein PyrR | 2.14e-07 | 9.08e-06 | NA | NA |
5. P | A6WM35 | Uracil phosphoribosyltransferase | 3.75e-07 | 4.12e-11 | NA | NA |
5. P | Q5XEL6 | Hypoxanthine-guanine phosphoribosyltransferase | 1.92e-06 | 6.66e-03 | NA | NA |
5. P | Q3K6Y9 | Uracil phosphoribosyltransferase | 4.33e-07 | 3.94e-12 | NA | NA |
5. P | A9WW75 | Uracil phosphoribosyltransferase | 2.58e-07 | 7.50e-08 | NA | NA |
5. P | Q5QW45 | Xanthine-guanine phosphoribosyltransferase | 3.21e-06 | 9.43e-07 | NA | NA |
5. P | Q1IEV9 | Uracil phosphoribosyltransferase | 4.04e-07 | 5.05e-12 | NA | NA |
5. P | A0LH56 | Bifunctional protein PyrR | 3.06e-05 | 4.17e-07 | NA | NA |
5. P | Q28PG8 | Xanthine-guanine phosphoribosyltransferase | 2.70e-06 | 1.67e-13 | NA | NA |
5. P | Q8E2H3 | Hypoxanthine-guanine phosphoribosyltransferase | 2.02e-06 | 5.88e-03 | NA | NA |
5. P | A0QLX9 | Orotate phosphoribosyltransferase | 6.40e-11 | 4.59e-32 | NA | NA |
5. P | B5XKV8 | Bifunctional protein PyrR | 4.51e-07 | 2.91e-09 | NA | NA |
5. P | Q87MH1 | Uracil phosphoribosyltransferase | 3.51e-07 | 2.35e-12 | NA | NA |
5. P | B7GRU8 | Orotate phosphoribosyltransferase | 1.16e-08 | 5.65e-12 | NA | NA |
5. P | P0DD75 | Bifunctional protein PyrR | 3.97e-07 | 3.15e-09 | NA | NA |
5. P | P0A9M3 | Hypoxanthine phosphoribosyltransferase | 5.90e-04 | 1.47e-02 | NA | NA |
5. P | Q9HJ11 | PyrE-like protein | 1.66e-10 | 3.26e-09 | NA | NA |
5. P | Q87RV3 | Xanthine-guanine phosphoribosyltransferase | 2.02e-06 | 1.07e-06 | NA | NA |
5. P | Q5LRI5 | Xanthine-guanine phosphoribosyltransferase | 1.99e-06 | 1.58e-13 | NA | NA |
5. P | A5VIQ0 | Uracil phosphoribosyltransferase | 2.29e-07 | 6.72e-12 | NA | NA |
5. P | B0UN77 | Orotate phosphoribosyltransferase | 1.38e-10 | 1.77e-20 | NA | NA |
5. P | A1U241 | Uracil phosphoribosyltransferase | 5.26e-07 | 6.14e-11 | NA | NA |
5. P | Q8EM74 | Uracil phosphoribosyltransferase | 1.01e-06 | 5.93e-14 | NA | NA |
5. P | Q1C4E3 | Xanthine-guanine phosphoribosyltransferase | 1.13e-03 | 1.76e-08 | NA | NA |
5. P | Q02G28 | Uracil phosphoribosyltransferase | 4.32e-07 | 4.63e-13 | NA | NA |
5. P | B5XNQ4 | Uracil phosphoribosyltransferase | 3.73e-07 | 1.61e-12 | NA | NA |
5. P | Q8ZJP7 | Orotate phosphoribosyltransferase | 2.91e-09 | 3.89e-14 | NA | NA |
5. P | Q9CGM8 | Orotate phosphoribosyltransferase | 7.36e-11 | 1.52e-17 | NA | NA |
5. P | Q0APC1 | Orotate phosphoribosyltransferase | 2.63e-11 | 4.55e-23 | NA | NA |
5. P | Q1CS04 | Orotate phosphoribosyltransferase | 4.45e-11 | 7.93e-15 | NA | NA |
5. P | Q6GA08 | Orotate phosphoribosyltransferase | 1.23e-10 | 9.38e-23 | NA | NA |
5. P | A1VN11 | Uracil phosphoribosyltransferase | 7.31e-07 | 1.52e-11 | NA | NA |
5. P | P0DH35 | Uracil phosphoribosyltransferase | 6.14e-07 | 1.81e-12 | NA | NA |
5. P | B1JIH6 | Xanthine-guanine phosphoribosyltransferase | 1.13e-03 | 1.76e-08 | NA | NA |
5. P | A5N3J1 | Uracil phosphoribosyltransferase | 4.63e-07 | 1.02e-13 | NA | NA |
5. P | P65910 | Orotate phosphoribosyltransferase | 4.66e-11 | 2.19e-21 | NA | NA |
5. P | Q6FE58 | Uracil phosphoribosyltransferase | 5.58e-07 | 1.63e-12 | NA | NA |
5. P | C3MBH2 | Uracil phosphoribosyltransferase | 3.83e-05 | 1.05e-10 | NA | NA |
5. P | A9KIB0 | Uracil phosphoribosyltransferase | 2.65e-07 | 3.53e-13 | NA | NA |
5. P | B9DMF2 | Uracil phosphoribosyltransferase | 4.04e-07 | 1.50e-12 | NA | NA |
5. P | Q0T222 | Uracil phosphoribosyltransferase | 3.44e-07 | 1.22e-11 | NA | NA |
5. P | A1TY28 | Orotate phosphoribosyltransferase | 1.07e-06 | 3.63e-16 | NA | NA |
5. P | Q65JU3 | Orotate phosphoribosyltransferase | 4.91e-11 | 5.04e-18 | NA | NA |
5. P | A4II60 | Phosphoribosyltransferase domain-containing protein 1 | 2.05e-03 | 3.26e-08 | NA | NA |
5. P | C5B9M4 | Xanthine-guanine phosphoribosyltransferase | 5.35e-06 | 7.60e-07 | NA | NA |
5. P | P65947 | Bifunctional protein PyrR | 3.90e-07 | 3.67e-08 | NA | NA |
5. P | Q9CPL8 | Uracil phosphoribosyltransferase | 4.08e-07 | 5.72e-12 | NA | NA |
5. P | F2MMP6 | Bifunctional protein pyrR | 2.09e-07 | 2.20e-08 | NA | NA |
5. P | P47276 | Uracil phosphoribosyltransferase | 2.09e-06 | 1.35e-10 | NA | NA |
5. P | Q67TC9 | Uracil phosphoribosyltransferase | 9.30e-07 | 3.26e-12 | NA | NA |
5. P | B7MC88 | Xanthine-guanine phosphoribosyltransferase | 4.46e-06 | 2.27e-08 | NA | NA |
5. P | Q9KVD5 | Orotate phosphoribosyltransferase | 2.11e-09 | 1.23e-15 | NA | NA |
5. P | A3MZB6 | Uracil phosphoribosyltransferase | 4.12e-07 | 2.74e-12 | NA | NA |
5. P | Q31UY4 | Orotate phosphoribosyltransferase | 2.74e-09 | 9.77e-14 | NA | NA |
5. P | B0UW86 | Uracil phosphoribosyltransferase | 4.16e-07 | 4.50e-14 | NA | NA |
5. P | Q48Q10 | Orotate phosphoribosyltransferase | 1.87e-09 | 6.50e-16 | NA | NA |
5. P | B2GAT5 | Uracil phosphoribosyltransferase | 3.02e-07 | 2.48e-11 | NA | NA |
5. P | P67397 | Uracil phosphoribosyltransferase | 5.57e-07 | 1.48e-12 | NA | NA |
5. P | Q71YH6 | Bifunctional protein PyrR | 3.87e-07 | 2.78e-09 | NA | NA |
5. P | Q6WIT9 | Hypoxanthine-guanine phosphoribosyltransferase | 1.11e-02 | 3.95e-09 | NA | NA |
5. P | Q65UX5 | Bifunctional protein PyrR | 9.51e-05 | 3.71e-08 | NA | NA |
5. P | Q6F6Z6 | Orotate phosphoribosyltransferase | 1.78e-09 | 1.43e-17 | NA | NA |
5. P | A8H5Q9 | Uracil phosphoribosyltransferase | 3.33e-07 | 4.40e-12 | NA | NA |
5. P | P21846 | Orotate phosphoribosyltransferase | 6.52e-09 | 6.71e-13 | NA | NA |
5. P | Q02E31 | Orotate phosphoribosyltransferase | 2.14e-09 | 1.83e-15 | NA | NA |
5. P | B9LUM1 | Uracil phosphoribosyltransferase | 6.69e-04 | 2.50e-10 | NA | NA |
5. P | Q2ST42 | Uracil phosphoribosyltransferase | 1.11e-06 | 2.00e-13 | NA | NA |
5. P | Q6GEW3 | Uracil phosphoribosyltransferase | 5.79e-07 | 1.48e-12 | NA | NA |
5. P | A7NRA6 | Uracil phosphoribosyltransferase | 7.80e-05 | 5.83e-13 | NA | NA |
5. P | A4QHG9 | Orotate phosphoribosyltransferase | 1.46e-10 | 8.95e-29 | NA | NA |
5. P | B7IQW8 | Uracil phosphoribosyltransferase | 4.51e-07 | 2.40e-13 | NA | NA |
5. P | Q668E6 | Uracil phosphoribosyltransferase | 4.06e-07 | 6.48e-12 | NA | NA |
5. P | B2KCN3 | Bifunctional protein PyrR | 2.82e-07 | 5.69e-07 | NA | NA |
5. P | B4T0M7 | Uracil phosphoribosyltransferase | 3.26e-07 | 1.05e-11 | NA | NA |
5. P | A7G9P8 | Uracil phosphoribosyltransferase | 5.61e-07 | 1.37e-13 | NA | NA |
5. P | B0S2A9 | Uracil phosphoribosyltransferase | 5.55e-07 | 6.50e-14 | NA | NA |
5. P | A2RF04 | Orotate phosphoribosyltransferase | 4.72e-11 | 8.28e-19 | NA | NA |
5. P | Q72KT9 | Bifunctional protein PyrR | 3.36e-07 | 1.02e-06 | NA | NA |
5. P | A9KY39 | Uracil phosphoribosyltransferase | 3.65e-07 | 4.12e-11 | NA | NA |
5. P | B8E009 | Uracil phosphoribosyltransferase | 2.58e-07 | 1.45e-11 | NA | NA |
5. P | A5IUQ7 | Uracil phosphoribosyltransferase | 5.57e-07 | 1.48e-12 | NA | NA |
5. P | A3QD33 | Uracil phosphoribosyltransferase | 3.57e-07 | 1.72e-11 | NA | NA |
5. P | Q820K1 | Orotate phosphoribosyltransferase | 1.89e-09 | 2.89e-08 | NA | NA |
5. P | B2G552 | Bifunctional protein PyrR | 5.34e-07 | 1.54e-08 | NA | NA |
5. P | Q4L7Z3 | Uracil phosphoribosyltransferase | 5.72e-07 | 3.62e-13 | NA | NA |
5. P | Q2SZS9 | Uracil phosphoribosyltransferase | 4.24e-05 | 1.71e-10 | NA | NA |
5. P | C3L744 | Orotate phosphoribosyltransferase | 7.41e-11 | 4.32e-17 | NA | NA |
5. P | Q5PNJ7 | Uracil phosphoribosyltransferase | 2.91e-07 | 1.05e-11 | NA | NA |
5. P | Q9Z7U6 | Orotate phosphoribosyltransferase | 5.98e-10 | 2.33e-19 | NA | NA |
5. P | Q4K4E3 | Bifunctional protein PyrR | 3.08e-07 | 2.82e-05 | NA | NA |
5. P | Q0SYG9 | Orotate phosphoribosyltransferase | 1.50e-09 | 1.39e-13 | NA | NA |
5. P | B7KVD0 | Orotate phosphoribosyltransferase | 4.06e-11 | 2.84e-20 | NA | NA |
5. P | B5R5R4 | Xanthine-guanine phosphoribosyltransferase | 4.53e-06 | 1.67e-08 | NA | NA |
5. P | B0SCV6 | Orotate phosphoribosyltransferase | 8.68e-10 | 5.79e-30 | NA | NA |
5. P | P59389 | Bifunctional protein PyrR 2 | 1.30e-06 | 9.36e-10 | NA | NA |
5. P | Q0SRX5 | Bifunctional protein PyrR | 7.99e-07 | 9.01e-11 | NA | NA |
5. P | A2RF64 | Bifunctional protein PyrR | 3.98e-07 | 3.91e-09 | NA | NA |
5. P | P65914 | Orotate phosphoribosyltransferase | 8.73e-10 | 1.24e-15 | NA | NA |
5. P | A7ZTJ3 | Orotate phosphoribosyltransferase | 1.49e-09 | 1.20e-13 | NA | NA |
5. P | B1XSI4 | Orotate phosphoribosyltransferase | 2.06e-09 | 6.06e-13 | NA | NA |
5. P | Q7VKP2 | Xanthine-guanine phosphoribosyltransferase | 1.99e-06 | 3.22e-12 | NA | NA |
5. P | B7JJW9 | Orotate phosphoribosyltransferase | 6.01e-11 | 1.83e-17 | NA | NA |
5. P | Q27541 | Hypoxanthine-guanine phosphoribosyltransferase | 1.15e-04 | 2.63e-07 | NA | NA |
5. P | Q5M1A9 | Uracil phosphoribosyltransferase | 4.33e-07 | 6.64e-12 | NA | NA |
5. P | Q2NVF2 | Xanthine-guanine phosphoribosyltransferase | 5.35e-06 | 1.08e-06 | NA | NA |
5. P | Q59040 | PyrE-like protein | 4.45e-09 | 8.00e-08 | NA | NA |
5. P | B0V8B1 | Uracil phosphoribosyltransferase | 6.99e-07 | 3.98e-11 | NA | NA |
5. P | B8EAL3 | Uracil phosphoribosyltransferase | 3.78e-07 | 4.12e-11 | NA | NA |
5. P | P43152 | Hypoxanthine-guanine phosphoribosyltransferase | 1.15e-03 | 6.98e-05 | NA | NA |
5. P | Q5ZW83 | Orotate phosphoribosyltransferase | 4.76e-10 | 1.55e-15 | NA | NA |
5. P | Q814V3 | Uracil phosphoribosyltransferase | 4.63e-07 | 2.40e-13 | NA | NA |
5. P | Q1LS40 | Orotate phosphoribosyltransferase | 1.58e-09 | 2.35e-12 | NA | NA |
5. P | A6VMA6 | Bifunctional protein PyrR | 1.66e-04 | 1.46e-08 | NA | NA |
5. P | Q5UZD3 | Uracil phosphoribosyltransferase | 6.57e-04 | 2.37e-09 | NA | NA |
5. P | A6U9A2 | Xanthine-guanine phosphoribosyltransferase | 2.95e-06 | 2.06e-06 | NA | NA |
5. P | B7LCN8 | Uracil phosphoribosyltransferase | 3.37e-07 | 1.22e-11 | NA | NA |
5. P | C6DBR1 | Uracil phosphoribosyltransferase | 3.36e-07 | 2.16e-12 | NA | NA |
5. P | B1XAX3 | Uracil phosphoribosyltransferase | 3.38e-07 | 1.22e-11 | NA | NA |
5. P | Q8DQL5 | Orotate phosphoribosyltransferase | 6.55e-11 | 6.25e-17 | NA | NA |
5. P | P58856 | Orotate phosphoribosyltransferase | 3.62e-10 | 1.56e-22 | NA | NA |
5. P | Q8DF90 | Xanthine-guanine phosphoribosyltransferase | 2.23e-06 | 9.72e-07 | NA | NA |
5. P | B1XDY1 | Xanthine-guanine phosphoribosyltransferase | 4.97e-06 | 2.86e-08 | NA | NA |
5. P | B8G8T1 | Bifunctional protein PyrR | 5.10e-07 | 4.43e-07 | NA | NA |
5. P | P0CB78 | Orotate phosphoribosyltransferase | 6.75e-11 | 2.32e-16 | NA | NA |
5. P | Q8DGJ7 | Bifunctional protein PyrR | 8.91e-05 | 4.21e-07 | NA | NA |
5. P | P67402 | Uracil phosphoribosyltransferase | 6.21e-07 | 1.81e-12 | NA | NA |
5. P | B5E302 | Orotate phosphoribosyltransferase | 6.44e-11 | 4.84e-17 | NA | NA |
5. P | Q5XCK7 | Orotate phosphoribosyltransferase | 5.40e-11 | 5.07e-19 | NA | NA |
5. P | C1F0N8 | Uracil phosphoribosyltransferase | 4.54e-07 | 2.40e-13 | NA | NA |
5. P | A1KT34 | Uracil phosphoribosyltransferase | 2.77e-07 | 3.82e-13 | NA | NA |
5. P | B9DTU7 | Uracil phosphoribosyltransferase | 4.54e-07 | 7.07e-12 | NA | NA |
5. P | Q5WX86 | Orotate phosphoribosyltransferase | 6.60e-10 | 1.45e-14 | NA | NA |
5. P | B9EB64 | Bifunctional protein PyrR | 8.65e-07 | 2.15e-07 | NA | NA |
5. P | A4WMQ7 | Uracil phosphoribosyltransferase | 6.82e-07 | 1.55e-12 | NA | NA |
5. P | A6VED8 | Orotate phosphoribosyltransferase | 2.13e-09 | 5.01e-15 | NA | NA |
5. P | B1J0Z6 | Xanthine-guanine phosphoribosyltransferase | 4.77e-06 | 2.86e-08 | NA | NA |
5. P | B1JEN1 | Uracil phosphoribosyltransferase | 3.58e-07 | 4.46e-12 | NA | NA |
5. P | Q6LZE9 | Uracil phosphoribosyltransferase | 1.32e-04 | 3.23e-11 | NA | NA |
5. P | Q1JM64 | Orotate phosphoribosyltransferase | 4.25e-11 | 8.53e-19 | NA | NA |
5. P | Q9PGZ3 | Orotate phosphoribosyltransferase | 1.20e-09 | 3.30e-12 | NA | NA |
5. P | A5UX79 | Bifunctional protein PyrR | 3.44e-07 | 1.13e-06 | NA | NA |
5. P | Q88C92 | Orotate phosphoribosyltransferase | 1.46e-09 | 8.06e-17 | NA | NA |
5. P | Q83FI4 | Orotate phosphoribosyltransferase | 5.03e-10 | 6.68e-11 | NA | NA |
5. P | B0TYR5 | Uracil phosphoribosyltransferase | 6.61e-07 | 3.19e-13 | NA | NA |
5. P | Q3B095 | Orotate phosphoribosyltransferase | 7.41e-11 | 4.19e-26 | NA | NA |
5. P | Q89E48 | Uracil phosphoribosyltransferase | 4.88e-05 | 2.25e-11 | NA | NA |
5. P | A4SJF2 | Xanthine-guanine phosphoribosyltransferase | 3.01e-06 | 3.09e-06 | NA | NA |
5. P | Q8ER35 | Orotate phosphoribosyltransferase | 1.13e-10 | 2.00e-20 | NA | NA |
5. P | B2K658 | Xanthine-guanine phosphoribosyltransferase | 5.64e-06 | 1.76e-08 | NA | NA |
5. P | Q6HES3 | Bifunctional protein PyrR | 1.25e-06 | 1.93e-09 | NA | NA |
5. P | B8GFS9 | PyrE-like protein | 1.13e-09 | 7.60e-07 | NA | NA |
5. P | B7HFL2 | Uracil phosphoribosyltransferase | 4.63e-07 | 2.40e-13 | NA | NA |
5. P | A5VYH8 | Uracil phosphoribosyltransferase | 3.86e-07 | 4.93e-12 | NA | NA |
5. P | B6I570 | Uracil phosphoribosyltransferase | 3.45e-07 | 1.22e-11 | NA | NA |
5. P | O42767 | Orotate phosphoribosyltransferase | 9.31e-09 | 1.85e-14 | NA | NA |
5. P | B4F0W4 | Orotate phosphoribosyltransferase | 1.26e-09 | 8.46e-14 | NA | NA |
5. P | A3MZB9 | Bifunctional protein PyrR | 2.78e-04 | 5.49e-08 | NA | NA |
5. P | Q4QJV5 | Uracil phosphoribosyltransferase | 4.12e-07 | 5.76e-13 | NA | NA |
5. P | Q0TEZ0 | Uracil phosphoribosyltransferase | 3.40e-07 | 1.22e-11 | NA | NA |
5. P | Q9Y9D8 | Orotate phosphoribosyltransferase | 5.11e-11 | 4.09e-29 | NA | NA |
5. P | B5E515 | Bifunctional protein PyrR | 5.44e-07 | 3.67e-08 | NA | NA |
5. P | Q7MIK2 | Uracil phosphoribosyltransferase | 2.76e-07 | 2.19e-13 | NA | NA |
5. P | Q47W53 | Uracil phosphoribosyltransferase | 3.48e-07 | 3.72e-13 | NA | NA |
5. P | P00493 | Hypoxanthine-guanine phosphoribosyltransferase | 1.34e-03 | 4.04e-09 | NA | NA |
5. P | Q8PVD0 | PyrE-like protein | 2.58e-10 | 3.07e-05 | NA | NA |
5. P | C3LFI9 | Uracil phosphoribosyltransferase | 4.66e-07 | 2.40e-13 | NA | NA |
5. P | B7LKE4 | Uracil phosphoribosyltransferase | 3.38e-07 | 7.52e-12 | NA | NA |
5. P | Q888A0 | Uracil phosphoribosyltransferase | 3.68e-07 | 4.07e-11 | NA | NA |
5. P | B5EWK0 | Xanthine-guanine phosphoribosyltransferase | 4.30e-06 | 1.67e-08 | NA | NA |
5. P | Q8K9U8 | Hypoxanthine phosphoribosyltransferase | 1.72e-06 | 8.97e-03 | NA | NA |
5. P | P9WHQ8 | Hypoxanthine-guanine phosphoribosyltransferase | 2.47e-03 | 1.57e-06 | NA | NA |
5. P | A9I0G7 | Orotate phosphoribosyltransferase | 2.23e-09 | 2.23e-14 | NA | NA |
5. P | Q1WUD3 | Uracil phosphoribosyltransferase | 3.79e-07 | 6.72e-12 | NA | NA |
5. P | P39765 | Bifunctional protein PyrR | 4.11e-07 | 1.00e-07 | NA | NA |
5. P | B2I6N0 | Orotate phosphoribosyltransferase | 1.10e-09 | 7.42e-12 | NA | NA |
5. P | B7M267 | Xanthine-guanine phosphoribosyltransferase | 5.26e-06 | 2.86e-08 | NA | NA |
5. P | Q49Z59 | Uracil phosphoribosyltransferase | 4.01e-07 | 4.87e-12 | NA | NA |
5. P | Q03A25 | Uracil phosphoribosyltransferase | 6.50e-07 | 7.72e-13 | NA | NA |
5. P | Q38X29 | Bifunctional protein PyrR | 9.08e-07 | 3.44e-08 | NA | NA |
5. P | C5B9D0 | Orotate phosphoribosyltransferase | 1.36e-09 | 6.59e-14 | NA | NA |
5. P | Q2FWE6 | Uracil phosphoribosyltransferase | 5.81e-07 | 1.48e-12 | NA | NA |
5. P | A3MYX7 | Xanthine-guanine phosphoribosyltransferase | 2.46e-06 | 4.87e-12 | NA | NA |
5. P | Q11IP4 | Xanthine-guanine phosphoribosyltransferase | 1.40e-06 | 2.39e-07 | NA | NA |
5. P | Q03M79 | Uracil phosphoribosyltransferase | 3.75e-07 | 6.64e-12 | NA | NA |
5. P | B5EBM3 | Uracil phosphoribosyltransferase | 2.46e-07 | 1.76e-13 | NA | NA |
5. P | C0RHZ5 | Orotate phosphoribosyltransferase | 4.09e-11 | 2.19e-21 | NA | NA |
5. P | B7UGN6 | Uracil phosphoribosyltransferase | 3.52e-07 | 1.22e-11 | NA | NA |
5. P | A0Q074 | Bifunctional protein PyrR | 2.11e-06 | 6.70e-09 | NA | NA |
5. P | A7IAZ7 | PyrE-like protein | 2.50e-10 | 7.92e-14 | NA | NA |
5. P | A6VKR2 | Xanthine-guanine phosphoribosyltransferase | 3.07e-06 | 1.29e-06 | NA | NA |
5. P | Q9RVB9 | Bifunctional protein PyrR | 3.80e-07 | 1.20e-07 | NA | NA |
5. P | A9A079 | Bifunctional protein PyrR | 3.53e-08 | 5.18e-09 | NA | NA |
5. P | B8ZJU2 | Bifunctional protein PyrR | 3.93e-07 | 3.67e-08 | NA | NA |
5. P | A1A1G3 | Orotate phosphoribosyltransferase | 7.71e-09 | 3.70e-11 | NA | NA |
5. P | Q5M6K8 | Hypoxanthine-guanine phosphoribosyltransferase | 2.23e-06 | 1.78e-03 | NA | NA |
5. P | B2JYM9 | Orotate phosphoribosyltransferase | 3.48e-09 | 3.89e-14 | NA | NA |
5. P | Q65QN6 | Xanthine-guanine phosphoribosyltransferase | 2.31e-06 | 5.93e-07 | NA | NA |
5. P | B9J6V7 | Uracil phosphoribosyltransferase | 3.22e-05 | 2.97e-11 | NA | NA |
5. P | P9WHQ9 | Hypoxanthine-guanine phosphoribosyltransferase | 1.38e-03 | 1.07e-06 | NA | NA |
5. P | Q4ZXU7 | Uracil phosphoribosyltransferase | 3.89e-07 | 3.52e-11 | NA | NA |
5. P | A3PIG2 | Xanthine-guanine phosphoribosyltransferase | 1.40e-06 | 2.29e-09 | NA | NA |
5. P | Q2NEP2 | PyrE-like protein | 7.10e-11 | 2.77e-12 | NA | NA |
5. P | Q8EDI9 | Uracil phosphoribosyltransferase | 3.46e-07 | 5.19e-11 | NA | NA |
5. P | Q1C5P3 | Uracil phosphoribosyltransferase | 3.93e-07 | 6.48e-12 | NA | NA |
5. P | B8DUJ6 | Orotate phosphoribosyltransferase | 1.25e-08 | 1.46e-11 | NA | NA |
5. P | A7GRL6 | Bifunctional protein PyrR | 5.32e-07 | 3.69e-09 | NA | NA |
5. P | Q8FT38 | Bifunctional protein PyrR | 3.89e-05 | 1.52e-06 | NA | NA |
5. P | A6VC42 | Uracil phosphoribosyltransferase | 3.80e-07 | 8.02e-13 | NA | NA |
5. P | A4W507 | Orotate phosphoribosyltransferase | 1.39e-09 | 2.54e-14 | NA | NA |
5. P | Q6D1I0 | Xanthine-guanine phosphoribosyltransferase | 4.28e-06 | 1.90e-08 | NA | NA |
5. P | Q8E9L5 | Orotate phosphoribosyltransferase | 1.86e-09 | 1.32e-14 | NA | NA |
5. P | P43855 | Orotate phosphoribosyltransferase | 2.02e-09 | 1.45e-14 | NA | NA |
5. P | B7IUQ1 | Bifunctional protein PyrR | 1.03e-06 | 2.34e-09 | NA | NA |
5. P | B7NQN7 | Uracil phosphoribosyltransferase | 3.64e-07 | 1.22e-11 | NA | NA |
5. P | B1YEG7 | Uracil phosphoribosyltransferase | 3.01e-07 | 1.37e-12 | NA | NA |
5. P | C5BLH1 | Orotate phosphoribosyltransferase | 9.32e-10 | 5.97e-15 | NA | NA |
5. P | P0A7E4 | Orotate phosphoribosyltransferase | 1.77e-09 | 6.59e-14 | NA | NA |
5. P | Q8DHW5 | Orotate phosphoribosyltransferase | 8.70e-11 | 2.31e-25 | NA | NA |
5. P | C1CR28 | Bifunctional protein PyrR | 4.12e-07 | 3.67e-08 | NA | NA |
5. P | B5Z1I2 | Xanthine-guanine phosphoribosyltransferase | 5.17e-06 | 2.86e-08 | NA | NA |
5. P | A6SUD4 | Orotate phosphoribosyltransferase | 1.23e-09 | 1.08e-11 | NA | NA |
5. P | P71479 | Bifunctional protein PyrR 1 | 9.64e-07 | 5.31e-08 | NA | NA |
5. P | Q9A0D0 | Bifunctional protein PyrR | 3.83e-07 | 2.43e-09 | NA | NA |
5. P | P9WHK3 | Bifunctional protein PyrR | 9.59e-07 | 3.36e-10 | NA | NA |
5. P | Q02522 | Hypoxanthine-guanine phosphoribosyltransferase | 8.09e-07 | 9.93e-04 | NA | NA |
5. P | Q8DQI3 | Uracil phosphoribosyltransferase | 6.14e-07 | 2.16e-12 | NA | NA |
5. P | B1KIG8 | Uracil phosphoribosyltransferase | 2.94e-07 | 2.88e-12 | NA | NA |
5. P | P35788 | Orotate phosphoribosyltransferase | 7.47e-09 | 1.16e-14 | NA | NA |
5. P | B7N1U3 | Orotate phosphoribosyltransferase | 1.73e-09 | 6.59e-14 | NA | NA |
5. P | Q89IM4 | Xanthine-guanine phosphoribosyltransferase | 2.28e-06 | 8.26e-15 | NA | NA |
5. P | Q0SK44 | Uracil phosphoribosyltransferase | 2.06e-06 | 2.92e-10 | NA | NA |
5. P | Q55758 | Bifunctional protein PyrR | 2.60e-07 | 4.35e-10 | NA | NA |
5. P | P43049 | Uracil phosphoribosyltransferase | 3.79e-07 | 1.48e-13 | NA | NA |
5. P | Q57ST7 | Xanthine-guanine phosphoribosyltransferase | 4.35e-06 | 1.67e-08 | NA | NA |
5. P | Q2YXH0 | Bifunctional protein PyrR | 8.82e-07 | 1.71e-08 | NA | NA |
5. P | A0RRR2 | Orotate phosphoribosyltransferase | 3.85e-11 | 1.88e-15 | NA | NA |
5. P | Q2G0Y9 | Xanthine phosphoribosyltransferase | 7.11e-15 | 1.31e-33 | NA | NA |
5. P | A9GUD3 | Orotate phosphoribosyltransferase | 7.34e-11 | 6.91e-31 | NA | NA |
5. P | A7MEN2 | Xanthine-guanine phosphoribosyltransferase | 4.26e-06 | 1.71e-08 | NA | NA |
5. P | P77889 | Orotate phosphoribosyltransferase | 5.48e-11 | 9.32e-19 | NA | NA |
5. P | A8FUD4 | Uracil phosphoribosyltransferase | 2.94e-07 | 5.26e-13 | NA | NA |
5. P | C4ZT95 | Xanthine-guanine phosphoribosyltransferase | 5.12e-06 | 2.86e-08 | NA | NA |
5. P | O66821 | Hypoxanthine-guanine phosphoribosyltransferase | 2.13e-06 | 4.28e-04 | NA | NA |
5. P | B5EB48 | Bifunctional protein PyrR | 2.28e-07 | 1.13e-11 | NA | NA |
5. P | Q63VS8 | Uracil phosphoribosyltransferase | 4.27e-05 | 2.88e-10 | NA | NA |
5. P | P58862 | PyrE-like protein 1 | 3.79e-10 | 1.29e-07 | NA | NA |
5. P | Q0C3U2 | Orotate phosphoribosyltransferase | 3.35e-11 | 3.51e-23 | NA | NA |
5. P | Q4QMP2 | Xanthine-guanine phosphoribosyltransferase 1 | 3.38e-06 | 4.34e-07 | NA | NA |
5. P | Q6GHN0 | Orotate phosphoribosyltransferase | 1.14e-10 | 3.10e-22 | NA | NA |
5. P | B7LVK4 | Orotate phosphoribosyltransferase | 1.79e-09 | 6.59e-14 | NA | NA |
5. P | Q182T5 | Bifunctional protein PyrR | 1.03e-06 | 9.39e-08 | NA | NA |
5. P | Q576P9 | Uracil phosphoribosyltransferase | 2.50e-07 | 3.71e-08 | NA | NA |
5. P | A2RG73 | Uracil phosphoribosyltransferase | 6.40e-07 | 1.81e-12 | NA | NA |
5. P | C1AN24 | Bifunctional protein PyrR | 5.90e-05 | 3.36e-10 | NA | NA |
5. P | B0CKX9 | Orotate phosphoribosyltransferase | 4.20e-11 | 2.19e-21 | NA | NA |
5. P | Q9RBJ3 | Uracil phosphoribosyltransferase | 3.36e-07 | 1.49e-10 | NA | NA |
5. P | A9VTC2 | Orotate phosphoribosyltransferase | 1.04e-10 | 1.75e-17 | NA | NA |
5. P | Q1DG16 | Uracil phosphoribosyltransferase | 7.36e-05 | 4.10e-10 | NA | NA |
5. P | B0KNF7 | Uracil phosphoribosyltransferase | 3.83e-07 | 4.93e-12 | NA | NA |
5. P | Q1J796 | Bifunctional protein PyrR | 3.90e-07 | 3.15e-09 | NA | NA |
5. P | C1CL12 | Bifunctional protein PyrR | 3.96e-07 | 3.67e-08 | NA | NA |
5. P | B5EQ26 | Orotate phosphoribosyltransferase | 4.70e-11 | 5.07e-22 | NA | NA |
5. P | Q2P2V7 | Uracil phosphoribosyltransferase | 3.54e-07 | 5.06e-11 | NA | NA |
5. P | B7VJB5 | Xanthine-guanine phosphoribosyltransferase | 2.12e-06 | 7.34e-08 | NA | NA |
5. P | Q5PC26 | Orotate phosphoribosyltransferase | 1.48e-09 | 3.49e-13 | NA | NA |
5. P | P67399 | Uracil phosphoribosyltransferase | 5.01e-07 | 6.97e-13 | NA | NA |
5. P | B9LFU4 | Bifunctional protein PyrR | 5.54e-07 | 2.71e-07 | NA | NA |
5. P | P08309 | Orotate phosphoribosyltransferase | 3.57e-08 | 3.52e-11 | NA | NA |
5. P | B7I752 | Uracil phosphoribosyltransferase | 6.55e-07 | 3.98e-11 | NA | NA |
5. P | Q7M8H6 | Uracil phosphoribosyltransferase | 8.91e-07 | 1.17e-10 | NA | NA |
5. P | A9WLN5 | Uracil phosphoribosyltransferase | 8.08e-07 | 1.65e-11 | NA | NA |
5. P | Q2JX67 | Bifunctional protein PyrR | 4.34e-07 | 1.35e-04 | NA | NA |
5. P | A8A6A4 | Orotate phosphoribosyltransferase | 1.71e-09 | 6.59e-14 | NA | NA |
5. P | B4TR74 | Uracil phosphoribosyltransferase | 3.27e-07 | 1.05e-11 | NA | NA |
5. P | B7H6L8 | Orotate phosphoribosyltransferase | 8.96e-11 | 3.43e-17 | NA | NA |
5. P | B7M4C7 | Orotate phosphoribosyltransferase | 1.58e-09 | 6.59e-14 | NA | NA |
5. P | Q8ZC05 | Xanthine-guanine phosphoribosyltransferase | 1.11e-03 | 1.76e-08 | NA | NA |
5. P | C5A6P6 | Uracil phosphoribosyltransferase | 7.46e-05 | 6.07e-11 | NA | NA |
5. P | P65915 | Orotate phosphoribosyltransferase | 8.74e-10 | 1.24e-15 | NA | NA |
5. P | Q92PU1 | Xanthine-guanine phosphoribosyltransferase | 2.65e-06 | 3.88e-06 | NA | NA |
5. P | Q2JJ22 | Bifunctional protein PyrR | 3.19e-07 | 2.95e-07 | NA | NA |
5. P | Q311Z9 | Uracil phosphoribosyltransferase | 3.05e-07 | 1.46e-11 | NA | NA |
5. P | B7NQ04 | Orotate phosphoribosyltransferase | 1.49e-09 | 6.85e-14 | NA | NA |
5. P | C0ZG45 | Bifunctional protein PyrR | 1.06e-04 | 5.43e-08 | NA | NA |
5. P | A4SHC9 | Orotate phosphoribosyltransferase | 2.02e-09 | 1.05e-11 | NA | NA |
5. P | B2IWH8 | Bifunctional protein PyrR | 1.70e-07 | 3.82e-10 | NA | NA |
5. P | Q6AF89 | Bifunctional protein PyrR | 7.42e-07 | 4.20e-05 | NA | NA |
5. P | Q7NQ92 | Orotate phosphoribosyltransferase | 1.20e-09 | 8.34e-13 | NA | NA |
5. P | B0KA38 | Bifunctional protein PyrR | 9.49e-07 | 1.21e-10 | NA | NA |
5. P | Q2K9D7 | Xanthine-guanine phosphoribosyltransferase | 1.89e-06 | 2.25e-08 | NA | NA |
5. P | A0Q306 | Uracil phosphoribosyltransferase | 4.61e-07 | 1.37e-13 | NA | NA |
5. P | B8GTF1 | Orotate phosphoribosyltransferase | 1.96e-09 | 2.13e-15 | NA | NA |
5. P | Q8RG35 | Uracil phosphoribosyltransferase | 5.49e-07 | 2.95e-12 | NA | NA |
5. P | A0ALM3 | Uracil phosphoribosyltransferase | 2.88e-05 | 4.18e-13 | NA | NA |
5. P | P65946 | Bifunctional protein PyrR | 3.44e-07 | 3.67e-08 | NA | NA |
5. P | B6I3L9 | Orotate phosphoribosyltransferase | 1.52e-09 | 1.20e-13 | NA | NA |
5. P | B3WDL1 | Uracil phosphoribosyltransferase | 8.31e-07 | 7.72e-13 | NA | NA |
5. P | Q9F4I7 | Bifunctional protein PyrR | 2.79e-07 | 2.01e-05 | NA | NA |
5. P | Q65W02 | Orotate phosphoribosyltransferase | 1.95e-09 | 6.85e-14 | NA | NA |
5. P | B0TI63 | Uracil phosphoribosyltransferase | 6.06e-07 | 1.80e-13 | NA | NA |
5. P | A5IBA2 | Orotate phosphoribosyltransferase | 6.04e-10 | 1.55e-15 | NA | NA |
5. P | Q38WJ8 | Uracil phosphoribosyltransferase | 6.11e-07 | 3.64e-14 | NA | NA |
5. P | B2RIV3 | Uracil phosphoribosyltransferase | 8.37e-05 | 1.86e-07 | NA | NA |
5. P | Q5XDM5 | Uracil phosphoribosyltransferase | 6.07e-07 | 1.81e-12 | NA | NA |
5. P | Q9HE15 | Uracil phosphoribosyltransferase 2 | 4.10e-05 | 2.88e-04 | NA | NA |
5. P | Q03LU2 | Bifunctional protein PyrR | 3.67e-07 | 2.27e-08 | NA | NA |
5. P | C6DZ53 | Bifunctional protein PyrR | 2.80e-07 | 6.14e-11 | NA | NA |
5. P | P51900 | Hypoxanthine-guanine-xanthine phosphoribosyltransferase | 2.66e-03 | 1.60e-03 | NA | NA |
5. P | P67396 | Uracil phosphoribosyltransferase | 5.65e-07 | 1.48e-12 | NA | NA |
5. P | Q9CF77 | Pyrimidine operon regulatory protein | 2.48e-07 | 2.53e-08 | NA | NA |
5. P | A1V2G4 | Uracil phosphoribosyltransferase | 5.26e-05 | 2.88e-10 | NA | NA |
5. P | A4VWM9 | Uracil phosphoribosyltransferase | 6.04e-07 | 1.33e-12 | NA | NA |
5. P | C4ZF78 | Orotate phosphoribosyltransferase | 1.39e-09 | 2.05e-13 | NA | NA |
5. P | A9KKR4 | Orotate phosphoribosyltransferase | 9.71e-10 | 6.98e-12 | NA | NA |
5. P | A7ZWK1 | Xanthine-guanine phosphoribosyltransferase | 5.24e-06 | 2.86e-08 | NA | NA |
5. P | Q04BB0 | Uracil phosphoribosyltransferase | 5.81e-07 | 5.13e-13 | NA | NA |
5. P | B7NK87 | Xanthine-guanine phosphoribosyltransferase | 5.63e-06 | 1.25e-07 | NA | NA |
5. P | B4TZY3 | Orotate phosphoribosyltransferase | 1.96e-09 | 8.35e-14 | NA | NA |
5. P | A7FCT0 | Orotate phosphoribosyltransferase | 3.41e-09 | 3.89e-14 | NA | NA |
5. P | Q3YW04 | Orotate phosphoribosyltransferase | 1.49e-09 | 6.76e-14 | NA | NA |
5. P | B5ZXI2 | Uracil phosphoribosyltransferase | 3.27e-05 | 2.97e-11 | NA | NA |
5. P | Q0TL78 | Xanthine-guanine phosphoribosyltransferase | 4.12e-06 | 1.46e-08 | NA | NA |
5. P | Q5WB67 | Uracil phosphoribosyltransferase | 5.35e-07 | 4.93e-12 | NA | NA |
5. P | B4SVV9 | Xanthine-guanine phosphoribosyltransferase | 4.40e-06 | 1.67e-08 | NA | NA |
5. P | Q8CSW7 | Orotate phosphoribosyltransferase | 7.05e-11 | 6.09e-20 | NA | NA |
5. P | A9BDP7 | Orotate phosphoribosyltransferase | 5.63e-11 | 1.14e-26 | NA | NA |
5. P | O93849 | Orotate phosphoribosyltransferase | 1.68e-08 | 9.84e-13 | NA | NA |
5. P | A9MNR9 | Xanthine-guanine phosphoribosyltransferase | 4.31e-06 | 1.67e-08 | NA | NA |
5. P | C3MF81 | Orotate phosphoribosyltransferase | 2.02e-10 | 1.32e-12 | NA | NA |
5. P | B2K9J9 | Uracil phosphoribosyltransferase | 3.97e-07 | 6.48e-12 | NA | NA |
5. P | Q6G463 | Orotate phosphoribosyltransferase | 2.69e-11 | 9.13e-21 | NA | NA |
5. P | Q92T49 | Uracil phosphoribosyltransferase | 3.00e-05 | 3.04e-11 | NA | NA |
5. P | A0RHR3 | Bifunctional protein PyrR | 6.71e-07 | 2.34e-09 | NA | NA |
5. P | B3Q0A6 | Orotate phosphoribosyltransferase | 3.41e-10 | 5.26e-13 | NA | NA |
5. P | Q2P898 | Orotate phosphoribosyltransferase | 1.28e-09 | 5.98e-13 | NA | NA |
5. P | A6U3J7 | Uracil phosphoribosyltransferase | 5.59e-07 | 1.48e-12 | NA | NA |
5. P | Q45FY6 | Hypoxanthine-guanine phosphoribosyltransferase | 1.37e-03 | 2.02e-09 | NA | NA |
5. P | P37171 | Hypoxanthine-guanine phosphoribosyltransferase | 2.50e-03 | 8.13e-03 | NA | NA |
5. P | B8HCL2 | Uracil phosphoribosyltransferase | 4.09e-07 | 6.72e-12 | NA | NA |
5. P | A1RV13 | Uracil phosphoribosyltransferase | 9.73e-07 | 5.13e-13 | NA | NA |
5. P | A1JKZ8 | Uracil phosphoribosyltransferase | 3.93e-07 | 5.31e-12 | NA | NA |
5. P | Q8RD94 | Uracil phosphoribosyltransferase | 3.51e-05 | 5.55e-14 | NA | NA |
5. P | A1VES8 | Xanthine-guanine phosphoribosyltransferase | 1.21e-03 | 1.27e-08 | NA | NA |
5. P | A1AMK6 | Uracil phosphoribosyltransferase | 2.63e-07 | 1.30e-13 | NA | NA |
5. P | Q39EA2 | Uracil phosphoribosyltransferase | 4.03e-05 | 1.37e-09 | NA | NA |
5. P | B4TD73 | Uracil phosphoribosyltransferase | 2.88e-07 | 1.05e-11 | NA | NA |
5. P | A9VSB3 | Uracil phosphoribosyltransferase | 4.52e-07 | 3.82e-13 | NA | NA |
5. P | C5D8P5 | Bifunctional protein PyrR | 1.42e-06 | 3.69e-09 | NA | NA |
5. P | A4VGS1 | Orotate phosphoribosyltransferase | 2.25e-09 | 1.62e-14 | NA | NA |
5. P | B2V4U3 | Bifunctional protein PyrR | 1.22e-06 | 4.57e-09 | NA | NA |
5. P | B7JJX8 | Bifunctional protein PyrR | 3.38e-07 | 1.93e-09 | NA | NA |
5. P | B5XJZ7 | Uracil phosphoribosyltransferase | 5.70e-07 | 3.14e-12 | NA | NA |
5. P | Q1CCZ8 | Orotate phosphoribosyltransferase | 2.93e-09 | 3.89e-14 | NA | NA |
5. P | C3P1G4 | Uracil phosphoribosyltransferase | 4.63e-07 | 2.40e-13 | NA | NA |
5. P | A1R2Y2 | Uracil phosphoribosyltransferase | 5.58e-07 | 2.48e-12 | NA | NA |
5. P | Q8XIC4 | Uracil phosphoribosyltransferase | 5.85e-07 | 1.83e-13 | NA | NA |
5. P | B8D8C3 | Orotate phosphoribosyltransferase | 1.41e-09 | 3.62e-15 | NA | NA |
5. P | P18562 | Uracil phosphoribosyltransferase | 2.19e-05 | 1.20e-08 | NA | NA |
5. P | A1WZE3 | Orotate phosphoribosyltransferase | 9.93e-10 | 1.06e-13 | NA | NA |
5. P | Q9K6G5 | Uracil phosphoribosyltransferase | 6.48e-07 | 1.80e-13 | NA | NA |
5. P | B0K1G2 | Uracil phosphoribosyltransferase | 4.00e-05 | 3.64e-14 | NA | NA |
5. P | B2SAD1 | Orotate phosphoribosyltransferase | 4.16e-11 | 2.19e-21 | NA | NA |
5. P | Q97RQ3 | Uracil phosphoribosyltransferase | 4.90e-07 | 1.55e-12 | NA | NA |
5. P | A6X294 | Orotate phosphoribosyltransferase | 3.98e-11 | 1.10e-20 | NA | NA |
5. P | A9BWD4 | Uracil phosphoribosyltransferase | 9.51e-07 | 9.87e-12 | NA | NA |
5. P | B8I567 | Uracil phosphoribosyltransferase | 6.06e-05 | 1.22e-14 | NA | NA |
5. P | C4LKC1 | Uracil phosphoribosyltransferase | 4.65e-07 | 4.52e-12 | NA | NA |
5. P | Q1RFT3 | Xanthine-guanine phosphoribosyltransferase | 4.45e-06 | 2.27e-08 | NA | NA |
5. P | Q0SQY5 | Uracil phosphoribosyltransferase | 6.30e-07 | 3.53e-13 | NA | NA |
5. P | B1MFZ1 | Uracil phosphoribosyltransferase | 9.58e-05 | 2.88e-09 | NA | NA |
5. P | C0Z818 | Uracil phosphoribosyltransferase | 6.48e-07 | 1.21e-12 | NA | NA |
5. P | P47959 | Hypoxanthine-guanine phosphoribosyltransferase | 5.47e-03 | 6.48e-09 | NA | NA |
5. P | Q979B9 | PyrE-like protein | 1.68e-10 | 5.24e-09 | NA | NA |
5. P | O26962 | PyrE-like protein | 1.37e-10 | 7.60e-10 | NA | NA |
5. P | Q3JZU9 | Uracil phosphoribosyltransferase | 4.27e-07 | 6.97e-13 | NA | NA |
5. P | B2UZI9 | Uracil phosphoribosyltransferase | 4.57e-07 | 1.72e-12 | NA | NA |
5. P | A6WYH9 | Uracil phosphoribosyltransferase | 3.56e-07 | 7.24e-12 | NA | NA |
5. P | A1US32 | Orotate phosphoribosyltransferase | 2.33e-11 | 9.53e-23 | NA | NA |
5. P | Q5M216 | Hypoxanthine-guanine phosphoribosyltransferase | 2.28e-06 | 1.78e-03 | NA | NA |
5. P | B0JUG8 | Bifunctional protein PyrR | 1.78e-07 | 7.53e-11 | NA | NA |
5. P | Q6DCP3 | Phosphoribosyltransferase domain-containing protein 1 | 2.06e-03 | 6.11e-08 | NA | NA |
5. P | A6X0U5 | Xanthine-guanine phosphoribosyltransferase | 2.08e-06 | 2.29e-07 | NA | NA |
5. P | B2GFU4 | Uracil phosphoribosyltransferase | 3.10e-07 | 8.83e-12 | NA | NA |
5. P | P27605 | Hypoxanthine-guanine phosphoribosyltransferase | 1.27e-03 | 3.44e-10 | NA | NA |
5. P | C1DEU0 | Uracil phosphoribosyltransferase | 3.65e-07 | 1.34e-13 | NA | NA |
5. P | Q4ZZY3 | Orotate phosphoribosyltransferase | 1.61e-09 | 1.26e-15 | NA | NA |
5. P | A7ZPU1 | Uracil phosphoribosyltransferase | 3.41e-07 | 1.22e-11 | NA | NA |
5. P | Q92AH7 | Orotate phosphoribosyltransferase | 4.18e-11 | 3.04e-21 | NA | NA |
5. P | Q8FRQ5 | Uracil phosphoribosyltransferase | 6.09e-05 | 9.68e-11 | NA | NA |
5. P | A2BUQ6 | Orotate phosphoribosyltransferase | 3.89e-11 | 5.40e-21 | NA | NA |
5. P | Q311U1 | Xanthine-guanine phosphoribosyltransferase | 1.72e-06 | 3.95e-09 | NA | NA |
5. P | Q07010 | Hypoxanthine-guanine phosphoribosyltransferase | 2.28e-04 | 3.85e-02 | NA | NA |
5. P | A5IYF5 | Uracil phosphoribosyltransferase | 5.36e-07 | 4.75e-13 | NA | NA |
5. P | Q7V4S7 | Orotate phosphoribosyltransferase | 5.25e-11 | 8.50e-25 | NA | NA |
5. P | B4SXE3 | Orotate phosphoribosyltransferase | 1.47e-09 | 8.35e-14 | NA | NA |
5. P | Q2FPQ2 | Orotate phosphoribosyltransferase | 3.04e-11 | 3.71e-36 | NA | NA |
5. P | A1JHW8 | Orotate phosphoribosyltransferase | 1.74e-09 | 6.24e-16 | NA | NA |
5. P | Q1QSL0 | Orotate phosphoribosyltransferase | 2.93e-09 | 1.61e-08 | NA | NA |
5. P | Q97HA0 | Bifunctional protein PyrR | 1.05e-06 | 3.01e-07 | NA | NA |
5. P | Q72D63 | Xanthine-guanine phosphoribosyltransferase | 7.05e-06 | 3.22e-09 | NA | NA |
5. P | Q042K8 | Uracil phosphoribosyltransferase | 5.78e-07 | 3.24e-15 | NA | NA |
5. P | Q7MAD7 | Orotate phosphoribosyltransferase | 5.06e-11 | 1.21e-15 | NA | NA |
5. P | B4U4M9 | Uracil phosphoribosyltransferase | 3.95e-07 | 2.13e-12 | NA | NA |
5. P | A1AXP4 | Orotate phosphoribosyltransferase | 2.62e-09 | 1.13e-15 | NA | NA |
5. P | B8FZ68 | Uracil phosphoribosyltransferase | 5.64e-07 | 3.36e-14 | NA | NA |
5. P | B2ULR4 | Bifunctional protein PyrR | 2.46e-07 | 3.91e-09 | NA | NA |
5. P | Q0TNB4 | Uracil phosphoribosyltransferase | 5.79e-07 | 1.83e-13 | NA | NA |
5. P | Q8G0P3 | Xanthine-guanine phosphoribosyltransferase | 1.60e-06 | 1.19e-07 | NA | NA |
5. P | B7HY75 | Uracil phosphoribosyltransferase | 4.43e-07 | 2.40e-13 | NA | NA |
5. P | B9DPQ3 | Bifunctional protein PyrR | 8.90e-07 | 5.48e-09 | NA | NA |
5. P | B2HU54 | Uracil phosphoribosyltransferase | 6.69e-07 | 3.98e-11 | NA | NA |
5. P | P0A9M4 | Hypoxanthine phosphoribosyltransferase | 1.50e-06 | 1.47e-02 | NA | NA |
5. P | B5FQJ0 | Uracil phosphoribosyltransferase | 2.89e-07 | 1.05e-11 | NA | NA |
5. P | Q7VDR1 | Orotate phosphoribosyltransferase | 5.89e-11 | 5.90e-28 | NA | NA |
5. P | P75081 | Uracil phosphoribosyltransferase | 3.09e-06 | 1.73e-13 | NA | NA |
5. P | B5R5G6 | Orotate phosphoribosyltransferase | 1.97e-09 | 8.35e-14 | NA | NA |
5. P | Q5HGN4 | Bifunctional protein PyrR | 7.88e-07 | 2.42e-08 | NA | NA |
5. P | Q9X6W6 | Bifunctional protein PyrR | 1.98e-07 | 1.92e-05 | NA | NA |
5. P | Q9A627 | Uracil phosphoribosyltransferase | 2.90e-07 | 2.41e-12 | NA | NA |
5. P | B1JSF5 | Uracil phosphoribosyltransferase | 4.09e-07 | 6.48e-12 | NA | NA |
5. P | Q21EF2 | Orotate phosphoribosyltransferase | 9.99e-10 | 3.92e-15 | NA | NA |
5. P | Q04K45 | Bifunctional protein PyrR | 4.10e-07 | 3.67e-08 | NA | NA |
5. P | A7FLI5 | Xanthine-guanine phosphoribosyltransferase | 5.71e-06 | 1.76e-08 | NA | NA |
5. P | Q8ZWV9 | Uracil phosphoribosyltransferase | 8.19e-07 | 3.35e-12 | NA | NA |
5. P | A5HY41 | Uracil phosphoribosyltransferase | 6.90e-07 | 1.37e-13 | NA | NA |
5. P | P20035 | Hypoxanthine-guanine-xanthine phosphoribosyltransferase | 8.64e-05 | 1.11e-06 | NA | NA |
5. P | A9M3K6 | Uracil phosphoribosyltransferase | 2.73e-07 | 3.82e-13 | NA | NA |
5. P | A3MZ36 | Orotate phosphoribosyltransferase | 2.60e-09 | 6.39e-15 | NA | NA |
5. P | A7FG38 | Uracil phosphoribosyltransferase | 3.94e-07 | 6.48e-12 | NA | NA |
5. P | B2T2A6 | Uracil phosphoribosyltransferase | 4.44e-05 | 4.10e-10 | NA | NA |
5. P | Q138L1 | Xanthine-guanine phosphoribosyltransferase | 2.18e-06 | 4.14e-12 | NA | NA |
5. P | A5EY64 | Orotate phosphoribosyltransferase | 6.92e-09 | 1.60e-13 | NA | NA |
5. P | B0RXL2 | Orotate phosphoribosyltransferase | 1.72e-09 | 1.85e-12 | NA | NA |
5. P | C5BXA3 | Uracil phosphoribosyltransferase | 4.75e-07 | 4.55e-10 | NA | NA |
5. P | P0A2M6 | Uracil phosphoribosyltransferase | 2.75e-07 | 1.05e-11 | NA | NA |
5. P | Q5L0U8 | Bifunctional protein PyrR | 1.19e-06 | 4.92e-08 | NA | NA |
5. P | A6TCB0 | Uracil phosphoribosyltransferase | 3.80e-07 | 8.89e-13 | NA | NA |
5. P | Q2S8N8 | Orotate phosphoribosyltransferase | 1.58e-06 | 4.43e-15 | NA | NA |
5. P | B0SL24 | Orotate phosphoribosyltransferase | 3.38e-10 | 5.79e-30 | NA | NA |
5. P | B2A2U8 | Bifunctional protein PyrR | 3.63e-07 | 3.22e-08 | NA | NA |
5. P | A5D172 | Bifunctional protein PyrR | 2.78e-07 | 2.15e-07 | NA | NA |
5. P | Q9CEC9 | Uracil phosphoribosyltransferase | 4.10e-07 | 2.19e-11 | NA | NA |
5. P | Q0I4P2 | Uracil phosphoribosyltransferase | 4.06e-07 | 4.50e-14 | NA | NA |
5. P | Q5HGM7 | Orotate phosphoribosyltransferase | 1.11e-10 | 8.52e-23 | NA | NA |
5. P | B4EUU7 | Xanthine-guanine phosphoribosyltransferase | 3.18e-06 | 4.09e-08 | NA | NA |
5. P | B5FGY4 | Uracil phosphoribosyltransferase | 2.69e-07 | 3.18e-12 | NA | NA |
5. P | A1SDD5 | Uracil phosphoribosyltransferase | 3.56e-07 | 1.28e-11 | NA | NA |
5. P | Q49WX9 | Bifunctional protein PyrR | 8.22e-07 | 1.63e-07 | NA | NA |
5. P | P59011 | Bifunctional protein PyrR | 3.76e-05 | 1.96e-07 | NA | NA |
5. P | Q5F9P0 | Uracil phosphoribosyltransferase | 4.00e-07 | 2.69e-13 | NA | NA |
5. P | A5FQE0 | Bifunctional protein PyrR | 5.64e-07 | 2.80e-07 | NA | NA |
5. P | Q630T4 | Uracil phosphoribosyltransferase | 4.63e-07 | 2.40e-13 | NA | NA |
5. P | B8DDR2 | Bifunctional protein PyrR | 3.60e-07 | 2.84e-09 | NA | NA |
5. P | F2MMN7 | Orotate phosphoribosyltransferase | 6.62e-11 | 8.04e-19 | NA | NA |
5. P | Q48P92 | Bifunctional protein PyrR | 3.16e-07 | 8.86e-07 | NA | NA |
5. P | A5VPJ0 | Orotate phosphoribosyltransferase | 4.22e-11 | 2.19e-21 | NA | NA |
5. P | Q57E89 | Orotate phosphoribosyltransferase | 4.25e-11 | 2.19e-21 | NA | NA |
5. P | Q9NRG1 | Phosphoribosyltransferase domain-containing protein 1 | 2.89e-04 | 1.32e-08 | NA | NA |
5. P | Q6LTX6 | Xanthine-guanine phosphoribosyltransferase | 3.22e-06 | 1.43e-08 | NA | NA |
5. P | A9M1F6 | Orotate phosphoribosyltransferase | 9.93e-10 | 1.57e-15 | NA | NA |
5. P | Q5M0X3 | Bifunctional protein PyrR | 2.33e-07 | 1.17e-08 | NA | NA |
5. P | B1L7Y5 | Uracil phosphoribosyltransferase | 4.32e-05 | 3.16e-11 | NA | NA |
5. P | Q831G0 | Uracil phosphoribosyltransferase | 4.69e-07 | 3.15e-13 | NA | NA |
5. P | P0A9M6 | Xanthine-guanine phosphoribosyltransferase | 4.94e-06 | 2.86e-08 | NA | NA |
5. P | B5Z035 | Uracil phosphoribosyltransferase | 3.36e-07 | 1.22e-11 | NA | NA |
5. P | Q819S7 | Orotate phosphoribosyltransferase | 6.27e-11 | 9.41e-18 | NA | NA |
5. P | Q8UI98 | Orotate phosphoribosyltransferase | 1.87e-10 | 2.28e-13 | NA | NA |
5. P | Q6LN74 | Uracil phosphoribosyltransferase | 2.79e-07 | 9.00e-13 | NA | NA |
5. P | Q55574 | Orotate phosphoribosyltransferase | 8.18e-11 | 1.77e-20 | NA | NA |
5. P | Q2FF16 | Uracil phosphoribosyltransferase | 5.70e-07 | 1.48e-12 | NA | NA |
5. P | P57291 | Hypoxanthine phosphoribosyltransferase | 1.98e-06 | 7.74e-03 | NA | NA |
5. P | Q5HPZ3 | Bifunctional protein PyrR | 8.13e-07 | 2.27e-08 | NA | NA |
5. P | Q8DRP8 | Hypoxanthine-guanine phosphoribosyltransferase | 2.40e-06 | 7.24e-03 | NA | NA |
5. P | A3CNI9 | Bifunctional protein PyrR | 2.91e-07 | 2.37e-08 | NA | NA |
5. P | A5WB07 | Orotate phosphoribosyltransferase | 2.03e-09 | 8.06e-17 | NA | NA |
5. P | P96078 | Bifunctional protein PyrR | 3.54e-07 | 7.44e-07 | NA | NA |
5. P | B6YTB2 | Uracil phosphoribosyltransferase | 6.35e-05 | 5.92e-11 | NA | NA |
5. P | Q54NJ8 | Hypoxanthine-guanine phosphoribosyltransferase | 4.54e-06 | 2.51e-02 | NA | NA |
5. P | P9WFF2 | Uracil phosphoribosyltransferase | 5.93e-05 | 6.07e-11 | NA | NA |
5. P | C1DI51 | Orotate phosphoribosyltransferase | 1.86e-09 | 3.20e-15 | NA | NA |
5. P | Q4JTK4 | Uracil phosphoribosyltransferase | 4.65e-07 | 3.17e-10 | NA | NA |
5. P | Q2FZ77 | Bifunctional protein PyrR | 8.44e-07 | 2.42e-08 | NA | NA |
5. P | Q3ZY75 | Bifunctional protein PyrR | 3.50e-07 | 2.80e-07 | NA | NA |
5. P | B8F557 | Orotate phosphoribosyltransferase | 2.37e-09 | 9.32e-15 | NA | NA |
5. P | A2C0A9 | Orotate phosphoribosyltransferase | 3.99e-11 | 3.81e-25 | NA | NA |
5. P | P0DH77 | Bifunctional protein pyrR | 2.54e-07 | 2.20e-08 | NA | NA |
5. P | Q5PF80 | Xanthine-guanine phosphoribosyltransferase | 4.41e-06 | 1.67e-08 | NA | NA |
5. P | Q46F14 | PyrE-like protein 1 | 1.90e-10 | 1.11e-07 | NA | NA |
5. P | P9WFF3 | Uracil phosphoribosyltransferase | 6.68e-05 | 6.07e-11 | NA | NA |
5. P | P59575 | Orotate phosphoribosyltransferase | 1.59e-09 | 6.90e-17 | NA | NA |
5. P | C3P661 | Bifunctional protein PyrR | 3.25e-07 | 2.34e-09 | NA | NA |
5. P | B4E5R5 | Uracil phosphoribosyltransferase | 4.33e-05 | 1.93e-09 | NA | NA |
5. P | Q6MS86 | Uracil phosphoribosyltransferase | 1.09e-06 | 6.46e-13 | NA | NA |
5. P | B1VNY5 | Uracil phosphoribosyltransferase | 5.28e-07 | 5.78e-11 | NA | NA |
5. P | Q5X340 | Uracil phosphoribosyltransferase | 1.20e-04 | 8.09e-11 | NA | NA |
5. P | Q2YN10 | Orotate phosphoribosyltransferase | 4.26e-11 | 2.19e-21 | NA | NA |
5. P | C5BHQ5 | Uracil phosphoribosyltransferase | 3.81e-07 | 1.97e-12 | NA | NA |
5. P | A4W0Q9 | Bifunctional protein PyrR | 6.22e-07 | 6.95e-08 | NA | NA |
5. P | B7UM49 | Orotate phosphoribosyltransferase | 2.13e-09 | 6.59e-14 | NA | NA |
5. P | B5FM65 | Orotate phosphoribosyltransferase | 1.46e-09 | 8.35e-14 | NA | NA |
5. P | B2UW87 | Orotate phosphoribosyltransferase | 2.36e-09 | 7.32e-15 | NA | NA |
5. P | A0QI38 | Bifunctional protein PyrR | 4.64e-05 | 3.19e-08 | NA | NA |
5. P | C3LQ49 | Xanthine-guanine phosphoribosyltransferase | 2.10e-06 | 1.05e-07 | NA | NA |
5. P | Q81WE7 | Bifunctional protein PyrR | 6.72e-07 | 2.34e-09 | NA | NA |
5. P | B8DVI9 | Uracil phosphoribosyltransferase | 8.69e-07 | 5.65e-12 | NA | NA |
5. P | O69537 | Hypoxanthine-guanine phosphoribosyltransferase | 1.21e-03 | 1.28e-04 | NA | NA |
5. P | Q81JY5 | Uracil phosphoribosyltransferase | 4.48e-07 | 2.40e-13 | NA | NA |
5. P | Q0TBG7 | Orotate phosphoribosyltransferase | 1.69e-09 | 6.59e-14 | NA | NA |
5. P | B8H621 | Orotate phosphoribosyltransferase | 1.42e-11 | 2.45e-22 | NA | NA |
5. P | P08870 | Orotate phosphoribosyltransferase | 1.97e-09 | 8.35e-14 | NA | NA |
5. P | Q8VR31 | Orotate phosphoribosyltransferase | 9.95e-10 | 2.95e-15 | NA | NA |
5. P | Q66DZ2 | Xanthine-guanine phosphoribosyltransferase | 1.13e-03 | 1.76e-08 | NA | NA |
5. P | B0RRQ3 | Uracil phosphoribosyltransferase | 3.31e-07 | 1.49e-10 | NA | NA |
5. P | Q6LVN7 | Orotate phosphoribosyltransferase | 1.91e-09 | 5.14e-16 | NA | NA |
5. P | Q9HS16 | PyrE-like protein | 2.61e-10 | 1.65e-08 | NA | NA |
5. P | Q5Z187 | Uracil phosphoribosyltransferase | 3.33e-07 | 6.17e-14 | NA | NA |
5. P | B0BTQ6 | Bifunctional protein PyrR | 2.00e-06 | 5.49e-08 | NA | NA |
5. P | A8GAD0 | Xanthine-guanine phosphoribosyltransferase | 2.84e-06 | 6.55e-09 | NA | NA |
5. P | Q732I7 | Orotate phosphoribosyltransferase | 4.85e-11 | 1.01e-17 | NA | NA |
5. P | Q9RE01 | Uracil phosphoribosyltransferase | 5.01e-07 | 3.92e-13 | NA | NA |
5. P | Q8DST6 | Uracil phosphoribosyltransferase | 4.66e-07 | 3.10e-12 | NA | NA |
5. P | Q93CX7 | Uracil phosphoribosyltransferase | 7.81e-07 | 3.64e-14 | NA | NA |
5. P | A4TPK4 | Xanthine-guanine phosphoribosyltransferase | 5.57e-06 | 1.76e-08 | NA | NA |
5. P | O94331 | Orotate phosphoribosyltransferase | 4.16e-09 | 2.64e-12 | NA | NA |
5. P | P58863 | PyrE-like protein 2 | 1.53e-10 | 5.17e-05 | NA | NA |
5. P | B4RNV9 | Orotate phosphoribosyltransferase | 1.25e-09 | 8.23e-16 | NA | NA |
5. P | B1XP88 | Bifunctional protein PyrR | 1.23e-07 | 1.16e-10 | NA | NA |
5. P | P67395 | Uracil phosphoribosyltransferase | 5.74e-07 | 1.48e-12 | NA | NA |
5. P | Q9L4N8 | Pyrimidine operon regulatory protein | 2.30e-07 | 3.55e-08 | NA | NA |
5. P | A8FD21 | Orotate phosphoribosyltransferase | 3.91e-11 | 3.48e-16 | NA | NA |
5. P | Q72DA4 | Uracil phosphoribosyltransferase | 3.73e-07 | 5.31e-11 | NA | NA |
5. P | Q48V26 | Uracil phosphoribosyltransferase | 5.94e-07 | 1.81e-12 | NA | NA |
5. P | Q5HPY6 | Orotate phosphoribosyltransferase | 7.80e-11 | 2.52e-20 | NA | NA |
5. P | B3DPH5 | Uracil phosphoribosyltransferase | 8.07e-07 | 1.01e-11 | NA | NA |
5. P | B2VF77 | Orotate phosphoribosyltransferase | 1.65e-09 | 2.65e-14 | NA | NA |
5. P | A1RKQ4 | Uracil phosphoribosyltransferase | 3.81e-07 | 4.82e-11 | NA | NA |
5. P | O33799 | Hypoxanthine phosphoribosyltransferase | 1.54e-06 | 1.91e-02 | NA | NA |
5. P | C6DCY0 | Xanthine-guanine phosphoribosyltransferase | 5.04e-06 | 2.59e-08 | NA | NA |
5. P | Q9K9W3 | Orotate phosphoribosyltransferase | 5.70e-11 | 1.35e-17 | NA | NA |
5. P | P30402 | Orotate phosphoribosyltransferase 2 | 3.52e-09 | 7.30e-17 | NA | NA |
5. P | Q8XJB2 | Bifunctional protein PyrR | 7.47e-07 | 9.01e-11 | NA | NA |
5. P | A5UBP1 | Uracil phosphoribosyltransferase | 4.44e-07 | 7.15e-13 | NA | NA |
5. P | B4T9Y5 | Orotate phosphoribosyltransferase | 1.46e-09 | 8.35e-14 | NA | NA |
5. P | A5IE48 | Uracil phosphoribosyltransferase | 1.17e-04 | 5.92e-11 | NA | NA |
5. P | P0CS95 | Orotate phosphoribosyltransferase | 2.33e-08 | 1.04e-12 | NA | NA |
5. P | Q1CLD0 | Xanthine-guanine phosphoribosyltransferase | 3.30e-06 | 1.76e-08 | NA | NA |
5. P | B2U3S9 | Xanthine-guanine phosphoribosyltransferase | 5.24e-06 | 4.28e-08 | NA | NA |
5. P | Q2A285 | Uracil phosphoribosyltransferase | 6.84e-07 | 8.04e-15 | NA | NA |
5. P | Q87F16 | Orotate phosphoribosyltransferase | 1.65e-09 | 4.69e-12 | NA | NA |
5. P | B2GEZ3 | Bifunctional protein PyrR | 6.61e-07 | 1.46e-08 | NA | NA |
5. P | B8GYP3 | Uracil phosphoribosyltransferase | 2.88e-07 | 2.41e-12 | NA | NA |
5. P | Q4L5Q0 | Bifunctional protein PyrR | 9.24e-07 | 3.96e-08 | NA | NA |
5. P | Q8NX25 | Orotate phosphoribosyltransferase | 1.19e-10 | 9.38e-23 | NA | NA |
5. P | A4IZ90 | Uracil phosphoribosyltransferase | 5.96e-07 | 1.62e-14 | NA | NA |
5. P | B7MYC5 | Uracil phosphoribosyltransferase | 3.39e-07 | 1.22e-11 | NA | NA |
5. P | Q1MM09 | Orotate phosphoribosyltransferase | 1.91e-10 | 1.41e-13 | NA | NA |
5. P | Q03QY1 | Uracil phosphoribosyltransferase | 6.22e-07 | 1.97e-13 | NA | NA |
5. P | A9IRL8 | Orotate phosphoribosyltransferase | 2.38e-11 | 9.27e-21 | NA | NA |
5. P | B8IZH6 | Uracil phosphoribosyltransferase | 4.19e-07 | 1.78e-10 | NA | NA |
5. P | B8DP34 | Uracil phosphoribosyltransferase | 3.84e-07 | 1.10e-12 | NA | NA |
5. P | A0PPI7 | Bifunctional protein PyrR | 5.29e-07 | 2.29e-09 | NA | NA |
5. P | P50587 | Orotate phosphoribosyltransferase | 1.79e-09 | 1.83e-15 | NA | NA |
5. P | Q9CLL7 | Bifunctional protein PyrR | 1.35e-03 | 4.92e-08 | NA | NA |
5. P | A7ZHZ7 | Xanthine-guanine phosphoribosyltransferase | 5.20e-06 | 2.86e-08 | NA | NA |
5. P | Q4QNR7 | Orotate phosphoribosyltransferase | 2.00e-09 | 9.58e-15 | NA | NA |
5. P | B3PG74 | Orotate phosphoribosyltransferase | 1.38e-09 | 7.22e-14 | NA | NA |
5. P | Q0TPA8 | Bifunctional protein PyrR | 1.33e-06 | 9.01e-11 | NA | NA |
5. P | Q7WB58 | Uracil phosphoribosyltransferase | 3.50e-07 | 2.99e-12 | NA | NA |
5. P | B3H0R5 | Bifunctional protein PyrR | 9.01e-07 | 5.49e-08 | NA | NA |
5. P | Q212I9 | Xanthine-guanine phosphoribosyltransferase | 3.15e-06 | 2.08e-14 | NA | NA |
5. P | Q9RX68 | Orotate phosphoribosyltransferase | 4.14e-12 | 1.13e-29 | NA | NA |
5. P | P43859 | Xanthine-guanine phosphoribosyltransferase | 3.33e-06 | 4.34e-07 | NA | NA |
5. P | Q3IJI1 | Orotate phosphoribosyltransferase | 2.52e-09 | 6.48e-15 | NA | NA |
5. P | Q9ZJX0 | Orotate phosphoribosyltransferase | 4.62e-11 | 2.44e-15 | NA | NA |
5. P | B0U1J0 | Orotate phosphoribosyltransferase | 1.11e-09 | 7.42e-12 | NA | NA |
5. P | C0M760 | Bifunctional protein PyrR | 3.32e-07 | 1.67e-08 | NA | NA |
5. P | Q2FHP0 | Bifunctional protein PyrR | 8.35e-07 | 2.42e-08 | NA | NA |
5. P | A4VUG6 | Bifunctional protein PyrR | 5.96e-07 | 6.95e-08 | NA | NA |
5. P | A7ZFB7 | Uracil phosphoribosyltransferase | 3.96e-05 | 2.99e-13 | NA | NA |
5. P | A8FD12 | Bifunctional protein PyrR | 5.42e-07 | 2.08e-08 | NA | NA |
5. P | Q2S320 | Uracil phosphoribosyltransferase | 4.99e-05 | 1.34e-13 | NA | NA |
5. P | Q48U73 | Bifunctional protein PyrR | 4.13e-07 | 3.15e-09 | NA | NA |
5. P | A9VYY9 | Orotate phosphoribosyltransferase | 4.69e-11 | 7.88e-20 | NA | NA |
5. P | Q1J728 | Orotate phosphoribosyltransferase | 5.57e-11 | 5.07e-19 | NA | NA |
5. P | B5BB06 | Uracil phosphoribosyltransferase | 3.04e-07 | 1.05e-11 | NA | NA |
5. P | A6QG99 | Bifunctional protein PyrR | 7.84e-07 | 2.42e-08 | NA | NA |
5. P | Q48AN2 | Orotate phosphoribosyltransferase | 2.23e-09 | 2.66e-11 | NA | NA |
5. P | B8CN81 | Uracil phosphoribosyltransferase | 3.06e-07 | 2.57e-12 | NA | NA |
5. P | P0DD41 | Hypoxanthine-guanine phosphoribosyltransferase | 1.88e-06 | 6.66e-03 | NA | NA |
5. P | A3CS56 | PyrE-like protein | 4.08e-10 | 4.13e-09 | NA | NA |
5. P | A9MA28 | Orotate phosphoribosyltransferase | 4.42e-11 | 4.77e-21 | NA | NA |
5. P | B3QC92 | Orotate phosphoribosyltransferase | 6.13e-11 | 1.77e-32 | NA | NA |
5. P | A6TFN4 | Orotate phosphoribosyltransferase | 1.42e-09 | 3.27e-14 | NA | NA |
5. P | C0PYQ8 | Uracil phosphoribosyltransferase | 3.13e-07 | 1.05e-11 | NA | NA |
5. P | B7N8G9 | Xanthine-guanine phosphoribosyltransferase | 3.20e-06 | 2.86e-08 | NA | NA |
5. P | Q74DP6 | Bifunctional protein PyrR | 3.28e-07 | 1.08e-09 | NA | NA |
5. P | B5YWE0 | Orotate phosphoribosyltransferase | 2.79e-09 | 9.77e-14 | NA | NA |
5. P | B7HLM5 | Bifunctional protein PyrR | 3.58e-07 | 2.34e-09 | NA | NA |
5. P | Q8Y1L3 | Bifunctional protein PyrR | 4.53e-07 | 5.08e-06 | NA | NA |
5. P | B4SS22 | Uracil phosphoribosyltransferase | 3.05e-07 | 5.75e-10 | NA | NA |
5. P | A3M2R1 | Uracil phosphoribosyltransferase | 6.52e-07 | 7.07e-12 | NA | NA |
5. P | Q9RU32 | Uracil phosphoribosyltransferase | 3.78e-07 | 1.69e-11 | NA | NA |
5. P | P0A277 | Xanthine-guanine phosphoribosyltransferase | 4.46e-06 | 1.67e-08 | NA | NA |
5. P | P65945 | Bifunctional protein PyrR | 7.95e-07 | 2.42e-08 | NA | NA |
5. P | J9VQB3 | Orotate phosphoribosyltransferase | 2.50e-08 | 9.71e-13 | NA | NA |
5. P | Q9US43 | Putative uracil phosphoribosyltransferase urg2 | 6.53e-05 | 2.75e-15 | NA | NA |
5. P | Q9Z441 | Bifunctional protein PyrR | 3.46e-07 | 2.18e-05 | NA | NA |
5. P | Q8NM11 | Orotate phosphoribosyltransferase | 1.35e-10 | 1.19e-28 | NA | NA |
5. P | Q2YCI8 | Orotate phosphoribosyltransferase | 3.94e-09 | 1.29e-08 | NA | NA |
5. P | C4K3W9 | Orotate phosphoribosyltransferase | 1.77e-09 | 1.13e-10 | NA | NA |
5. P | Q2SN06 | Uracil phosphoribosyltransferase | 3.85e-07 | 6.54e-13 | NA | NA |
5. P | Q04DP1 | Uracil phosphoribosyltransferase | 6.22e-07 | 5.27e-14 | NA | NA |
5. P | B6EJU2 | Uracil phosphoribosyltransferase | 2.39e-07 | 2.88e-12 | NA | NA |
5. P | Q9W719 | Hypoxanthine-guanine phosphoribosyltransferase | 4.56e-03 | 1.72e-08 | NA | NA |
5. P | P70881 | Uracil phosphoribosyltransferase | 3.89e-07 | 5.24e-12 | NA | NA |
5. P | P65916 | Orotate phosphoribosyltransferase | 6.55e-11 | 3.10e-22 | NA | NA |
5. P | A5N7G2 | Bifunctional protein PyrR | 1.95e-06 | 8.81e-08 | NA | NA |
5. P | B2HDV9 | Uracil phosphoribosyltransferase | 5.27e-05 | 4.82e-11 | NA | NA |
5. P | C6A3U9 | Uracil phosphoribosyltransferase | 2.09e-03 | 3.13e-10 | NA | NA |
5. P | Q6LDD9 | Hypoxanthine-guanine phosphoribosyltransferase | 9.34e-03 | 1.08e-08 | NA | NA |
5. P | Q1CK39 | Uracil phosphoribosyltransferase | 4.02e-07 | 6.48e-12 | NA | NA |
5. P | Q92AG8 | Bifunctional protein PyrR | 3.07e-07 | 2.43e-09 | NA | NA |
5. P | Q26997 | Hypoxanthine-guanine-xanthine phosphoribosyltransferase | 4.03e-03 | 2.37e-07 | NA | NA |
5. P | A1KS25 | Orotate phosphoribosyltransferase | 1.12e-09 | 1.24e-15 | NA | NA |
5. P | B0T2R0 | Uracil phosphoribosyltransferase | 2.93e-05 | 1.83e-12 | NA | NA |
5. P | Q18JL4 | PyrE-like protein | 6.17e-10 | 7.93e-09 | NA | NA |
5. P | A3N7G1 | Uracil phosphoribosyltransferase | 4.35e-05 | 1.13e-10 | NA | NA |
5. P | Q1JHA9 | Orotate phosphoribosyltransferase | 5.37e-11 | 2.20e-19 | NA | NA |
5. P | O13917 | Hypoxanthine-guanine phosphoribosyltransferase | 7.21e-07 | 2.45e-02 | NA | NA |
5. P | P47165 | Xanthine phosphoribosyltransferase 1 | 3.30e-06 | 1.26e-03 | NA | NA |
5. P | Q83J15 | Orotate phosphoribosyltransferase | 1.50e-09 | 8.46e-14 | NA | NA |
5. P | Q87VA0 | Bifunctional protein PyrR | 3.09e-07 | 1.65e-06 | NA | NA |
5. P | P57622 | Orotate phosphoribosyltransferase | 1.85e-09 | 3.62e-15 | NA | NA |
5. P | A8MH75 | Bifunctional protein PyrR | 5.49e-07 | 2.91e-09 | NA | NA |
5. P | P0DH75 | Orotate phosphoribosyltransferase | 6.35e-11 | 8.04e-19 | NA | NA |
5. P | Q1MMV8 | Uracil phosphoribosyltransferase | 3.25e-05 | 5.19e-11 | NA | NA |
5. P | Q98QP6 | Uracil phosphoribosyltransferase | 3.99e-07 | 5.92e-11 | NA | NA |
5. P | B7L3Z0 | Xanthine-guanine phosphoribosyltransferase | 4.99e-06 | 2.86e-08 | NA | NA |
5. P | P59013 | Bifunctional protein PyrR | 3.99e-07 | 2.37e-09 | NA | NA |
5. P | P0A2M5 | Uracil phosphoribosyltransferase | 3.10e-07 | 1.05e-11 | NA | NA |
6. F | P0A3Z9 | Pur operon repressor | 2.66e-14 | NA | NA | 0.8463 |
6. F | P0A400 | Pur operon repressor | 2.28e-14 | NA | NA | 0.846 |
6. F | Q8YSY4 | Bifunctional enzyme PyrF/PyrE | 2.87e-07 | NA | NA | 0.6729 |
6. F | P37472 | Hypoxanthine-guanine phosphoribosyltransferase | 1.63e-06 | NA | NA | 0.6716 |
6. F | Q839B2 | Hypoxanthine-guanine phosphoribosyltransferase | 1.67e-06 | NA | NA | 0.6414 |
7. B | Q9HLV6 | Ribose-phosphate pyrophosphokinase | 1.96e-04 | NA | 0.020 | NA |
7. B | P31166 | Adenine phosphoribosyltransferase 1, chloroplastic | 0.00e+00 | NA | 1.27e-35 | NA |