Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54779.1

JCVISYN3A_0415

Chromosome segregation protein.
M. mycoides homolog: Q6MTD2.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 155
Unique PROST Go: 37
Unique BLAST Go: 20
Unique Foldseek Go: 1

Total Homologs: 326
Unique PROST Homologs: 36
Unique BLAST Homologs: 18
Unique Foldseek Homologs: 39

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: smc; Chromosome partition protein Smc
Zhang et al. [4]: GO:0022402|cell cycle process
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was B8CW13 (Chromosome partition protein Smc) with a FATCAT P-Value: 0 and RMSD of 3.93 angstrom. The sequence alignment identity is 32.5%.
Structural alignment shown in left. Query protein AVX54779.1 colored as red in alignment, homolog B8CW13 colored as blue. Query protein AVX54779.1 is also shown in right top, homolog B8CW13 showed in right bottom. They are colored based on secondary structures.

  AVX54779.1 MLFLKQIRASGFKSFA-DLTVMDFNYD--MTGVVGPNGSGKSNITDAIRWTLGEQSTKTLRGSKMDDIVFSGNNEKKAADVAEVTLVFNNTHENFSSIKS 97
      B8CW13 M-FLKKLELKGFKSFAKPITI---NFESPITAIVGPNGSGKSNIVDAIRWVLGEQSAKTLRGSRMADVIFAGSKDYKALNKASVTLYLDN-QDKI--LPL 93

  AVX54779.1 DV--VEITRK--FDKNTRESEFYINSTK-CKLKDVQSIALEAGLTRSSIAIISQGTVANFTESKPETKREIFDDAAGVSKYKKRKKETLSKLEKATENLT 192
      B8CW13 DVSTVKISRKVNMDGQ---SDYYLNG-KICRLKDIENLLMDTGLGKDTYSIVGQGKIDSIINSRPEKLRELFEEAAGISKYKSRKMDAEKRLEKTNHDLQ 189

  AVX54779.1 RLEDIAKEISRRL-PNLERQSKKALEYQQ-KVNELKNIEL-YILTK-DLKVLVNRI------EELRVEKIEYETQIKKLTNEINMSQEEV-----NLIID 277
      B8CW13 RIEDLIWELEKQVGP-LEKAAQKAKKYRRLK-EELKVLEVNLLLDKWD-KNL-DRLSSFEEDEQLLIHK------LKSLTNNLTESQEKLESLQRTLKVK 279

  AVX54779.1 KDSEDNQKLGELNSKF---NSIVEKIAN----LKVRKQKAEFKEQENLN--TKD-----------QDEYKAALI--KKQFD------E-KQI---SIK-- 343
      B8CW13 KD-----ELSRLRDRYYRQKSKREEAENTLCILEERRQGLS-REKENLNQEIKDLNLRREELTGRLDEIGSRLIELKEKIDNYNQNYESKKVLLDEIKEN 373

  AVX54779.1 --SEKDKLTKAENSLL----ELKD--------K----------------YDYYSNKY---NEIYREIETIRTTISRIS-----------------IQIEA 393
      B8CW13 LDREKQDLFFLRNNILDGNVELKDISSQFEQLKERGRHLEEEIKRIKTTRDKISSEYDALNE--RE-DKLRTYLKSVDNKIEEKRSVLTDLKEEELNLQA 470

  AVX54779.1 -IE---------HNK---K-----------AALQSYQDGVSAILNNQKQIGGVVGVLKSLINVKEEYQIAISVTA-SGHMNSLVMKTDQDVKKAIEFLKK 468
      B8CW13 RLEEAKKRFNRTRNKLNEKNSHLSILHEMEDSLEGYYRGVKNILKARSKLTGIIGVVADQIEVDKKYELAIE-TALGGRLQNIIVKDDKSARECVDYLKE 569

  AVX54779.1 NNNLGRVTFLPLNTLTPNLINPVQRQILEKSEGFVGFANELVEYPETISKAVEYALASIIVVQSYD--DAINLAKNTNFR---FNIVSLDGQRILPHGAI 563
      B8CW13 TKG-GQATFLPVNMVNGRKVN-FKNNQVKKVDGFLGIASSFVDCEDYLKPVIEYLLGRTII--STDLKSAIEIAR---LRKRGFKIVTLEGDVINSGGAI 662

  AVX54779.1 VGGSTRNAN---IFTK--------------QNTQNQDN-TLEELKNKI-ELLEQKEISKTKEITEYKTANDSLRD-QI--N----DLNGTIR--NAKNNL 635
      B8CW13 TGGS-KNSNKKMLLSRSRKIEDLKKEVLKLQNSLGEDSKNLNQLENKLKEVLNKKEVIK----------ND-IRDLEIEKNNYHKDL---IRLEQEKTKL 747

  AVX54779.1 FNWTENL----KEFSDEHKSLTGR-DLF-TGVYSK----SDESESI----I--LAKQISELEIQR----DEI-QIEIN--SISFKRTQSMEK-----QK- 706
      B8CW13 ---SERLEEIDEEFVDCHDRL-GKNDAAKQKLEDKLKALNDDF-SLEKNEIENKEKRVEELEARHENINDEITRLKINLAQLNEKR-ESLRKEEEKSNKE 841

  AVX54779.1 --EMNSKN-------SK----------KRDELDELKTH-AG-------SIN-TEYNV--------LLQRRITIID---RLSN----GYQITEETALTMEV 763
      B8CW13 LIELAEKNEEFKERYNKILSEIKGINNKEGQLNELKVKLSGEIEKLKNDLNLTEKEVEEKQQRIDMLQREVS--DLQTRLDKKKDEKHQI--ELKIT-RL 936

  AVX54779.1 EN-----IE----DEQVARE-----RIIELTTY---------IQN----IGNVNMDAIEEYKNE-KERFDYYDQQIKDIYDAKEKLESIILDIDIAMESQ 835
      B8CW13 ENRNERIVEILENDYDVKPEDGFDDR-IKITNYSRAGQKVKELKNAIKKLGTVNQGAIEEY-NDLVDRLDYLQNQHDDLLKAKESITKVIQEIEETMSSL 1034

  AVX54779.1 FKQIIEDVNKALPDVFSKMFGGGYAELIYTDPDNILETGIDIKIFPPGKKITNLNLLSGGEKSLVALSVLFAILKARPLPLVILDEAEAPLDPVNVERFA 935
      B8CW13 FHEAFLKVNGEFNNTFKELFNGGQASLKLTEPENLLETGVEIVAQPPGKQLKKLSLMSGGERALTAIALVFAFLKVNPSPFYILDEIDAPLDDANVTRFA 1134

  AVX54779.1 RYVRQFSHNTQFIIVTHREGTMTQCDSLFGVTMQTKGITKIINVKLVEAKNLH 988
      B8CW13 RYIKEYSRFAQFLIVTHRKNMMAEAETIYGVTMEESGVSKLISLKLSE--QII 1185

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0003677	DNA binding
1. PBF	GO:0072423	response to DNA damage checkpoint signaling
1. PBF	GO:0003697	single-stranded DNA binding
1. PBF	GO:0000724	double-strand break repair via homologous recombination
1. PBF	GO:0034991	nuclear meiotic cohesin complex
1. PBF	GO:0030261	chromosome condensation
1. PBF	GO:0051321	meiotic cell cycle
1. PBF	GO:0007059	chromosome segregation
1. PBF	GO:0009314	response to radiation
1. PBF	GO:0034184	positive regulation of maintenance of mitotic sister chromatid cohesion
1. PBF	GO:0097431	mitotic spindle pole
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0046872	metal ion binding
1. PBF	GO:0051301	cell division
1. PBF	GO:0019827	stem cell population maintenance
1. PBF	GO:0016787	hydrolase activity
1. PBF	GO:0008278	cohesin complex
1. PBF	GO:0007062	sister chromatid cohesion
1. PBF	GO:0036033	mediator complex binding
1. PBF	GO:0090398	cellular senescence
1. PBF	GO:0051276	chromosome organization
1. PBF	GO:0090307	mitotic spindle assembly
1. PBF	GO:0005694	chromosome
1. PBF	GO:0006302	double-strand break repair
1. PBF	GO:0000781	chromosome, telomeric region
1. PBF	GO:0030893	meiotic cohesin complex
1. PBF	GO:0007076	mitotic chromosome condensation
1. PBF	GO:0007064	mitotic sister chromatid cohesion
1. PBF	GO:0006260	DNA replication
1. PBF	GO:0030915	Smc5-Smc6 complex
1. PBF	GO:0006281	DNA repair
1. PBF	GO:0016605	PML body
1. PBF	GO:0000722	telomere maintenance via recombination
2. PF	GO:0009432	SOS response
2. PF	GO:0016021	integral component of membrane
2. PF	GO:0004527	exonuclease activity
2. PF	GO:0005886	plasma membrane
2. PF	GO:0006310	DNA recombination
2. PF	GO:0004519	endonuclease activity
2. PF	GO:0009295	nucleoid
2. PF	GO:0007049	cell cycle
4. PB	GO:0003682	chromatin binding
4. PB	GO:0000228	nuclear chromosome
4. PB	GO:0051307	meiotic chromosome separation
4. PB	GO:0046536	dosage compensation complex
4. PB	GO:0034506	chromosome, centromeric core domain
4. PB	GO:0070840	dynein complex binding
4. PB	GO:0042464	dosage compensation by hypoactivation of X chromosome
4. PB	GO:0010705	meiotic DNA double-strand break processing involved in reciprocal meiotic recombination
4. PB	GO:0048487	beta-tubulin binding
4. PB	GO:0000796	condensin complex
4. PB	GO:0036292	DNA rewinding
4. PB	GO:0000793	condensed chromosome
4. PB	GO:0006974	cellular response to DNA damage stimulus
4. PB	GO:0034990	nuclear mitotic cohesin complex
4. PB	GO:0000217	DNA secondary structure binding
4. PB	GO:0046982	protein heterodimerization activity
4. PB	GO:0007130	synaptonemal complex assembly
4. PB	GO:0000019	regulation of mitotic recombination
4. PB	GO:0071459	protein localization to chromosome, centromeric region
4. PB	GO:0051984	positive regulation of chromosome segregation
4. PB	GO:0016363	nuclear matrix
4. PB	GO:0000803	sex chromosome
4. PB	GO:0015616	DNA translocase activity
4. PB	GO:0005634	nucleus
4. PB	GO:0000779	condensed chromosome, centromeric region
4. PB	GO:0000776	kinetochore
4. PB	GO:0071960	maintenance of mitotic sister chromatid cohesion, centromeric
4. PB	GO:0006275	regulation of DNA replication
4. PB	GO:0010165	response to X-ray
4. PB	GO:0030892	mitotic cohesin complex
4. PB	GO:0070550	rDNA condensation
4. PB	GO:0000070	mitotic sister chromatid segregation
4. PB	GO:0035861	site of double-strand break
4. PB	GO:0000775	chromosome, centromeric region
4. PB	GO:0010032	meiotic chromosome condensation
4. PB	GO:0071139	resolution of recombination intermediates
4. PB	GO:0030870	Mre11 complex
4. PB	GO:0061775	cohesin loading activity
4. PB	GO:0000800	lateral element
4. PB	GO:0000805	X chromosome
4. PB	GO:1903342	negative regulation of meiotic DNA double-strand break formation
4. PB	GO:0061780	mitotic cohesin loading
4. PB	GO:0000794	condensed nuclear chromosome
4. PB	GO:0000012	single strand break repair
4. PB	GO:0062022	mitotic cohesin ssDNA (lagging strand) loading
4. PB	GO:0070058	tRNA gene clustering
4. PB	GO:0110039	positive regulation of nematode male tail tip morphogenesis
4. PB	GO:0051383	kinetochore organization
4. PB	GO:0016607	nuclear speck
4. PB	GO:0045132	meiotic chromosome segregation
4. PB	GO:0035061	interchromatin granule
4. PB	GO:0003680	minor groove of adenine-thymine-rich DNA binding
4. PB	GO:0005654	nucleoplasm
4. PB	GO:0018393	internal peptidyl-lysine acetylation
4. PB	GO:0036121	double-stranded DNA helicase activity
4. PB	GO:0000785	chromatin
5. P	GO:0051304	chromosome separation
5. P	GO:1903211	mitotic recombination involved in replication fork processing
5. P	GO:0090305	nucleic acid phosphodiester bond hydrolysis
5. P	GO:0033674	positive regulation of kinase activity
5. P	GO:0042626	ATPase-coupled transmembrane transporter activity
5. P	GO:0120290	stalled replication fork localization to nuclear periphery
5. P	GO:0003690	double-stranded DNA binding
5. P	GO:0045120	pronucleus
5. P	GO:0032206	positive regulation of telomere maintenance
5. P	GO:0031860	telomeric 3' overhang formation
5. P	GO:0043047	single-stranded telomeric DNA binding
5. P	GO:0032508	DNA duplex unwinding
5. P	GO:0070192	chromosome organization involved in meiotic cell cycle
5. P	GO:0007131	reciprocal meiotic recombination
5. P	GO:0009380	excinuclease repair complex
5. P	GO:1990898	meiotic DNA double-strand break clipping
5. P	GO:0044752	response to human chorionic gonadotropin
5. P	GO:0031954	positive regulation of protein autophosphorylation
5. P	GO:0016234	inclusion body
5. P	GO:0009381	excinuclease ABC activity
5. P	GO:0006289	nucleotide-excision repair
5. P	GO:0010520	regulation of reciprocal meiotic recombination
5. P	GO:0007004	telomere maintenance via telomerase
5. P	GO:0004529	exodeoxyribonuclease activity
5. P	GO:0046597	negative regulation of viral entry into host cell
5. P	GO:0032078	negative regulation of endodeoxyribonuclease activity
5. P	GO:0000723	telomere maintenance
5. P	GO:1904354	negative regulation of telomere capping
5. P	GO:0097552	mitochondrial double-strand break repair via homologous recombination
5. P	GO:1990683	DNA double-strand break attachment to nuclear envelope
5. P	GO:0099015	degradation of host chromosome by virus
5. P	GO:0030674	protein-macromolecule adaptor activity
5. P	GO:1990238	double-stranded DNA endodeoxyribonuclease activity
5. P	GO:0003691	double-stranded telomeric DNA binding
5. P	GO:0051880	G-quadruplex DNA binding
5. P	GO:0110025	DNA strand resection involved in replication fork processing
5. P	GO:0003684	damaged DNA binding
6. F	GO:0005737	cytoplasm
7. B	GO:0015441	ABC-type beta-glucan transporter activity
7. B	GO:0009888	tissue development
7. B	GO:0007414	axonal defasciculation
7. B	GO:0051177	meiotic sister chromatid cohesion
7. B	GO:0005201	extracellular matrix structural constituent
7. B	GO:0014037	Schwann cell differentiation
7. B	GO:0015415	ATPase-coupled phosphate ion transmembrane transporter activity
7. B	GO:0010950	positive regulation of endopeptidase activity
7. B	GO:0009411	response to UV
7. B	GO:0005315	inorganic phosphate transmembrane transporter activity
7. B	GO:0032224	positive regulation of synaptic transmission, cholinergic
7. B	GO:0016887	ATP hydrolysis activity
7. B	GO:0051788	response to misfolded protein
7. B	GO:0000725	recombinational repair
7. B	GO:0005604	basement membrane
7. B	GO:0015437	lipopolysaccharide floppase activity
7. B	GO:0015772	oligosaccharide transport
7. B	GO:0044772	mitotic cell cycle phase transition
7. B	GO:0036298	recombinational interstrand cross-link repair
7. B	GO:0009792	embryo development ending in birth or egg hatching

Uniprot GO Annotations

GO	Description
GO:0003677	DNA binding
GO:0006260	DNA replication
GO:0007062	sister chromatid cohesion
GO:0051276	chromosome organization
GO:0016887	ATP hydrolysis activity
GO:0005737	cytoplasm
GO:0005524	ATP binding
GO:0030261	chromosome condensation
GO:0005694	chromosome
GO:0007059	chromosome segregation
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q9CBT5	Chromosome partition protein Smc	1.04e-12	2.37e-42	1.02e-48	0.4089
1. PBF	Q00737	Chromosome segregation protein sudA	4.27e-13	3.97e-50	6.72e-23	0.3856
1. PBF	O93309	Structural maintenance of chromosomes protein 3	1.22e-15	3.46e-43	2.61e-14	0.3989
1. PBF	P41508	Chromosome partition protein Smc	0.00e+00	1.13e-98	3.18e-162	0.6056
1. PBF	Q81ZL2	Chromosome partition protein Smc	8.88e-16	1.83e-50	6.92e-47	0.4207
1. PBF	Q604U6	Chromosome partition protein Smc	1.02e-14	5.36e-49	1.00e-53	0.4715
1. PBF	P62134	DNA double-strand break repair Rad50 ATPase	1.58e-08	9.78e-28	3.64e-05	0.3229
1. PBF	B9E1H0	Chromosome partition protein Smc	6.44e-15	2.81e-50	2.66e-52	0.4303
1. PBF	P50533	Structural maintenance of chromosomes protein 2	3.11e-11	3.73e-42	3.81e-17	0.4189
1. PBF	D4GUK1	DNA double-strand break repair Rad50 ATPase	6.10e-09	4.49e-21	5.60e-04	0.3799
1. PBF	Q5ZJY5	Structural maintenance of chromosomes protein 5	9.57e-10	2.97e-22	6.14e-04	0.2989
1. PBF	P62135	DNA double-strand break repair Rad50 ATPase	1.73e-08	1.69e-19	2.16e-04	0.3712
1. PBF	Q8REH4	Chromosome partition protein Smc	1.89e-15	2.63e-51	1.73e-38	0.3914
1. PBF	Q5N0D2	Chromosome partition protein Smc	1.78e-15	5.30e-46	8.60e-25	0.3679
1. PBF	Q6N1B7	Chromosome partition protein Smc	3.30e-08	2.22e-45	1.02e-38	0.3806
1. PBF	P47540	Chromosome partition protein Smc	0.00e+00	3.27e-92	2.39e-149	0.6051
1. PBF	Q8TXI4	DNA double-strand break repair Rad50 ATPase	2.42e-09	3.62e-21	2.53e-05	0.4406
1. PBF	Q802R9	Structural maintenance of chromosomes protein 5	1.96e-10	2.44e-24	0.015	0.3234
1. PBF	Q90988	Structural maintenance of chromosomes protein 2	1.41e-13	1.88e-39	2.37e-15	0.3976
1. PBF	P58302	DNA double-strand break repair Rad50 ATPase	2.25e-08	9.94e-29	0.020	0.2945
1. PBF	Q8KBS6	Chromosome partition protein Smc	5.86e-12	1.12e-50	8.47e-41	0.3838
1. PBF	P73340	Chromosome partition protein Smc	2.00e-15	2.35e-45	1.61e-21	0.401
1. PBF	Q8TZY2	Chromosome partition protein Smc	4.44e-16	9.48e-52	2.50e-33	0.4262
1. PBF	A3PMS2	Chromosome partition protein Smc	8.11e-08	8.25e-42	8.35e-39	0.4778
1. PBF	Q69GZ5	Chromosome partition protein Smc	5.39e-08	4.46e-50	4.38e-33	0.4024
1. PBF	P50532	Structural maintenance of chromosomes protein 4	3.10e-10	4.64e-35	2.78e-16	0.3392
1. PBF	E1X022	Chromosome partition protein Smc	5.95e-14	1.94e-45	8.85e-46	0.4136
1. PBF	P51834	Chromosome partition protein Smc	1.57e-14	4.09e-50	6.45e-58	0.3813
1. PBF	Q5R4K5	Structural maintenance of chromosomes protein 3	4.44e-16	4.61e-42	3.95e-18	0.3932
1. PBF	Q96YR5	DNA double-strand break repair Rad50 ATPase	1.73e-07	1.30e-22	0.016	0.3081
1. PBF	Q9HLR8	DNA double-strand break repair Rad50 ATPase	4.14e-08	1.12e-27	0.033	0.287
1. PBF	Q73VM3	Chromosome partition protein Smc	1.25e-12	1.04e-47	4.20e-51	0.4981
1. PBF	O66878	Chromosome partition protein Smc	2.33e-15	1.26e-48	7.13e-28	0.3622
1. PBF	Q5H054	Chromosome partition protein Smc	1.89e-15	1.87e-49	5.06e-51	0.4594
1. PBF	Q9HK21	Chromosome partition protein Smc	9.82e-08	4.62e-46	9.56e-44	0.372
1. PBF	Q7ZAK1	Chromosome partition protein Smc	6.53e-14	5.21e-49	6.50e-18	0.3507
1. PBF	A9II65	Chromosome partition protein Smc	4.55e-15	5.61e-52	3.36e-46	0.4703
1. PBF	P9WGF2	Chromosome partition protein Smc	1.14e-12	2.49e-47	5.23e-46	0.493
1. PBF	B8CW13	Chromosome partition protein Smc	0.00e+00	3.38e-48	1.60e-64	0.432
1. PBF	B8GZ28	Chromosome partition protein Smc	7.33e-11	4.78e-43	2.10e-40	0.4546
1. PBF	P58301	DNA double-strand break repair Rad50 ATPase	1.27e-08	1.30e-21	0.001	0.3906
1. PBF	Q7NG51	Chromosome partition protein Smc	2.22e-16	2.05e-45	4.29e-30	0.3864
1. PBF	Q88WJ9	Chromosome partition protein Smc	1.33e-15	7.18e-55	9.03e-60	0.4454
1. PBF	O93308	Structural maintenance of chromosomes protein 1A	2.31e-11	2.59e-44	8.99e-15	0.3415
1. PBF	Q9ERA5	Structural maintenance of chromosomes protein 4 (Fragment)	8.73e-10	2.04e-37	2.59e-15	0.3583
1. PBF	O29230	DNA double-strand break repair Rad50 ATPase	1.01e-09	4.92e-23	0.001	0.4088
1. PBF	Q3JR19	Chromosome partition protein Smc	4.84e-10	7.62e-53	1.26e-44	0.4178
1. PBF	Q802R8	Structural maintenance of chromosomes protein 6	2.31e-09	1.11e-33	0.036	0.3692
1. PBF	O97593	Structural maintenance of chromosomes protein 1A	1.29e-11	5.85e-44	1.23e-15	0.3358
1. PBF	C4ZJU1	Chromosome partition protein Smc	9.49e-05	3.62e-51	1.27e-43	0.3933
1. PBF	Q1INB1	Chromosome partition protein Smc	1.02e-03	4.22e-28	1.41e-44	0.4118
1. PBF	P75361	Chromosome partition protein Smc	0.00e+00	1.35e-93	1.47e-143	0.5702
1. PBF	Q7UQV4	Chromosome partition protein Smc	3.33e-16	9.47e-45	4.39e-47	0.4567
1. PBF	Q24U48	Chromosome partition protein Smc	1.85e-10	7.82e-47	2.15e-54	0.3703
1. PBF	A9BZW2	Chromosome partition protein Smc	2.03e-14	2.48e-45	1.88e-46	0.5011
2. PF	Q7VL96	Chromosome partition protein MukB	1.84e-04	2.55e-18	NA	0.2006
2. PF	Q1CA55	Chromosome partition protein MukB	6.91e-04	1.10e-20	NA	0.2563
2. PF	B1LJT9	Chromosome partition protein MukB	1.62e-03	2.54e-24	NA	0.2517
2. PF	Q8Z7Z5	Chromosome partition protein MukB	1.53e-03	1.41e-23	NA	0.2688
2. PF	Q6GH60	Nuclease SbcCD subunit C	1.46e-07	6.60e-22	NA	0.2862
2. PF	B7N391	Chromosome partition protein MukB	8.75e-04	7.17e-24	NA	0.2512
2. PF	B7M853	Chromosome partition protein MukB	3.45e-03	3.33e-24	NA	0.2409
2. PF	B1X8M8	Chromosome partition protein MukB	1.94e-04	5.95e-24	NA	0.262
2. PF	O33600	DNA double-strand break repair Rad50 ATPase	5.00e-09	9.43e-21	NA	0.2992
2. PF	P9WM40	Uncharacterized protein MT1315	8.95e-06	2.61e-16	NA	0.232
2. PF	C0PXW1	Chromosome partition protein MukB	4.84e-04	1.36e-23	NA	0.2102
2. PF	Q8TRL1	DNA double-strand break repair Rad50 ATPase	2.99e-07	3.53e-13	NA	0.3063
2. PF	B2JYQ7	Chromosome partition protein MukB	1.17e-03	1.19e-20	NA	0.2529
2. PF	A1A9K1	Chromosome partition protein MukB	3.08e-03	2.76e-24	NA	0.2527
2. PF	B5R8L1	Chromosome partition protein MukB	2.78e-03	2.18e-23	NA	0.2275
2. PF	C5BAC7	Chromosome partition protein MukB	8.68e-04	6.64e-21	NA	0.2487
2. PF	B5YT58	Chromosome partition protein MukB	1.84e-03	3.33e-24	NA	0.2512
2. PF	A8Z219	Nuclease SbcCD subunit C	1.92e-05	1.15e-21	NA	0.2847
2. PF	B7UN10	Chromosome partition protein MukB	3.68e-03	6.07e-24	NA	0.2607
2. PF	O67124	Probable DNA double-strand break repair Rad50 ATPase	2.76e-04	9.25e-21	NA	0.2857
2. PF	B1IW07	Chromosome partition protein MukB	1.83e-03	4.10e-24	NA	0.2465
2. PF	Q6D447	Chromosome partition protein MukB	2.78e-03	2.24e-22	NA	0.2084
2. PF	A7MEV9	Chromosome partition protein MukB	3.53e-04	2.21e-21	NA	0.2589
2. PF	B7LE23	Chromosome partition protein MukB	1.66e-03	3.93e-24	NA	0.2567
2. PF	Q5HG72	Nuclease SbcCD subunit C	8.79e-07	1.15e-21	NA	0.2821
2. PF	A7X203	Nuclease SbcCD subunit C	5.40e-08	1.27e-21	NA	0.2999
2. PF	A6U1G7	Nuclease SbcCD subunit C	1.17e-07	1.27e-21	NA	0.2923
2. PF	B3H108	Chromosome partition protein MukB	5.47e-05	1.88e-15	NA	0.217
2. PF	Q8DAP8	Chromosome partition protein MukB	6.44e-04	6.90e-18	NA	0.198
2. PF	B7MHN3	Chromosome partition protein MukB	1.98e-03	2.76e-24	NA	0.2237
2. PF	Q9UZC8	DNA double-strand break repair Rad50 ATPase	1.71e-08	7.04e-21	NA	0.3937
2. PF	A6QGP8	Nuclease SbcCD subunit C	5.03e-06	1.15e-21	NA	0.2808
2. PF	Q9HWB8	Nuclease SbcCD subunit C	5.70e-05	5.23e-23	NA	0.2654
2. PF	Q8SRK6	DNA repair protein RAD50	9.58e-05	1.47e-23	NA	0.3017
2. PF	B4TDR1	Chromosome partition protein MukB	3.93e-03	1.92e-23	NA	0.2257
2. PF	Q5JHN1	DNA double-strand break repair Rad50 ATPase	2.87e-09	5.91e-21	NA	0.3586
2. PF	Q4L655	Nuclease SbcCD subunit C	2.28e-07	2.28e-19	NA	0.2651
2. PF	B5XY73	Chromosome partition protein MukB	5.81e-04	1.28e-22	NA	0.2567
2. PF	A7FJV2	Chromosome partition protein MukB	1.32e-01	9.43e-21	NA	0.2026
2. PF	O06714	Nuclease SbcCD subunit C	4.78e-03	4.18e-24	NA	0.2864
2. PF	Q97FK1	Nuclease SbcCD subunit C	2.40e-06	1.62e-22	NA	0.276
2. PF	Q2FH88	Nuclease SbcCD subunit C	8.46e-06	8.55e-22	NA	0.2829
2. PF	Q8XDG0	Chromosome partition protein MukB	1.02e-03	3.33e-24	NA	0.262
2. PF	Q8FJA2	Chromosome partition protein MukB	1.73e-04	2.82e-24	NA	0.263
2. PF	B1JQT1	Chromosome partition protein MukB	3.73e-04	8.90e-21	NA	0.2608
2. PF	O08455	Uncharacterized protein YhaN	3.84e-07	2.02e-14	NA	0.287
2. PF	Q1CGI0	Chromosome partition protein MukB	9.93e-04	1.10e-20	NA	0.2586
2. PF	Q935S7	Chromosome partition protein MukB	3.62e-04	2.41e-23	NA	0.2665
2. PF	B2VC99	Chromosome partition protein MukB	4.19e-04	7.07e-19	NA	0.2336
2. PF	Q66CH3	Chromosome partition protein MukB	1.30e-03	1.10e-20	NA	0.2484
2. PF	A5UEK8	Chromosome partition protein MukB	2.95e-04	1.68e-10	NA	0.2056
2. PF	O58687	DNA double-strand break repair Rad50 ATPase	9.41e-10	2.42e-19	NA	0.3552
2. PF	Q9KRC8	Chromosome partition protein MukB	4.09e-03	7.02e-20	NA	0.2093
2. PF	Q7ZAM1	Chromosome partition protein MukB	1.74e-03	8.28e-24	NA	0.2597
2. PF	Q9YFZ1	DNA double-strand break repair Rad50 ATPase	3.37e-08	4.58e-21	NA	0.3099
2. PF	Q6P9I7	Structural maintenance of chromosomes protein 6	8.20e-11	1.01e-24	NA	0.3705
2. PF	Q8ZG99	Chromosome partition protein MukB	4.28e-03	1.10e-20	NA	0.2447
2. PF	C3LN37	Chromosome partition protein MukB	1.01e-03	7.02e-20	NA	0.2073
2. PF	A9MHV9	Chromosome partition protein MukB	2.26e-03	3.27e-23	NA	0.2441
2. PF	Q8PUY4	DNA double-strand break repair Rad50 ATPase	2.01e-06	3.23e-16	NA	0.3684
2. PF	B8F3Q0	Chromosome partition protein MukB	6.19e-05	5.56e-15	NA	0.2126
2. PF	Q9HHM7	Smc-like protein Sph1	1.70e-03	1.40e-06	NA	0.3404
2. PF	Q9X1X1	Probable DNA double-strand break repair Rad50 ATPase	7.94e-09	2.13e-23	NA	0.3254
2. PF	Q1RDT3	Chromosome partition protein MukB	3.08e-04	2.76e-24	NA	0.2541
2. PF	P45187	Chromosome partition protein MukB	2.83e-03	1.05e-11	NA	0.1939
2. PF	Q2NU97	Chromosome partition protein MukB	3.05e-03	4.23e-21	NA	0.2498
2. PF	A4W8U3	Chromosome partition protein MukB	8.16e-04	3.55e-23	NA	0.2886
2. PF	Q99UD0	Nuclease SbcCD subunit C	4.75e-05	1.27e-21	NA	0.2819
2. PF	Q7N6B7	Chromosome partition protein MukB	1.32e-01	1.86e-18	NA	0.2393
2. PF	Q5HPJ3	Nuclease SbcCD subunit C	8.09e-06	5.56e-17	NA	0.2864
2. PF	B7MS42	Chromosome partition protein MukB	3.09e-03	3.06e-24	NA	0.2529
2. PF	B6I8Z6	Chromosome partition protein MukB	1.83e-03	3.93e-24	NA	0.256
2. PF	Q3Z3J7	Chromosome partition protein MukB	2.94e-03	1.64e-24	NA	0.2484
2. PF	Q9KM67	Nuclease SbcCD subunit C	9.82e-07	2.61e-15	NA	0.2805
2. PF	Q93IE8	Chromosome partition protein MukB	1.41e-03	3.81e-17	NA	0.2068
2. PF	A3MZU7	Chromosome partition protein MukB	2.03e-04	4.28e-16	NA	0.2127
2. PF	Q0TJC9	Chromosome partition protein MukB	3.33e-03	3.06e-24	NA	0.2479
2. PF	P64796	Uncharacterized protein Mb1309	7.67e-06	2.61e-16	NA	0.2365
2. PF	B4T158	Chromosome partition protein MukB	2.96e-03	1.85e-23	NA	0.2228
2. PF	B5FQ67	Chromosome partition protein MukB	2.43e-04	1.10e-23	NA	0.2621
2. PF	Q8CPC5	Nuclease SbcCD subunit C	4.71e-07	4.09e-17	NA	0.2741
2. PF	Q31YS6	Chromosome partition protein MukB	2.99e-03	1.64e-24	NA	0.26
2. PF	Q9HRW3	DNA double-strand break repair Rad50 ATPase	1.17e-10	1.22e-23	NA	0.3663
2. PF	A3MWN7	Arcadin-4	3.51e-06	5.36e-17	NA	0.3528
2. PF	A8GCI9	Chromosome partition protein MukB	4.47e-04	2.09e-21	NA	0.2509
2. PF	Q7A5S6	Nuclease SbcCD subunit C	2.24e-07	1.27e-21	NA	0.2937
2. PF	Q97WH0	DNA double-strand break repair Rad50 ATPase	2.86e-09	5.98e-22	NA	0.3044
2. PF	Q0T6B8	Chromosome partition protein MukB	2.32e-03	8.28e-24	NA	0.2694
2. PF	B7NM50	Chromosome partition protein MukB	1.46e-03	4.55e-24	NA	0.2559
2. PF	Q49XE1	Nuclease SbcCD subunit C	1.36e-06	3.88e-19	NA	0.2896
2. PF	B0R9X9	Smc-like protein Sph1	1.17e-05	1.40e-06	NA	0.3321
2. PF	Q2YXX0	Nuclease SbcCD subunit C	3.35e-05	9.64e-22	NA	0.2843
2. PF	Q87QW2	Chromosome partition protein MukB	3.88e-04	4.73e-17	NA	0.1991
2. PF	O26640	DNA double-strand break repair Rad50 ATPase	3.08e-09	3.63e-22	NA	0.3174
2. PF	A5ISM9	Nuclease SbcCD subunit C	5.99e-08	1.27e-21	NA	0.3022
2. PF	Q4QK86	Chromosome partition protein MukB	2.01e-04	4.79e-12	NA	0.1987
2. PF	Q8NWV1	Nuclease SbcCD subunit C	7.26e-08	1.25e-21	NA	0.2909
2. PF	A7ZYM6	Chromosome partition protein MukB	1.68e-03	9.37e-24	NA	0.2623
2. PF	Q7MJ64	Chromosome partition protein MukB	1.07e-04	5.75e-18	NA	0.1972
2. PF	C4ZQ50	Chromosome partition protein MukB	2.41e-03	5.95e-24	NA	0.2487
2. PF	A5F7H8	Chromosome partition protein MukB	2.30e-03	4.49e-21	NA	0.2098
2. PF	P32985	Protein bps2	2.72e-04	1.05e-06	NA	0.4103
2. PF	Q937H2	Chromosome partition protein MukB	2.33e-03	2.21e-21	NA	0.215
2. PF	Q32E44	Chromosome partition protein MukB	2.41e-03	1.88e-23	NA	0.2483
2. PF	B0BUD9	Chromosome partition protein MukB	6.64e-05	5.01e-16	NA	0.1939
2. PF	A9N7T7	Chromosome partition protein MukB	1.54e-03	2.18e-23	NA	0.2652
2. PF	B4TRV6	Chromosome partition protein MukB	4.09e-04	2.56e-23	NA	0.2579
2. PF	Q65TL9	Chromosome partition protein MukB	1.45e-04	2.14e-17	NA	0.2007
2. PF	B7LN86	Chromosome partition protein MukB	2.43e-03	5.15e-24	NA	0.2659
2. PF	B2TUF5	Chromosome partition protein MukB	3.93e-03	9.92e-25	NA	0.252
2. PF	Q9CFZ0	Nuclease SbcCD subunit C	1.25e-06	3.99e-21	NA	0.2775
2. PF	O07116	Smc-like protein Sph1	7.03e-06	1.12e-06	NA	0.3227
2. PF	C6DFB1	Chromosome partition protein MukB	2.21e-04	1.30e-22	NA	0.2004
2. PF	A9R7J9	Chromosome partition protein MukB	2.65e-03	1.10e-20	NA	0.2491
2. PF	B5F1S6	Chromosome partition protein MukB	2.03e-03	2.22e-23	NA	0.2493
2. PF	A1JMM2	Chromosome partition protein MukB	1.01e-03	1.78e-21	NA	0.2451
2. PF	O83635	Nuclease SbcCD subunit C	1.04e-07	1.28e-17	NA	0.2772
2. PF	Q6G9L2	Nuclease SbcCD subunit C	1.66e-07	1.30e-21	NA	0.3023
2. PF	Q5PGG1	Chromosome partition protein MukB	3.90e-04	3.63e-23	NA	0.2494
2. PF	B0R9L6	Smc-like protein Sph2	5.53e-05	6.81e-05	NA	0.3092
2. PF	A8AIF5	Chromosome partition protein MukB	1.76e-03	2.80e-22	NA	0.2716
2. PF	Q9CN36	Chromosome partition protein MukB	2.27e-04	6.32e-19	NA	0.2452
2. PF	A7ZK14	Chromosome partition protein MukB	3.43e-04	3.93e-24	NA	0.2034
2. PF	B5BBN4	Chromosome partition protein MukB	1.39e-03	3.63e-23	NA	0.2221
2. PF	B5QZC8	Chromosome partition protein MukB	1.41e-03	1.85e-23	NA	0.2003
2. PF	A4TN03	Chromosome partition protein MukB	3.91e-04	1.10e-20	NA	0.2512
2. PF	O68032	Nuclease SbcCD subunit C	6.50e-05	2.88e-24	NA	0.281
2. PF	A6T716	Chromosome partition protein MukB	1.61e-03	6.54e-23	NA	0.2332
4. PB	O95347	Structural maintenance of chromosomes protein 2	1.67e-15	1.61e-46	3.02e-17	NA
4. PB	Q9NTJ3	Structural maintenance of chromosomes protein 4	1.02e-09	8.61e-33	4.96e-15	NA
4. PB	P38989	Structural maintenance of chromosomes protein 2	4.25e-12	4.25e-46	7.66e-16	NA
4. PB	O01789	Structural maintenance of chromosomes protein 1	9.34e-10	5.85e-42	5.93e-13	NA
4. PB	Q58718	DNA double-strand break repair Rad50 ATPase	1.53e-08	3.06e-24	6.69e-07	NA
4. PB	Q59037	Chromosome partition protein Smc	5.27e-12	1.00e-44	4.99e-27	NA
4. PB	Q9RT44	Nuclease SbcCD subunit C	NA	7.24e-23	3.56e-04	NA
4. PB	Q924W5	Structural maintenance of chromosomes protein 6	3.34e-11	4.53e-35	0.022	NA
4. PB	Q56YN8	Structural maintenance of chromosomes protein 3	2.00e-15	3.84e-45	1.73e-14	NA
4. PB	Q8IY18	Structural maintenance of chromosomes protein 5	5.79e-12	2.72e-23	0.004	NA
4. PB	Q8CG46	Structural maintenance of chromosomes protein 5	2.51e-12	3.22e-22	0.005	NA
4. PB	P97690	Structural maintenance of chromosomes protein 3	1.66e-13	5.64e-45	5.68e-18	NA
4. PB	P41004	Structural maintenance of chromosomes protein 4	3.98e-10	9.61e-23	2.76e-13	NA
4. PB	Q9LFS8	Structural maintenance of chromosomes protein 5	5.99e-09	1.36e-23	3.16e-04	NA
4. PB	P41003	Structural maintenance of chromosomes protein 2	2.80e-11	2.92e-40	8.41e-25	NA
4. PB	Q9FJL0	Structural maintenance of chromosomes protein 4	5.85e-10	1.08e-40	1.69e-17	NA
4. PB	Q9UQE7	Structural maintenance of chromosomes protein 3	9.66e-14	4.61e-42	3.95e-18	NA
4. PB	Q9CW03	Structural maintenance of chromosomes protein 3	4.76e-13	1.07e-41	6.20e-18	NA
4. PB	Q9Z1M9	Structural maintenance of chromosomes protein 1A	6.46e-11	4.34e-44	1.20e-15	NA
4. PB	Q14683	Structural maintenance of chromosomes protein 1A	1.05e-10	4.11e-44	1.32e-15	NA
4. PB	Q54CS9	DNA repair protein RAD50	5.49e-05	5.28e-16	0.011	NA
4. PB	B2FDA8	Structural maintenance of chromosomes protein 3	1.34e-12	1.97e-41	3.53e-14	NA
4. PB	O94383	Structural maintenance of chromosomes protein 1	5.79e-10	7.14e-41	1.74e-16	NA
4. PB	P53692	Structural maintenance of chromosomes protein 6	1.27e-10	6.60e-24	0.001	NA
4. PB	Q20060	Structural maintenance of chromosomes protein 4	4.12e-05	5.97e-19	6.72e-19	NA
4. PB	O42649	Structural maintenance of chromosomes protein 3	1.05e-12	1.55e-55	8.09e-23	NA
4. PB	Q08204	Structural maintenance of chromosomes protein 5	2.94e-04	2.08e-25	2.31e-04	NA
4. PB	Q09591	Mitotic chromosome and X-chromosome-associated protein mix-1	9.11e-13	6.12e-45	1.70e-17	NA
4. PB	Q96SB8	Structural maintenance of chromosomes protein 6	6.80e-11	1.09e-35	0.016	NA
4. PB	Q12267	Structural maintenance of chromosomes protein 4	2.92e-08	3.73e-20	3.40e-20	NA
4. PB	Q8CG47	Structural maintenance of chromosomes protein 4	1.92e-09	1.29e-32	1.52e-14	NA
4. PB	Q552D9	Structural maintenance of chromosomes protein 3	5.98e-14	2.28e-15	4.73e-15	NA
4. PB	Q8IED2	Structural maintenance of chromosomes protein 2	1.81e-11	4.18e-51	9.32e-21	NA
4. PB	Q9CU62	Structural maintenance of chromosomes protein 1A	9.14e-11	4.71e-44	1.13e-15	NA
4. PB	P47037	Structural maintenance of chromosomes protein 3	4.88e-15	1.15e-53	1.16e-11	NA
4. PB	P48996	Chromosome condensation protein dpy-27	7.20e-07	8.83e-20	1.53e-10	NA
4. PB	Q920F6	Structural maintenance of chromosomes protein 1B	7.01e-12	1.36e-41	1.08e-15	NA
4. PB	O97594	Structural maintenance of chromosomes protein 3	NA	2.70e-41	3.11e-18	NA
4. PB	Q8NDV3	Structural maintenance of chromosomes protein 1B	3.44e-11	6.10e-41	2.69e-15	NA
4. PB	Q9C5Y4	Structural maintenance of chromosomes protein 2-1	2.79e-14	5.17e-40	4.19e-27	NA
4. PB	P9WGF3	Chromosome partition protein Smc	8.72e-13	2.49e-47	5.23e-46	NA
4. PB	P32908	Structural maintenance of chromosomes protein 1	7.59e-14	5.92e-43	1.14e-19	NA
4. PB	Q6Q1P4	Structural maintenance of chromosomes protein 1	7.42e-12	2.35e-47	2.03e-13	NA
4. PB	O13710	Structural maintenance of chromosomes protein 5	8.55e-12	8.22e-22	2.39e-05	NA
4. PB	Q54LV0	Structural maintenance of chromosomes protein 4	1.26e-09	4.86e-19	4.25e-19	NA
4. PB	Q8I1U7	Structural maintenance of chromosomes protein 3 homolog	7.77e-15	4.54e-40	5.21e-11	NA
4. PB	Q8CG48	Structural maintenance of chromosomes protein 2	7.33e-15	2.55e-48	8.74e-17	NA
4. PB	Q54PK4	Structural maintenance of chromosomes protein 2	6.79e-12	5.70e-42	1.11e-11	NA
4. PB	Q9SN90	Structural maintenance of chromosomes protein 2-2	3.04e-12	1.24e-40	8.94e-27	NA
4. PB	Q18237	Structural maintenance of chromosomes protein 5	4.73e-08	3.13e-27	0.017	NA
5. P	P22523	Chromosome partition protein MukB	2.85e-03	5.95e-24	NA	NA
5. P	Q54I56	Structural maintenance of chromosomes protein 6	5.05e-08	3.63e-09	NA	NA
5. P	Q805A1	Structural maintenance of chromosomes protein 5	NA	2.09e-21	NA	NA
5. P	Q9FII7	Structural maintenance of chromosomes protein 6B	3.02e-09	2.61e-34	NA	NA
5. P	Q12749	Structural maintenance of chromosomes protein 6	8.49e-09	1.57e-23	NA	NA
5. P	Q8XNI5	UvrABC system protein A	3.25e-01	1.36e-02	NA	NA
5. P	Q9FLR5	Structural maintenance of chromosomes protein 6A	6.37e-09	2.87e-34	NA	NA
5. P	Q9UTJ8	DNA repair protein rad50	4.52e-04	1.00e-20	NA	NA
5. P	Q2YPX5	UvrABC system protein A	1.79e-01	4.01e-02	NA	NA
5. P	Q196W6	Uncharacterized protein 094L	NA	3.69e-24	NA	NA
5. P	P70388	DNA repair protein RAD50	5.05e-04	2.06e-17	NA	NA
5. P	O44199	DNA repair protein rad-50	2.92e-05	1.26e-18	NA	NA
5. P	Q8YHC4	UvrABC system protein A	1.69e-01	2.69e-02	NA	NA
5. P	P9WM41	Uncharacterized protein Rv1278	1.36e-05	2.61e-16	NA	NA
5. P	Q9SL02	DNA repair protein RAD50	6.75e-05	5.24e-18	NA	NA
5. P	Q2FYT3	Nuclease SbcCD subunit C	5.69e-07	3.99e-21	NA	NA
5. P	P0C0Z2	UvrABC system protein A	1.61e-01	4.01e-02	NA	NA
5. P	Q91G49	Uncharacterized protein 050L	NA	1.64e-15	NA	NA
5. P	Q9K6Y0	UvrABC system protein A	4.78e-01	1.89e-02	NA	NA
5. P	P47661	Uncharacterized protein MG422	9.13e-03	1.68e-04	NA	NA
5. P	Q8ENJ6	UvrABC system protein A	4.90e-01	5.46e-03	NA	NA
5. P	Q92878	DNA repair protein RAD50	2.26e-04	1.28e-17	NA	NA
5. P	O25943	DNA repair protein RecN	6.28e-04	7.88e-03	NA	NA
5. P	Q8G0I9	UvrABC system protein A	2.80e-01	2.48e-02	NA	NA
5. P	P11109	Probable exonuclease subunit 2	NA	1.41e-09	NA	NA
5. P	Q9W252	DNA repair protein RAD50	2.05e-04	1.01e-17	NA	NA
5. P	Q9ZJ80	DNA repair protein RecN	2.51e-04	1.85e-02	NA	NA
5. P	Q9HHY2	Smc-like protein Sph2	2.75e-05	6.81e-05	NA	NA
5. P	G5EG17	Structural maintenance of chromosomes protein 6 homolog smc-6	2.47e-07	3.93e-31	NA	NA
5. P	Q7MHB5	UvrABC system protein A	2.87e-01	4.18e-02	NA	NA
5. P	Q8CPY9	UvrABC system protein A	5.33e-01	4.56e-02	NA	NA
5. P	Q8DCJ3	UvrABC system protein A	3.54e-01	3.26e-02	NA	NA
5. P	P13458	Nuclease SbcCD subunit C	7.53e-07	4.23e-21	NA	NA
5. P	P12753	DNA repair protein RAD50	5.42e-02	2.19e-16	NA	NA
5. P	Q9JIL8	DNA repair protein RAD50	1.52e-04	6.53e-17	NA	NA
5. P	Q9KUW5	UvrABC system protein A	3.92e-01	2.67e-02	NA	NA
6. F	Q9RVE0	DNA replication and repair protein RecF	4.45e-03	NA	NA	0.4453
6. F	Q9KHU6	DNA replication and repair protein RecF	5.09e-03	NA	NA	0.4334
6. F	P44496	DNA repair protein RecN	1.20e-04	NA	NA	0.419
6. F	B0BVU8	DNA replication and repair protein RecF	1.29e-03	NA	NA	0.4967
6. F	Q4UNG8	DNA replication and repair protein RecF	1.53e-03	NA	NA	0.49
6. F	Q68XI5	DNA repair protein RecN	4.07e-04	NA	NA	0.4435
6. F	Q87BS5	DNA repair protein RecN	2.65e-04	NA	NA	0.4125
6. F	Q9ZEB6	DNA replication and repair protein RecF	1.76e-03	NA	NA	0.4936
6. F	Q2SQZ4	DNA replication and repair protein RecF	1.39e-03	NA	NA	0.5239
6. F	O66834	DNA repair protein RecN	8.03e-04	NA	NA	0.4128
6. F	Q65VB6	DNA replication and repair protein RecF	2.81e-02	NA	NA	0.4525
6. F	B0JM53	DNA replication and repair protein RecF	2.21e-03	NA	NA	0.4691
6. F	Q1RKJ9	DNA replication and repair protein RecF	2.19e-03	NA	NA	0.482
6. F	Q9PB02	DNA repair protein RecN	2.10e-04	NA	NA	0.4082
6. F	Q48AS5	DNA replication and repair protein RecF	2.75e-03	NA	NA	0.4798
6. F	P9WHI6	DNA repair protein RecN	1.23e-03	NA	NA	0.3924
6. F	A1TWJ3	DNA replication and repair protein RecF	5.81e-03	NA	NA	0.4936
6. F	A8F0D4	DNA replication and repair protein RecF	1.95e-03	NA	NA	0.4857
6. F	A8EX95	DNA replication and repair protein RecF	2.85e-03	NA	NA	0.4879
6. F	Q9WXF2	DNA repair protein RecN	6.58e-04	NA	NA	0.4375
6. F	Q9PHM5	DNA repair protein RecN	6.43e-04	NA	NA	0.4134
6. F	A6VK88	DNA replication and repair protein RecF	1.48e-03	NA	NA	0.5438
6. F	C4K0P8	DNA replication and repair protein RecF	1.60e-03	NA	NA	0.4954
6. F	B0UUM0	DNA replication and repair protein RecF	1.57e-03	NA	NA	0.4636
6. F	Q9ZDY2	DNA repair protein RecN	2.67e-04	NA	NA	0.4381
6. F	O83456	DNA repair protein RecN	1.67e-04	NA	NA	0.4014
6. F	Q45598	Uncharacterized protein YydD	4.99e-04	NA	NA	0.3493
6. F	Q92J40	DNA repair protein RecN	3.78e-04	NA	NA	0.4408
6. F	Q1RHI2	DNA repair protein RecN	4.14e-04	NA	NA	0.4414
6. F	P74374	DNA repair protein RecN	4.09e-04	NA	NA	0.4597
6. F	P17894	DNA repair protein RecN	2.65e-04	NA	NA	0.4061
6. F	Q1IXW9	DNA replication and repair protein RecF	4.03e-03	NA	NA	0.4421
6. F	A8GQG2	DNA replication and repair protein RecF	1.58e-03	NA	NA	0.4828
6. F	A8GUF0	DNA replication and repair protein RecF	2.21e-03	NA	NA	0.4816
6. F	C3PM56	DNA replication and repair protein RecF	1.25e-03	NA	NA	0.4856
6. F	Q92JN5	DNA replication and repair protein RecF	1.58e-03	NA	NA	0.4887
6. F	Q9CLQ6	DNA replication and repair protein RecF	1.75e-03	NA	NA	0.5639
6. F	P0C6Q4	DNA repair protein RecN	9.35e-04	NA	NA	0.4863
6. F	Q8DG79	DNA replication and repair protein RecF	1.51e-03	NA	NA	0.4365
7. B	P24043	Laminin subunit alpha-2	NA	NA	0.024	NA
7. B	Q9M0G9	ABC transporter B family member 24, mitochondrial	1.17e-02	NA	0.022	NA
7. B	A6H141	DNA replication and repair protein RecF	3.63e-03	NA	0.023	NA
7. B	Q5HVF4	Phosphate import ATP-binding protein PstB	2.07e-01	NA	0.023	NA
7. B	Q2YQ73	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	9.32e-03	NA	0.022	NA
7. B	Q21313	Laminin-like protein epi-1	NA	NA	0.002	NA
7. B	Q9PHQ1	Phosphate import ATP-binding protein PstB	2.07e-01	NA	0.022	NA
7. B	P9WQK8	Phosphate import ATP-binding protein PstB 2	2.53e-01	NA	0.037	NA
7. B	P0C529	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	7.97e-03	NA	0.022	NA
7. B	Q8G0T8	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.93e-02	NA	0.033	NA
7. B	C5BUP6	DNA replication and repair protein RecF	3.74e-03	NA	0.046	NA
7. B	P9WQK9	Phosphate import ATP-binding protein PstB 2	2.53e-01	NA	0.037	NA
7. B	Q8YH20	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.15e-02	NA	0.021	NA
7. B	Q54RU1	ABC transporter B family member 6	6.55e-03	NA	0.020	NA
7. B	Q7U0Z9	Phosphate import ATP-binding protein PstB 2	2.54e-01	NA	0.037	NA
7. B	Q0P9C4	Protein glycosylation K	1.70e-03	NA	0.013	NA
7. B	P15016	Uncharacterized protein in ATPase CF(0) subunits 3'region (Fragment)	3.58e-07	NA	9.89e-36	NA
7. B	P05824	DNA repair protein RecN	1.56e-04	NA	0.020	NA