Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54780.1
JCVISYN3A_0416
Uncharacterized protein.
M. mycoides homolog: Q6MTD1.
TIGRfam Classification: 1=Unknown.
Category: Quasiessential.
Statistics
Total GO Annotation: 37
Unique PROST Go: 37
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 46
Unique PROST Homologs: 46
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
O33348
(Toxin RelG) with a FATCAT P-Value: 0.000168 and RMSD of 3.02 angstrom. The sequence alignment identity is 19.0%.
Structural alignment shown in left. Query protein AVX54780.1 colored as red in alignment, homolog O33348 colored as blue.
Query protein AVX54780.1 is also shown in right top, homolog O33348 showed in right bottom. They are colored based on secondary structures.
AVX54780.1 MNKNKKILSNNSKISTSPKLFKKDIFFKIAIVHKLDNGFDFKSLTIEGIKEFHNFINEILNKKMTISQVENLYMRKTSNPFNNRTVDQQIEIREIHLG-- 98 O33348 -------MPYTVRFTTT---ARRD-------LHKLP-----PRI-LAAVVEFA-F-GD-LSR-------EPLRVGK---PL--R--------REL-AGTF 53 AVX54780.1 -KNRQPFRLFGYFNDDNY--FVLTKIDPNHN---FHE 129 O33348 SARRGTYRLL-YRIDDEHTTVVILRVD--HRADIYRR 87
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:0006379 | mRNA cleavage |
| 5. P | GO:0003677 | DNA binding |
| 5. P | GO:0003723 | RNA binding |
| 5. P | GO:0051290 | protein heterotetramerization |
| 5. P | GO:0046677 | response to antibiotic |
| 5. P | GO:0001217 | DNA-binding transcription repressor activity |
| 5. P | GO:2000582 | obsolete positive regulation of microtubule motor activity, plus-end-directed |
| 5. P | GO:0004521 | endoribonuclease activity |
| 5. P | GO:0016892 | endoribonuclease activity, producing 3'-phosphomonoesters |
| 5. P | GO:0098795 | mRNA destabilization-mediated gene silencing |
| 5. P | GO:0045892 | negative regulation of transcription, DNA-templated |
| 5. P | GO:0045947 | negative regulation of translational initiation |
| 5. P | GO:2000145 | regulation of cell motility |
| 5. P | GO:0044010 | single-species biofilm formation |
| 5. P | GO:0003777 | microtubule motor activity |
| 5. P | GO:0017148 | negative regulation of translation |
| 5. P | GO:0005929 | cilium |
| 5. P | GO:0090502 | RNA phosphodiester bond hydrolysis, endonucleolytic |
| 5. P | GO:0032993 | protein-DNA complex |
| 5. P | GO:0030371 | translation repressor activity |
| 5. P | GO:0005874 | microtubule |
| 5. P | GO:0043024 | ribosomal small subunit binding |
| 5. P | GO:0042802 | identical protein binding |
| 5. P | GO:0006401 | RNA catabolic process |
| 5. P | GO:0043488 | regulation of mRNA stability |
| 5. P | GO:0051959 | dynein light intermediate chain binding |
| 5. P | GO:0045505 | dynein intermediate chain binding |
| 5. P | GO:0034198 | cellular response to amino acid starvation |
| 5. P | GO:0006402 | mRNA catabolic process |
| 5. P | GO:0043022 | ribosome binding |
| 5. P | GO:0030286 | dynein complex |
| 5. P | GO:0006415 | translational termination |
| 5. P | GO:0008219 | cell death |
| 5. P | GO:0004519 | endonuclease activity |
| 5. P | GO:0007017 | microtubule-based process |
| 5. P | GO:0045926 | negative regulation of growth |
| 5. P | GO:1903507 | negative regulation of nucleic acid-templated transcription |
Uniprot GO Annotations
| GO | Description |
|---|
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | P9WHG6 | Toxin ParE1 | 1.55e-02 | 2.13e-06 | NA | NA |
| 5. P | Q60374 | Putative toxin RelE1 | 9.01e-04 | 1.57e-08 | NA | NA |
| 5. P | O53468 | Putative toxin HigB2 | 2.13e-03 | 6.72e-03 | NA | NA |
| 5. P | P0C078 | mRNA interferase RelE | 2.30e-04 | 6.94e-05 | NA | NA |
| 5. P | Q47149 | mRNA interferase toxin YafQ | 3.62e-02 | 1.06e-09 | NA | NA |
| 5. P | P55534 | Putative toxin Y4kP | 7.22e-04 | 8.49e-10 | NA | NA |
| 5. P | Q9A4F4 | Toxin RelE3 | 1.80e-02 | 1.02e-07 | NA | NA |
| 5. P | Q58503 | Toxin RelE3 | 1.88e-04 | 7.25e-08 | NA | NA |
| 5. P | O50461 | Toxin RelE | 7.55e-04 | 7.30e-05 | NA | NA |
| 5. P | A0A140NAP5 | mRNA interferase toxin YafQ | 3.76e-02 | 1.24e-09 | NA | NA |
| 5. P | P0CJ64 | Toxin YoeB | 1.82e-03 | 1.11e-09 | NA | NA |
| 5. P | Q8FG53 | Toxin YoeB | 2.56e-03 | 6.19e-09 | NA | NA |
| 5. P | O33348 | Toxin RelG | 1.68e-04 | 1.17e-03 | NA | NA |
| 5. P | A4F4L4 | Dynein axonemal light chain 4 | 1.02e-01 | 3.66e-02 | NA | NA |
| 5. P | Q9PRB3 | Uncharacterized protein UU032 | 1.30e-03 | 3.50e-21 | NA | NA |
| 5. P | P9WHG7 | Toxin ParE1 | 1.46e-02 | 2.13e-06 | NA | NA |
| 5. P | P9WHG4 | Toxin ParE2 | 2.46e-03 | 9.96e-03 | NA | NA |
| 5. P | Q9A3S1 | Toxin RelE4 | 7.19e-02 | 7.74e-18 | NA | NA |
| 5. P | P9WF08 | Toxin RelK | 4.48e-03 | 3.03e-09 | NA | NA |
| 5. P | Q9AA09 | Toxin RelE1 | 4.97e-02 | 3.45e-08 | NA | NA |
| 5. P | Q9A459 | Toxin ParE4 | 2.48e-03 | 3.84e-09 | NA | NA |
| 5. P | Q46865 | mRNA interferase toxin MqsR | 9.45e-02 | 5.16e-05 | NA | NA |
| 5. P | P69349 | Toxin YoeB | 2.84e-03 | 1.23e-08 | NA | NA |
| 5. P | Q9DCM4 | Dynein axonemal light chain 4 | 1.02e-01 | 1.26e-02 | NA | NA |
| 5. P | P44041 | Putative toxin YafQ | 3.82e-02 | 1.21e-10 | NA | NA |
| 5. P | P0C077 | mRNA interferase toxin RelE | 2.78e-04 | 6.94e-05 | NA | NA |
| 5. P | Q9KMG5 | Toxin HigB-1 | 2.19e-03 | 1.19e-20 | NA | NA |
| 5. P | Q8PU08 | Uncharacterized protein MM_2549 | 3.13e-03 | 1.21e-06 | NA | NA |
| 5. P | Q58573 | Putative toxin RelE4 | 3.16e-03 | 1.85e-05 | NA | NA |
| 5. P | Q32KN5 | Dynein axonemal light chain 4 | 1.04e-01 | 3.66e-02 | NA | NA |
| 5. P | P9WF09 | Toxin RelK | 4.53e-03 | 3.03e-09 | NA | NA |
| 5. P | Q97ZJ9 | DNA-directed RNA polymerase subunit Rpo6 | 2.41e-01 | 2.12e-02 | NA | NA |
| 5. P | Q8FEM8 | mRNA interferase HigB | 1.25e-03 | 2.64e-02 | NA | NA |
| 5. P | O96015 | Dynein axonemal light chain 4 | 1.03e-01 | 3.66e-02 | NA | NA |
| 5. P | P9WHG5 | Toxin ParE2 | 2.27e-02 | 9.96e-03 | NA | NA |
| 5. P | Q9A9T8 | Toxin ParE1 | 4.00e-03 | 4.00e-08 | NA | NA |
| 5. P | Q7A225 | Endoribonuclease HigB | 2.84e-03 | 3.54e-14 | NA | NA |
| 5. P | Q9A5D7 | Toxin RelE2 | 2.04e-03 | 5.69e-09 | NA | NA |
| 5. P | B5ZBT1 | Urease subunit gamma | 1.13e-01 | 3.69e-02 | NA | NA |
| 5. P | P64529 | Toxin YoeB | 4.56e-03 | 3.03e-09 | NA | NA |
| 5. P | Q9A4S4 | Toxin ParE3 | 3.22e-03 | 5.17e-07 | NA | NA |
| 5. P | P44138 | Uncharacterized protein HI_1250 | 1.76e-03 | 3.98e-19 | NA | NA |
| 5. P | Q9Z4V8 | Toxin YoeB | 2.63e-03 | 2.35e-06 | NA | NA |
| 5. P | Q60228 | Putative RelE-like toxin protein | 4.49e-04 | 2.11e-04 | NA | NA |
| 5. P | Q58319 | Putative toxin RelE2 | 3.71e-04 | 8.18e-10 | NA | NA |
| 5. P | P69348 | Toxin YoeB | 2.67e-03 | 1.23e-08 | NA | NA |