Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54783.1
JCVISYN3A_0420

Fatty acid kinase subunit A.
M. mycoides homolog: Q6MTC7.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 24
Unique PROST Go: 10
Unique BLAST Go: 0
Unique Foldseek Go: 12

Total Homologs: 32
Unique PROST Homologs: 4
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 12

Literature

Danchin and Fang [1]: kinase of unknown substrates|conserved as a whole, may be a protein kinase acting on DnaK or other essential component
Yang and Tsui [2]: Dihydroxyacetone-related kinase DhaK
Antczak et al. [3]: Dihydroxyacetone kinase, dhaL-like
Zhang et al. [4]: GO:0019563|glycerol catabolic process
Bianchi et al. [5]: Fatty Acid Kinase (fakA-like)

Structures and Sequence Alignment

The best structural homolog that predicted by 6. F was P45620 (Putative kinase MCAP_0235) with a FATCAT P-Value: 7.24e-11 and RMSD of 2.49 angstrom. The sequence alignment identity is 10.1%.
Structural alignment shown in left. Query protein AVX54783.1 colored as red in alignment, homolog P45620 colored as blue. Query protein AVX54783.1 is also shown in right top, homolog P45620 showed in right bottom. They are colored based on secondary structures. 

  AVX54783.1 -------MKKLELLKNMITSGVNNLYNHYPQIDKLNVFPVPDGDTGTNMNLTATNGYNEVI-DVE---YESIGKFLSAFSR-GLIM----GARGNSGVIF 84
      P45620 MSLNVDNVKEV-LVK--IAEVVNE--NK-EELSQLDA-AIGDGDHGHNM----SRGFLKVVEELKNNSYDDIG---SIFKKVGMVLVSNVG--GASGPLY 84

  AVX54783.1 -SQIIKGLSLGMNNAKELSVSEWKSGFSKASEIAYKAV--MKPVEG-------TILTVIRETSEKVSQLADDIDIKDF--WKQVVK---N-----ANQSL 164
      P45620 GTAFLKAATF-VNNKKEIDIND----FSVC---LQQAVDGIK-IRGKANVGDKTMLDVLQPVS--------DL-IKDLINQKYLAKEILNKAVELAFQKV 166

  AVX54783.1 ENTPNLL------PLL--KEVGVVDSGGYG---LVKFL-EGIEYYVLNDQIVNKLDKLEVNNGGNVDMQIEEEFGYCTEAIVMLNDDWINKLQNSVIRDQ 252
      P45620 EFTKEIVAKKGRASYLGQRSIGYKDPGAYSSYLILKCISENI---------------------------------------------------------- 208

  AVX54783.1 LQIFGNTSIVVVVDNDILKVHTHSLSPGQVLQFLQQYGDFQTLKIENMNLQANKQVKNKDQKWKENSDIKTERKLINETAIISVVSSEKQKRYFEDELGI 352
      P45620 ---------------------------------------------------------------------------------------------------- 208

  AVX54783.1 AFAINAGAKMNPSTEDFLQAIETVDAKTVFLLPNSSNVYLTAKQAEKIENKSKIYVIQTKTIQQGMVAALSFDPSLTASKNYSYLSKSFRNVVSFNITKA 452
      P45620 ---------------------------------------------------------------------------------------------------- 208

  AVX54783.1 EKNTTYNGIEIQKDNLLAIVDNNIIGAEQTLEAIFDKQLSKYIKSKTEIITIFVGGETNEQDLVQLRKFLDEGYDVEYEIFDGGQETYNLLIAIE 547
      P45620 ----------------------------------------------------------------------------------------------- 208

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0006071 glycerol metabolic process
1. PBF GO:0004371 glycerone kinase activity
5. P GO:0047112 pyruvate oxidase activity
5. P GO:0019310 inositol catabolic process
5. P GO:0009097 isoleucine biosynthetic process
5. P GO:0009099 valine biosynthetic process
5. P GO:0030976 thiamine pyrophosphate binding
5. P GO:0050660 flavin adenine dinucleotide binding
5. P GO:0102481 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase activity
5. P GO:0005948 acetolactate synthase complex
5. P GO:0000287 magnesium ion binding
5. P GO:0003984 acetolactate synthase activity
6. F GO:0039534 negative regulation of MDA-5 signaling pathway
6. F GO:0009758 carbohydrate utilization
6. F GO:0034012 FAD-AMP lyase (cyclizing) activity
6. F GO:0050354 triokinase activity
6. F GO:0019200 carbohydrate kinase activity
6. F GO:0019563 glycerol catabolic process
6. F GO:0005524 ATP binding
6. F GO:0019588 anaerobic glycerol catabolic process
6. F GO:0016052 carbohydrate catabolic process
6. F GO:0030246 carbohydrate binding
6. F GO:0047324 phosphoenolpyruvate-glycerone phosphotransferase activity
6. F GO:0071322 cellular response to carbohydrate stimulus

Uniprot GO Annotations

GO Description
GO:0006071 glycerol metabolic process
GO:0004371 glycerone kinase activity
GO:0016310 phosphorylation
GO:0016301 kinase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF O34751 Uncharacterized protein YloV 0.00e+00 5.95e-65 8.64e-117 0.4184
1. PBF Q5HGK7 Uncharacterized protein SACOL1240 0.00e+00 3.97e-66 8.28e-108 0.4202
1. PBF Q6GHK9 Uncharacterized protein SAR1202 0.00e+00 8.42e-67 3.26e-108 0.4235
1. PBF P75231 Uncharacterized protein MG369 homolog 0.00e+00 1.08e-60 4.06e-75 0.4963
1. PBF Q8NX12 Uncharacterized protein MW1109 0.00e+00 3.12e-66 2.53e-107 0.4209
1. PBF Q2FHL2 Uncharacterized protein SAUSA300_1119 0.00e+00 3.97e-66 8.28e-108 0.4169
1. PBF Q6G9Y7 Uncharacterized protein SAS1160 0.00e+00 3.97e-66 8.28e-108 0.4237
1. PBF Q7A5Z4 Uncharacterized protein SA1069 0.00e+00 3.97e-66 8.28e-108 0.4211
1. PBF Q49X07 Uncharacterized protein SSP1546 0.00e+00 1.48e-66 2.12e-107 0.4222
1. PBF Q4L5S7 Uncharacterized protein SH1689 0.00e+00 2.54e-68 2.35e-104 0.4343
1. PBF P47609 Uncharacterized protein MG369 0.00e+00 6.53e-56 3.55e-77 0.5016
1. PBF Q8CSV4 Uncharacterized protein SE_0901 0.00e+00 5.79e-67 6.83e-107 0.4102
1. PBF Q99UP2 Uncharacterized protein SAV1226 0.00e+00 3.97e-66 8.28e-108 0.4171
1. PBF Q2YXJ0 Uncharacterized protein SAB1090 0.00e+00 1.01e-64 7.31e-107 0.4133
1. PBF Q5HPW5 Uncharacterized protein SERP0792 0.00e+00 2.14e-67 9.05e-106 0.4197
4. PB Q2FZ58 Uncharacterized protein SAOUHSC_01193 0.00e+00 3.97e-66 8.28e-108 NA
5. P Q58077 Uncharacterized protein MJ0663 2.20e-01 3.37e-02 NA NA
5. P Q54970 Pyruvate oxidase 3.76e-01 1.16e-02 NA NA
5. P P42415 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 2.62e-01 4.89e-02 NA NA
5. P P37063 Pyruvate oxidase 2.98e-01 7.93e-03 NA NA
6. F P45620 Putative kinase MCAP_0235 7.24e-11 NA NA 0.8421
6. F Q927E5 PEP-dependent dihydroxyacetone kinase 1, ADP-binding subunit DhaL 5.45e-09 NA NA 0.7337
6. F O04059 Putative 3,4-dihydroxy-2-butanone kinase 1.65e-07 NA NA 0.804
6. F A0QXE4 D-erythrulose kinase 1.56e-07 NA NA 0.8125
6. F O60017 Dihydroxyacetone kinase 8.54e-06 NA NA 0.7158
6. F A0R758 L-erythrulose 1-kinase 1.09e-06 NA NA 0.7639
6. F Q6D8V6 L-erythrulose kinase 1.31e-07 NA NA 0.8138
6. F O74192 Dihydroxyacetone kinase 5.89e-06 NA NA 0.6621
6. F Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL 7.45e-09 NA NA 0.74
6. F P45510 Dihydroxyacetone kinase 1.34e-05 NA NA 0.6877
6. F F1RKQ4 Triokinase/FMN cyclase 6.50e-07 NA NA 0.8003
6. F Q92EU3 PEP-dependent dihydroxyacetone kinase 2, ADP-binding subunit DhaL 2.66e-10 NA NA 0.8136