Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54787.1
JCVISYN3A_0425

Phosphate ABC transporter substrate-binding protein.
M. mycoides homolog: Q6MTC3.
TIGRfam Classification: 4=Probable.
Category: Essential.

Statistics

Total GO Annotation: 117
Unique PROST Go: 58
Unique BLAST Go: 0
Unique Foldseek Go: 22

Total Homologs: 488
Unique PROST Homologs: 164
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 212

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: pstS; phosphate ABC transporter substrate-binding protein; Unreviewed
Zhang et al. [4]: GO:0016036|cellular response to phosphate starvation
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 2. PF was P45192 (Phosphate-binding protein PstS) with a FATCAT P-Value: 1.95e-11 and RMSD of 3.04 angstrom. The sequence alignment identity is 22.3%.
Structural alignment shown in left. Query protein AVX54787.1 colored as red in alignment, homolog P45192 colored as blue. Query protein AVX54787.1 is also shown in right top, homolog P45192 showed in right bottom. They are colored based on secondary structures. 

  AVX54787.1 MRKIKESDNKTKKQFKHFFTNKKSLLFLNLCVLFIVSIWIWTFVSIKSNLINIGGSASADL-VLQKLIKEYQKQTNKKFNYSSTGSGAGARNVINQTYSI 99
      P45192 -------------------MKKKSYYVLTLGTL--------PFA--QANSIT-GAGASFPYPIYAKWASLYEKETGNKVNYQSIGSGGGQQQIIAKTVDF 70

  AVX54787.1 GFIS---KS----QNDL-SIPKEIRNNLYD--DLTEFE--KINDELSKK---QVFNHLKTFKDKYHYIDFVKDSIVFVYNIKNT-GLTNQQIDQIRFNVL 183
      P45192 GASDDPMKSELLQQHQLVQFPAVI-GGIVPVVNLPEIKPGKL--KLSGKLLAEIF--LGKIK-KWN--D--PD-LVAL-N--PTLPLPNKNI--I---VI 151

  AVX54787.1 NNKISSDSQKALHKIYTN--NK-QSDLISWKEFYKLLTNKDENNISSLIKVRPYSTNSGSGTRSSFEQISGLKDNNKKIGQAVNEYNSNGAIFTQLDASD 280
      P45192 H---RSDGSGTTFG-FTNYLSKISND---WK-----------NQV-------------GEG--KSVKWLTG--QGGK--G---NE----G-VASYVRQMK 206

  AVX54787.1 GSFGFVSMQYAQ-------DLKK------YPNLRSVIIKQNNQEWNLNKRNDN-LLT-------YPLS-RPFVALYKFTDNQKLNDDILDFVYW-FSYSN 357
      P45192 YSIGYVEYAYAKQNQLAWISLQNQAGQFVQPSNESFMAAASHAKWH-EKAGMGVILTNETGEKSWPITAASFILLNKYSDNPETTKNVLAFFDWAFSRGQ 305

  AVX54787.1 DQKVKKIYDHL----GLIRKVSN-------- 376
      P45192 DAATE--LDYVPIPADVVSTIKSQWKTELKQ 334

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
2. PF GO:0015419 ABC-type sulfate transporter activity
2. PF GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
2. PF GO:0071289 cellular response to nickel ion
2. PF GO:1901359 tungstate binding
2. PF GO:1901681 sulfur compound binding
2. PF GO:0055085 transmembrane transport
2. PF GO:0005886 plasma membrane
2. PF GO:0046680 response to DDT
2. PF GO:0030975 thiamine binding
2. PF GO:0071286 cellular response to magnesium ion
2. PF GO:0015847 putrescine transport
2. PF GO:0044010 single-species biofilm formation
2. PF GO:0042597 periplasmic space
2. PF GO:0030288 outer membrane-bounded periplasmic space
2. PF GO:0031676 plasma membrane-derived thylakoid membrane
2. PF GO:0015888 thiamine transport
2. PF GO:0031460 glycine betaine transport
2. PF GO:0030973 molybdate ion binding
2. PF GO:0015417 ABC-type polyamine transporter activity
2. PF GO:0006817 phosphate ion transport
2. PF GO:0006865 amino acid transport
2. PF GO:0071292 cellular response to silver ion
2. PF GO:0015276 ligand-gated ion channel activity
2. PF GO:0009279 cell outer membrane
2. PF GO:0042301 phosphate ion binding
2. PF GO:0047614 aconitate delta-isomerase activity
2. PF GO:0035435 phosphate ion transmembrane transport
2. PF GO:0015846 polyamine transport
2. PF GO:0043190 ATP-binding cassette (ABC) transporter complex
2. PF GO:0015848 spermidine transport
2. PF GO:0071287 cellular response to manganese ion
2. PF GO:0019810 putrescine binding
2. PF GO:0004035 alkaline phosphatase activity
2. PF GO:0006811 ion transport
2. PF GO:0019808 polyamine binding
2. PF GO:0015689 molybdate ion transport
2. PF GO:0055072 iron ion homeostasis
5. P GO:0046170 methanol catabolic process
5. P GO:0019809 spermidine binding
5. P GO:0042918 alkanesulfonate transport
5. P GO:0048473 D-methionine transport
5. P GO:0009230 thiamine catabolic process
5. P GO:0071705 nitrogen compound transport
5. P GO:0009290 DNA import into cell involved in transformation
5. P GO:0004664 prephenate dehydratase activity
5. P GO:0030976 thiamine pyrophosphate binding
5. P GO:0015734 taurine transport
5. P GO:0042930 enterobactin transport
5. P GO:0015886 heme transport
5. P GO:0051470 ectoine transport
5. P GO:0071281 cellular response to iron ion
5. P GO:0050332 thiamine pyridinylase activity
5. P GO:0046306 alkanesulfonate catabolic process
5. P GO:0015809
5. P GO:0015813 L-glutamate transmembrane transport
5. P GO:0046872 metal ion binding
5. P GO:0070778 L-aspartate transmembrane transport
5. P GO:0097638 L-arginine import across plasma membrane
5. P GO:0051701 biological process involved in interaction with host
5. P GO:0022857 transmembrane transporter activity
5. P GO:0046687 response to chromate
5. P GO:0015829 valine transport
5. P GO:0051938 L-glutamate import
5. P GO:0046239 phthalate catabolic process
5. P GO:0018796 4,5-dihydroxyphthalate decarboxylase activity
5. P GO:0015709 thiosulfate transport
5. P GO:0008643 carbohydrate transport
5. P GO:0008272 sulfate transport
5. P GO:0005737 cytoplasm
5. P GO:0033294 ectoine binding
5. P GO:0030001 metal ion transport
5. P GO:0048840 otolith development
5. P GO:0015740 C4-dicarboxylate transport
5. P GO:0005576 extracellular region
5. P GO:0052170 suppression by symbiont of host innate immune response
5. P GO:0042959 alkanesulfonate transmembrane transporter activity
5. P GO:0015820 leucine transport
5. P GO:0070335 aspartate binding
5. P GO:0016036 cellular response to phosphate starvation
5. P GO:0050997 quaternary ammonium group binding
5. P GO:0006790 sulfur compound metabolic process
5. P GO:0042619 poly-hydroxybutyrate biosynthetic process
5. P GO:0016595 glutamate binding
5. P GO:0070728 leucine binding
5. P GO:0047769 arogenate dehydratase activity
5. P GO:0015685 ferric-enterobactin import into cell
5. P GO:0009970 cellular response to sulfate starvation
5. P GO:0043090 amino acid import
5. P GO:0043199 sulfate binding
5. P GO:0007155 cell adhesion
5. P GO:0036173 thiosulfate binding
5. P GO:0020037 heme binding
5. P GO:0006826 iron ion transport
5. P GO:0015818 isoleucine transport
5. P GO:0010921 regulation of phosphatase activity
6. F GO:0019619 3,4-dihydroxybenzoate catabolic process
6. F GO:0003677 DNA binding
6. F GO:0045151 acetoin biosynthetic process
6. F GO:0003700 DNA-binding transcription factor activity
6. F GO:0009507 chloroplast
6. F GO:0015144 carbohydrate transmembrane transporter activity
6. F GO:0000986
6. F GO:0006355 regulation of transcription, DNA-templated
6. F GO:0000976 transcription cis-regulatory region binding
6. F GO:1901982 maltose binding
6. F GO:0045892 negative regulation of transcription, DNA-templated
6. F GO:0005524 ATP binding
6. F GO:0042956 maltodextrin transport
6. F GO:0032993 protein-DNA complex
6. F GO:0070689 L-threonine catabolic process to propionate
6. F GO:0016021 integral component of membrane
6. F GO:0019439 aromatic compound catabolic process
6. F GO:0019344 cysteine biosynthetic process
6. F GO:2001071 maltoheptaose binding
6. F GO:0009086 methionine biosynthetic process
6. F GO:2000142 regulation of DNA-templated transcription, initiation
6. F GO:0015768 maltose transport

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
2. PF P9WGT6 Phosphate-binding protein PstS 3 6.25e-11 1.57e-13 NA 0.5102
2. PF P39665 Protein SphX 1.87e-06 7.39e-07 NA 0.505
2. PF A0A0H3MBL5 Phosphate-binding protein PstS2 1.14e-10 2.29e-12 NA 0.5495
2. PF A0A0A1H8I4 Aconitate isomerase 4.31e-05 1.43e-11 NA 0.514
2. PF Q8CP98 Phosphate-binding protein PstS 2.69e-06 1.60e-12 NA 0.5173
2. PF P21408 Fe(3+)-binding periplasmic protein 8.05e-07 5.96e-06 NA 0.3778
2. PF Q8E5K2 Phosphate-binding protein PstS 1 2.52e-09 2.75e-14 NA 0.6286
2. PF Q9HTX3 Probable binding protein component of ABC iron transporter PA5217 1.16e-03 2.16e-04 NA 0.3561
2. PF Q8TTZ5 Uncharacterized solute-binding protein MA_0280 6.39e-03 1.33e-18 NA 0.4266
2. PF Q2LWH5 Uncharacterized solute-binding protein SYNAS_25580 4.28e-04 7.00e-10 NA 0.409
2. PF O34852 L-cystine-binding protein TcyK 8.28e-03 4.36e-03 NA 0.4895
2. PF Q7A5Q2 Phosphate-binding protein PstS 2.21e-06 2.76e-12 NA 0.5245
2. PF P9WGU0 Phosphate-binding protein PstS 1 2.71e-11 4.59e-13 NA 0.5479
2. PF O30142 Molybdate/tungstate-binding protein WtpA 2.06e-03 1.10e-16 NA 0.3995
2. PF P72827 Iron uptake protein A1 4.97e-04 2.91e-11 NA 0.3419
2. PF A3DL83 Uncharacterized solute-binding protein Smar_0280 2.49e-04 1.89e-18 NA 0.4245
2. PF Q8DZV4 Phosphate-binding protein PstS 1 2.50e-09 2.75e-14 NA 0.6354
2. PF Q08868 Outer membrane lipoprotein 1 3.56e-03 1.08e-13 NA 0.3987
2. PF P0DMR4 Phosphate-binding protein PstS 3.78e-11 5.39e-15 NA 0.5881
2. PF P0A0Y4 Major ferric iron-binding protein 3.22e-03 2.64e-04 NA 0.4132
2. PF Q31L64 Iron deficiency-induced protein A 2.16e-03 1.93e-06 NA 0.37
2. PF O84385 Probable ABC transporter arginine-binding protein ArtJ 5.16e-03 8.29e-06 NA 0.519
2. PF A6UX24 Uncharacterized solute-binding protein Maeo_1470 2.25e-03 4.13e-21 NA 0.4036
2. PF Q9KK89 Phosphate-binding protein PstS 3 6.66e-11 1.05e-11 NA 0.5208
2. PF Q9I6J1 Putrescine-binding periplasmic protein SpuD 3.62e-02 5.83e-05 NA 0.3337
2. PF P9WGT8 Phosphate-binding protein PstS 2 1.02e-10 9.81e-13 NA 0.5577
2. PF O32208 Putative ABC transporter substrate-binding lipoprotein YvgL 2.62e-07 8.35e-14 NA 0.5669
2. PF Q4L694 Phosphate-binding protein PstS 2.09e-06 1.76e-13 NA 0.5472
2. PF B0R5Y3 Uncharacterized solute-binding protein OE_3270R 1.12e-06 5.12e-12 NA 0.4114
2. PF P46338 Phosphate-binding protein PstS 1.11e-10 6.81e-16 NA 0.5926
2. PF Q7A2S1 Phosphate-binding protein PstS 2.10e-06 2.76e-12 NA 0.5095
2. PF Q0P885 Tungstate-binding protein TupA 5.21e-08 2.13e-09 NA 0.5436
2. PF Q02HI0 Alkaline phosphatase L 3.73e-08 1.59e-04 NA 0.4944
2. PF Q9CNJ4 Phosphate-binding protein PstS 2.45e-11 4.87e-09 NA 0.5861
2. PF A6VHR6 Uncharacterized solute-binding protein MmarC7_0925 3.83e-03 5.49e-18 NA 0.411
2. PF Q08383 Molybdate-binding protein ModA 7.88e-08 1.73e-10 NA 0.5619
2. PF P0AG79 Sulfate-binding protein 8.73e-07 2.63e-03 NA 0.3246
2. PF Q97Z99 Uncharacterized solute-binding protein SSO1031 1.62e-03 7.29e-16 NA 0.4055
2. PF Q5HG31 Phosphate-binding protein PstS 2.20e-06 2.76e-12 NA 0.5145
2. PF Q7A0X7 Phosphate-binding protein PstS 2.24e-06 2.76e-12 NA 0.5233
2. PF P71391 Putative binding protein HI_1525 5.01e-09 3.56e-08 NA 0.6159
2. PF Q8DLH9 Iron deficiency-induced protein A 1.83e-03 2.95e-06 NA 0.3457
2. PF Q98FL2 Phosphate-binding protein PstS 3.05e-11 2.45e-09 NA 0.5651
2. PF P45192 Phosphate-binding protein PstS 1.95e-11 6.25e-11 NA 0.581
2. PF A3CWQ6 Uncharacterized solute-binding protein Memar_1880 7.92e-04 9.36e-15 NA 0.4104
2. PF Q02DZ3 Phosphate-binding protein PstS 3.06e-11 5.39e-15 NA 0.5585
2. PF P45168 Spermidine/putrescine-binding periplasmic protein 1 5.98e-03 2.19e-06 NA 0.3741
2. PF Q9HPK2 Uncharacterized solute-binding protein VNG_1595C 1.12e-06 5.12e-12 NA 0.4587
2. PF Q49XJ1 Phosphate-binding protein PstS 1.09e-05 5.79e-12 NA 0.5284
2. PF Q46125 Probable histidine-binding protein 1.60e-04 9.71e-05 NA 0.5052
2. PF A4G0R9 Uncharacterized solute-binding protein MmarC5_1756 4.76e-03 1.57e-16 NA 0.3944
2. PF Q2YXX9 Phosphate-binding protein PstS 2.21e-06 4.39e-12 NA 0.5182
2. PF Q8PHA1 Molybdate-binding protein ModA 1.65e-05 8.03e-09 NA 0.5477
2. PF P0A5Y1 Molybdate-binding protein ModA 1.88e-08 9.87e-10 NA 0.5976
2. PF P35482 Alkaline phosphatase L 4.34e-09 1.66e-06 NA 0.514
2. PF Q5N0R0 Iron deficiency-induced protein A 2.13e-03 1.93e-06 NA 0.3703
2. PF Q2FH48 Phosphate-binding protein PstS 2.22e-06 2.76e-12 NA 0.5193
2. PF O34439 UPF0065 protein YflP 1.33e-03 2.88e-05 NA 0.4573
2. PF O34406 L-cystine-binding protein TcyJ 1.70e-03 1.04e-04 NA 0.4184
2. PF Q8Z8W7 Putative 2-aminoethylphosphonate-binding periplasmic protein 9.23e-05 1.78e-02 NA 0.3941
2. PF Q97Q31 Phosphate-binding protein PstS 1 4.47e-09 1.52e-14 NA 0.6364
2. PF Q9CBE5 Phosphate-binding protein PstS 3 1.11e-10 4.97e-12 NA 0.5001
2. PF Q5JEB6 Molybdate/tungstate-binding protein WtpA 1.40e-03 9.92e-16 NA 0.3729
2. PF Q87C91 Phosphate-binding protein PstS 4.60e-11 2.70e-15 NA 0.5411
2. PF D4GSY9 Putative ABC transporter anion-binding protein HVO_1888 1.17e-07 4.90e-06 NA 0.4872
2. PF Q08869 Outer membrane lipoprotein 2 3.41e-03 2.15e-12 NA 0.3767
2. PF P0A0Y3 Major ferric iron-binding protein 3.45e-03 2.47e-04 NA 0.4166
2. PF P47652 Uncharacterized lipoprotein MG412 8.23e-11 5.79e-12 NA 0.5074
2. PF P9WGU2 Molybdate-binding protein ModA 2.23e-08 9.87e-10 NA 0.5976
2. PF A0A0H3M950 Phosphate-binding protein PstS1 3.57e-11 5.92e-13 NA 0.5664
2. PF P35755 Iron-utilization periplasmic protein 1.78e-03 3.60e-06 NA 0.434
2. PF P0A5Y3 Phosphate-binding protein PstS 3 6.11e-11 1.57e-13 NA 0.537
2. PF P75184 Uncharacterized lipoprotein MG412 homolog 3.66e-11 1.93e-09 NA 0.5413
2. PF Q9KU25 Norspermidine sensor 1.17e-02 1.68e-04 NA 0.3665
2. PF O32243 Glycine betaine/carnitine/choline-binding protein OpuCC 2.31e-02 2.18e-18 NA 0.3741
2. PF Q6GH18 Phosphate-binding protein PstS 2.27e-06 2.98e-12 NA 0.5171
2. PF Q6G9H1 Phosphate-binding protein PstS 2.29e-06 2.76e-12 NA 0.5133
2. PF O32167 Methionine-binding lipoprotein MetQ 1.50e-02 3.76e-12 NA 0.3992
2. PF P0AG83 Phosphate-binding protein PstS 2.77e-11 4.92e-08 NA 0.5618
2. PF P44731 Spermidine/putrescine-binding periplasmic protein 2 1.86e-02 2.00e-05 NA 0.3189
2. PF O51233 Phosphate-binding protein PstS 2.25e-08 1.77e-16 NA 0.5503
2. PF Q57SD5 Putative 2-aminoethylphosphonate-binding periplasmic protein 8.80e-05 1.55e-02 NA 0.3958
2. PF P37734 Molybdate-binding protein ModA 2.85e-05 2.32e-09 NA 0.5117
2. PF Q5PFQ8 Putative 2-aminoethylphosphonate-binding periplasmic protein 2.54e-03 1.50e-02 NA 0.3952
2. PF P46149 Uncharacterized protein SO_0736 4.84e-03 1.04e-04 NA 0.4623
2. PF P96062 Putative 2-aminoethylphosphonate-binding periplasmic protein 2.54e-03 1.41e-02 NA 0.4446
2. PF P54594 Uncharacterized lipoprotein YhcJ 3.22e-02 7.12e-17 NA 0.4035
2. PF G3XDA8 Phosphate-binding protein PstS 3.69e-11 5.39e-15 NA 0.5879
2. PF Q8DPB1 Phosphate-binding protein PstS 1 4.20e-09 1.52e-14 NA 0.6189
2. PF P31728 Probable D-methionine-binding lipoprotein MetQ 3.59e-03 3.83e-18 NA 0.4146
2. PF Q9PBK3 Phosphate-binding protein PstS 5.09e-11 4.12e-15 NA 0.5409
2. PF Q5HPF2 Phosphate-binding protein PstS 2.62e-06 5.45e-12 NA 0.5171
2. PF Q01903 Sulfate-binding protein 8.19e-07 4.92e-11 NA 0.2834
2. PF Q97BB3 Uncharacterized solute-binding protein TV0544 7.15e-03 6.12e-18 NA 0.3893
2. PF A0A0H3MBK5 Phosphate-binding protein PstS3 8.62e-11 1.57e-13 NA 0.537
2. PF Q8RQL6 Glutamate-binding protein 2.97e-03 3.57e-03 NA 0.4359
2. PF A9BF57 Uncharacterized solute-binding protein Pmob_0379 6.91e-04 2.54e-08 NA 0.454
2. PF Q93KD6 Tungstate-binding protein TupA 6.87e-05 2.45e-19 NA 0.5096
2. PF Q96YZ5 Uncharacterized solute-binding protein STK_20340 2.88e-03 7.07e-21 NA 0.4417
2. PF P17259 Major ferric iron-binding protein 6.71e-04 1.34e-04 NA 0.4241
2. PF P57911 Uncharacterized protein PM1146 1.94e-03 1.24e-05 NA 0.5514
2. PF Q55200 Protein SphX 3.62e-08 8.97e-08 NA 0.6205
2. PF Q8ZML1 Glycine betaine/proline betaine-binding periplasmic protein 4.01e-02 1.65e-03 NA 0.3876
2. PF P61618 Uncharacterized solute-binding protein MMP1652 5.79e-03 4.81e-10 NA 0.3982
2. PF A6UQT5 Uncharacterized solute-binding protein Mevan_0954 4.02e-03 1.70e-13 NA 0.4272
2. PF Q9HJB8 Uncharacterized solute-binding protein Ta1052 3.43e-03 8.80e-10 NA 0.3925
2. PF Q45462 Choline-binding protein 8.19e-03 3.25e-15 NA 0.3724
2. PF Q02UB7 Putrescine-binding periplasmic protein SpuD 3.51e-02 5.83e-05 NA 0.3261
2. PF P52626 Putative amino-acid ABC transporter-binding protein PatH 7.41e-04 3.16e-02 NA 0.525
2. PF P02906 Sulfate-binding protein 5.67e-07 6.94e-03 NA 0.3391
2. PF K4LAH1 Alkaline phosphatase L 3.65e-08 2.99e-04 NA 0.4979
2. PF P45323 Molybdate-binding protein ModA 1.08e-07 1.43e-05 NA 0.5413
5. P Q6GA82 High-affinity heme uptake system protein IsdE 3.98e-01 3.42e-02 NA NA
5. P P0A3T3 31 kDa immunogenic protein 2.60e-03 6.42e-04 NA NA
5. P P43020 Uncharacterized protein YiiZ 1.52e-02 1.32e-02 NA NA
5. P A1JJ52 Autoinducer 2-binding protein LsrB 2.58e-01 1.97e-02 NA NA
5. P P0A4F8 Octopine-binding periplasmic protein 1.09e-03 9.94e-06 NA NA
5. P P45766 Putative amino-acid ABC transporter-binding protein YhdW NA 3.35e-02 NA NA
5. P B0R6A8 Chemotactic signal transduction system substrate-binding protein CosB 1.02e-02 1.65e-13 NA NA
5. P C0SP84 Putative binding protein YtlA 1.16e-03 6.32e-03 NA NA
5. P Q9L5X1 Manganese ABC transporter substrate-binding lipoprotein 1.23e-01 2.50e-02 NA NA
5. P P04846 Lipoprotein 28 6.01e-04 6.77e-19 NA NA
5. P Q8XC50 Lipoprotein 28 3.77e-03 1.31e-18 NA NA
5. P P9WGT7 Phosphate-binding protein PstS 3 6.18e-11 1.57e-13 NA NA
5. P P35120 Nopaline-binding periplasmic protein 8.02e-03 1.11e-05 NA NA
5. P Q312S0 Isethionate-binding periplasmic protein DctP 9.74e-03 7.64e-04 NA NA
5. P P37902 Glutamate/aspartate import solute-binding protein 2.09e-02 5.14e-03 NA NA
5. P C0SP94 Putative ABC transporter substrate-binding lipoprotein YhfQ 3.06e-01 1.80e-03 NA NA
5. P B1IRU4 Autoinducer 2-binding protein LsrB 2.54e-01 5.82e-03 NA NA
5. P Q99UX1 High-affinity heme uptake system protein IsdE 4.02e-01 3.42e-02 NA NA
5. P Q8U4K5 Molybdate/tungstate-binding protein WtpA 4.38e-04 3.40e-17 NA NA
5. P Q9ZF60 Glutamate/aspartate import solute-binding protein 1.33e-02 1.78e-02 NA NA
5. P P55659 Probable amino-acid ABC transporter periplasmic-binding protein y4tE 1.13e-03 2.95e-02 NA NA
5. P Q9IBF7 Otolith matrix protein 1 3.33e-03 4.36e-02 NA NA
5. P Q9L5X0 Manganese ABC transporter substrate-binding lipoprotein 1.41e-01 4.04e-02 NA NA
5. P P0A3T2 31 kDa immunogenic protein 7.59e-04 6.42e-04 NA NA
5. P A9WGD2 Riboflavin-binding protein RibY 5.28e-03 4.73e-03 NA NA
5. P Q7CR85 Thiamine-binding periplasmic protein 1.09e-06 3.88e-06 NA NA
5. P P0A2C7 Spermidine/putrescine-binding periplasmic protein 5.67e-03 6.40e-05 NA NA
5. P Q2FHU8 High-affinity heme uptake system protein IsdE 4.03e-01 3.42e-02 NA NA
5. P P11460 Ferric-anguibactin-binding protein FatB 2.87e-01 3.29e-02 NA NA
5. P Q8Z992 D-methionine-binding lipoprotein MetQ 2.47e-03 2.47e-17 NA NA
5. P P0AFM3 Glycine betaine/proline betaine-binding periplasmic protein 5.41e-02 3.16e-04 NA NA
5. P Q6G9J7 Regulatory protein MsrR 3.85e-01 2.22e-02 NA NA
5. P Q56328 ABC transporter riboflavin-binding protein RfuA 2.51e-01 9.34e-03 NA NA
5. P P0AG78 Sulfate-binding protein 7.47e-07 2.63e-03 NA NA
5. P P31133 Putrescine-binding periplasmic protein PotF 2.00e-02 1.14e-04 NA NA
5. P Q7A652 High-affinity heme uptake system protein IsdE 4.03e-01 3.42e-02 NA NA
5. P Q06758 Probable histidine-binding protein 5.70e-04 4.71e-04 NA NA
5. P Q57550 Uncharacterized lipoprotein MJ0085 4.14e-01 5.34e-06 NA NA
5. P P0A4F9 Octopine-binding periplasmic protein 1.10e-03 9.94e-06 NA NA
5. P Q5HGV1 High-affinity heme uptake system protein IsdE 4.11e-01 3.42e-02 NA NA
5. P P15363 High affinity transport system protein p37 5.95e-02 2.48e-15 NA NA
5. P Q8X8V9 D-methionine-binding lipoprotein MetQ 3.09e-03 1.12e-16 NA NA
5. P Q7A0Y4 Regulatory protein MsrR 3.32e-01 2.22e-02 NA NA
5. P Q4J710 Xylose/arabinose-binding protein XylF 9.03e-02 1.07e-02 NA NA
5. P A8A069 Autoinducer 2-binding protein LsrB 2.56e-01 7.93e-03 NA NA
5. P Q122C7 Solute-binding protein Bpro_4736 3.64e-02 2.62e-02 NA NA
5. P P28635 D-methionine-binding lipoprotein MetQ 2.39e-03 1.96e-17 NA NA
5. P O34563 ABC transporter glutamine-binding protein GlnH 1.09e-02 1.35e-04 NA NA
5. P P77269 ABC transporter periplasmic-binding protein YphF 3.01e-01 2.89e-02 NA NA
5. P P33362 Glycine betaine-binding protein YehZ 2.05e-02 4.14e-14 NA NA
5. P P29900 Protein MoxJ 3.76e-02 1.32e-03 NA NA
5. P Q8XAY9 Autoinducer 2-binding protein LsrB 2.55e-01 1.89e-02 NA NA
5. P Q57449 Uncharacterized periplasmic iron-binding protein HI_0362 1.55e-01 2.09e-02 NA NA
5. P P0AG82 Phosphate-binding protein PstS 2.76e-11 4.92e-08 NA NA
5. P Q931S1 Regulatory protein MsrR 4.12e-01 2.13e-02 NA NA
5. P Q9I6J0 Spermidine-binding periplasmic protein SpuE 1.02e-02 2.92e-05 NA NA
5. P P71336 Uncharacterized protein HI_0052 1.05e-02 4.13e-04 NA NA
5. P Q49410 High affinity transport system protein p37 5.84e-02 5.06e-28 NA NA
5. P Q56952 Periplasmic chelated iron-binding protein YfeA 1.69e-01 4.08e-02 NA NA
5. P A0QQ71 Phosphate-import protein PhnD 3.95e-04 1.77e-05 NA NA
5. P B1LF99 Autoinducer 2-binding protein LsrB 2.54e-01 1.89e-02 NA NA
5. P Q9CK95 Probable D-methionine-binding lipoprotein MetQ 4.88e-03 2.25e-14 NA NA
5. P Q01269 Cyclohexadienyl dehydratase 3.14e-03 2.09e-02 NA NA
5. P Q5HG57 Regulatory protein MsrR 4.03e-01 2.22e-02 NA NA
5. P P58068 Putative amino-acid ABC transporter-binding protein YhdW 2.22e-02 2.78e-02 NA NA
5. P Q9S529 Uncharacterized metal-binding lipoprotein CT_067 2.90e-01 3.77e-02 NA NA
5. P Q4QP41 Sialic acid-binding periplasmic protein SiaP 6.55e-03 1.26e-03 NA NA
5. P Q8FYV1 Thiamine-binding periplasmic protein 1.55e-06 2.28e-09 NA NA
5. P P0AFK9 Spermidine/putrescine-binding periplasmic protein 4.93e-03 3.73e-04 NA NA
5. P P37735 C4-dicarboxylate-binding periplasmic protein DctP 2.21e-02 2.01e-02 NA NA
5. P P75371 High affinity transport system protein p37 5.58e-02 7.70e-14 NA NA
5. P O32436 Transcriptional activator protein med 1.87e-01 2.95e-06 NA NA
5. P Q9KQR9 C4-dicarboxylate-binding periplasmic protein DctP 1.02e-02 1.44e-02 NA NA
5. P Q8K9M5 High-affinity zinc uptake system protein ZnuA 2.40e-01 1.41e-02 NA NA
5. P Q9CFZ5 Metal ABC transporter substrate-binding lipoprotein 1.27e-01 4.86e-02 NA NA
5. P G2JZ42 Carnitine transport binding protein OpuCC 9.75e-03 1.86e-15 NA NA
5. P P48242 Glutamate-binding protein 3.30e-03 7.48e-04 NA NA
5. P P96600 C4-dicarboxylate-binding protein DctB 4.52e-03 3.53e-04 NA NA
5. P P54535 Arginine-binding extracellular protein ArtP 8.48e-04 1.21e-03 NA NA
5. P Q8ZH40 D-methionine-binding lipoprotein MetQ 2.14e-03 1.05e-17 NA NA
5. P A3PDP9 Probable ABC transporter phosphonate/phosphite binding protein PhnD2 1.79e-04 1.93e-07 NA NA
5. P O31486 Putative lipoprotein YdaJ 4.66e-01 3.08e-03 NA NA
5. P P45741 Thiaminase-1 6.94e-02 1.36e-02 NA NA
5. P P9WGT9 Phosphate-binding protein PstS 2 1.22e-10 9.81e-13 NA NA
5. P P76108 Bifunctional polyhydroxybutyrate synthase / ABC transporter periplasmic binding protein 6.63e-03 1.34e-03 NA NA
5. P Q5LSJ5 Solute-binding protein SPO1773 1.98e-02 3.97e-05 NA NA
5. P O69061 Probable phosphite transport system-binding protein HtxB 5.20e-04 1.54e-07 NA NA
5. P P31305 Manganese ABC transporter substrate-binding lipoprotein 1.29e-01 8.52e-03 NA NA
5. P P37676 2,3-diketo-L-gulonate-binding periplasmic protein YiaO 1.20e-02 4.72e-02 NA NA
5. P P27366 Sulfate-binding protein 4.35e-06 1.43e-11 NA NA
5. P P9WGU1 Phosphate-binding protein PstS 1 2.68e-11 4.59e-13 NA NA
5. P P72298 Octopine-binding periplasmic protein 9.86e-04 4.22e-03 NA NA
5. P P16700 Thiosulfate-binding protein 9.90e-07 2.36e-04 NA NA
5. P Q57BC4 Thiamine-binding periplasmic protein 1.54e-06 1.18e-08 NA NA
5. P P76142 Autoinducer 2-binding protein LsrB 2.55e-01 1.69e-02 NA NA
5. P Q55835 Iron uptake protein A2 4.73e-03 4.56e-04 NA NA
5. P E0SCY3 Glycine betaine-binding periplasmic protein OusX 4.86e-02 1.15e-05 NA NA
5. P Q2FZE6 High-affinity heme uptake system protein IsdE 4.02e-01 3.42e-02 NA NA
5. P Q58586 Molybdate/tungstate-binding protein WtpA 3.65e-03 2.18e-14 NA NA
5. P Q8YJ02 Thiamine-binding periplasmic protein 1.37e-06 1.23e-08 NA NA
5. P A6QG34 High-affinity heme uptake system protein IsdE 3.99e-01 3.42e-02 NA NA
5. P P44658 Putative thiamine biosynthesis protein HI_0357 2.14e-02 5.04e-03 NA NA
5. P Q9KHT7 Carnitine transport binding protein OpuCC 1.08e-02 1.86e-15 NA NA
5. P A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP 2.58e-02 3.42e-02 NA NA
5. P P0C888 Autoinducer 2-binding protein LsrB 2.55e-01 1.13e-02 NA NA
5. P Q58421 Phosphate-binding protein PstS 1.24e-10 3.24e-14 NA NA
5. P P37329 Molybdate-binding protein ModA 2.81e-04 1.73e-06 NA NA
5. P P0AFM2 Glycine betaine/proline betaine-binding periplasmic protein 5.41e-02 3.16e-04 NA NA
5. P Q8KR68 Outer membrane transporter protein TsaT 4.72e-02 1.17e-02 NA NA
5. P B1XEA4 Autoinducer 2-binding protein LsrB 2.41e-01 1.69e-02 NA NA
5. P A7ZLX3 Autoinducer 2-binding protein LsrB 2.55e-01 1.13e-02 NA NA
5. P P55454 Probable ABC transporter periplasmic-binding protein y4fP 3.20e-03 9.93e-05 NA NA
5. P Q6GH43 Regulatory protein MsrR 4.00e-01 2.22e-02 NA NA
5. P P44984 Thiamine-binding periplasmic protein 5.01e-06 1.35e-09 NA NA
5. P Q99Q02 Regulatory protein MsrR 3.45e-01 2.22e-02 NA NA
5. P Q0VIL3 Otolith matrix protein 1 3.63e-03 2.40e-02 NA NA
5. P P0AEL6 Ferric enterobactin-binding periplasmic protein FepB 6.26e-01 8.62e-04 NA NA
5. P P31550 Thiamine-binding periplasmic protein 9.97e-07 7.85e-08 NA NA
5. P P94421 Petrobactin-binding protein YclQ 2.40e-01 1.55e-04 NA NA
5. P D4GP35 Xylose/arabinose-binding protein XacG 4.09e-02 4.66e-04 NA NA
5. P P0C887 Autoinducer 2-binding protein LsrB 2.53e-01 1.50e-02 NA NA
5. P A3PC74 Probable ABC transporter phosphite binding protein PhnD1 2.06e-05 4.93e-04 NA NA
5. P O07950 Membrane lipoprotein TpN32 2.07e-02 5.82e-13 NA NA
5. P C0QY54 Putative ABC transporter periplasmic binding protein BHWA1_00430 9.93e-03 5.82e-03 NA NA
5. P Q47537 Taurine-binding periplasmic protein 3.27e-03 1.80e-03 NA NA
5. P Q7BHL7 Regulatory protein MsrR 4.46e-01 2.22e-02 NA NA
5. P P0A2C8 Spermidine/putrescine-binding periplasmic protein 5.54e-03 6.40e-05 NA NA
5. P Q9V2C4 Molybdate/tungstate-binding protein WtpA 1.38e-03 1.24e-18 NA NA
5. P D4GQ16 Putative ABC transporter molybdenum-binding protein HVO_B0369 3.61e-03 7.52e-12 NA NA
5. P O31567 Probable siderophore-binding lipoprotein YfiY 3.08e-01 1.84e-02 NA NA
5. P P54952 Probable amino-acid-binding protein YxeM 4.51e-04 3.34e-04 NA NA
5. P Q7A150 High-affinity heme uptake system protein IsdE 4.03e-01 3.42e-02 NA NA
5. P P0AEL7 Ferric enterobactin-binding periplasmic protein FepB 6.19e-01 8.62e-04 NA NA
5. P A7X153 High-affinity heme uptake system protein IsdE 4.02e-01 3.42e-02 NA NA
5. P Q9HU18 C4-dicarboxylate-binding periplasmic protein DctP 1.50e-02 1.13e-03 NA NA
5. P P9WGU3 Molybdate-binding protein ModA 1.91e-08 9.87e-10 NA NA
5. P Q8ZRN1 D-methionine-binding lipoprotein MetQ 2.32e-03 1.35e-17 NA NA
5. P Q9KTJ7 Probable D-methionine-binding lipoprotein MetQ 8.30e-03 8.64e-17 NA NA
5. P P76223 Protein YnjB 6.87e-04 2.72e-05 NA NA
5. P P75853 Putative aliphatic sulfonates-binding protein 1.02e-02 1.18e-03 NA NA
5. P P16028 Protein MoxJ 1.02e-02 8.91e-06 NA NA
5. P Q52812 General L-amino acid-binding periplasmic protein AapJ 3.80e-02 4.49e-03 NA NA
5. P O57890 Molybdate/tungstate-binding protein WtpA 9.87e-04 3.73e-16 NA NA
5. P O69052 Probable phosphite transport system-binding protein PtxB 2.31e-04 1.73e-05 NA NA
5. P P40400 Putative aliphatic sulfonates-binding protein 3.68e-03 7.71e-05 NA NA
5. P Q8ZPK2 Osmoprotectant-binding protein OsmX 2.02e-02 6.73e-11 NA NA
5. P P43951 Uncharacterized protein HI_0131 2.90e-03 2.99e-05 NA NA
5. P P0AFL0 Spermidine/putrescine-binding periplasmic protein 5.87e-03 3.73e-04 NA NA
5. P P41031 Thiosulfate-binding protein 1.29e-04 1.22e-03 NA NA
5. P Q0B2F6 Solute-binding protein Bamb_6123 7.30e-03 1.25e-02 NA NA
5. P Q9L5W9 Manganese ABC transporter substrate-binding lipoprotein 1.23e-01 3.45e-02 NA NA
5. P P42400 Probable ABC transporter extracellular-binding protein YckB 1.17e-02 1.33e-05 NA NA
5. P Q6GHV3 High-affinity heme uptake system protein IsdE 4.01e-01 5.00e-02 NA NA
5. P Q08870 Outer membrane lipoprotein 3 1.16e-02 2.42e-17 NA NA
5. P P30860 ABC transporter arginine-binding protein 1 9.60e-04 6.87e-03 NA NA
5. P Q2FYP6 Phosphate-binding protein PstS 2.22e-06 2.76e-12 NA NA
5. P Q05185 4,5-dihydroxyphthalate decarboxylase 8.13e-02 1.60e-02 NA NA
5. P P38683 Periplasmic protein TorT 1.64e-01 4.67e-02 NA NA
5. P Q2YLW8 Thiamine-binding periplasmic protein 1.30e-06 1.18e-08 NA NA
5. P A3T0D1 Solute-binding protein NAS141_03721 5.61e-02 7.38e-03 NA NA
5. P Q9Z869 Probable ABC transporter arginine-binding protein ArtJ 1.36e-03 1.49e-02 NA NA
5. P E1VBK1 Ectoine-binding periplasmic protein TeaA 1.20e-02 1.13e-02 NA NA
5. P A4N8V8 Putative metal ABC transporter substrate-binding protein Hpf 1.64e-01 2.09e-02 NA NA
5. P P44542 Sialic acid-binding periplasmic protein SiaP 6.49e-03 2.39e-03 NA NA
6. F Q6LMN6 HTH-type transcriptional regulator ArgP 1.28e-05 NA NA 0.4619
6. F Q1CBT5 HTH-type transcriptional regulator HdfR 4.97e-05 NA NA 0.4815
6. F P51205 Probable RuBisCO transcriptional regulator 5.61e-07 NA NA 0.5145
6. F A1JI47 HTH-type transcriptional regulator HdfR 5.20e-04 NA NA 0.4741
6. F P0ACR1 HTH-type transcriptional activator AllS 9.56e-05 NA NA 0.4466
6. F P0A9F4 HTH-type transcriptional regulator CysB 1.32e-05 NA NA 0.4611
6. F P0A9G0 HTH-type transcriptional regulator MetR 1.90e-04 NA NA 0.4474
6. F A8A6M0 HTH-type transcriptional regulator HdfR 8.87e-05 NA NA 0.4284
6. F B7NF28 HTH-type transcriptional regulator YidZ 1.81e-04 NA NA 0.4344
6. F P52677 Probable hydrogen peroxide-inducible genes activator 7.40e-06 NA NA 0.488
6. F A0T0V5 Probable RuBisCO transcriptional regulator 5.35e-07 NA NA 0.538
6. F B4SYF7 HTH-type transcriptional regulator HdfR 6.78e-04 NA NA 0.4338
6. F O32207 Uncharacterized protein YvgK 2.11e-05 NA NA 0.5044
6. F A7Z5E4 HTH-type transcriptional regulator YofA 1.32e-05 NA NA 0.4913
6. F Q31UW5 HTH-type transcriptional regulator YidZ 1.69e-04 NA NA 0.4241
6. F A8ACM1 HTH-type transcriptional regulator YidZ 1.76e-04 NA NA 0.436
6. F P0ACR6 Uncharacterized HTH-type transcriptional regulator YeiE 1.48e-06 NA NA 0.5279
6. F P58332 HTH-type transcriptional regulator CbbR 2.16e-06 NA NA 0.5305
6. F Q8X4M5 HTH-type transcriptional regulator CynR 6.23e-06 NA NA 0.5168
6. F Q3MCB5 Probable RuBisCO transcriptional regulator 1.09e-06 NA NA 0.4541
6. F O07009 Galactooligosaccharide-binding protein 5.58e-02 NA NA 0.3846
6. F Q5PKV5 HTH-type transcriptional regulator YidZ 1.31e-04 NA NA 0.4233
6. F B1LLU0 HTH-type transcriptional regulator HdfR 1.21e-03 NA NA 0.4156
6. F O32255 Uncharacterized HTH-type transcriptional regulator YvbU 1.32e-05 NA NA 0.5255
6. F Q88JX7 HTH-type transcriptional regulator GalR 1.82e-04 NA NA 0.4516
6. F B7N260 HTH-type transcriptional regulator HdfR 1.74e-03 NA NA 0.3753
6. F Q1RF30 HTH-type transcriptional activator AllS 9.77e-05 NA NA 0.44
6. F B5YY14 HTH-type transcriptional regulator HdfR 1.13e-03 NA NA 0.4262
6. F P46924 Probable HTH-type transcriptional regulator LeuO 2.93e-05 NA NA 0.3971
6. F B2TUR4 HTH-type transcriptional regulator YidZ 5.27e-04 NA NA 0.4198
6. F P0A4T4 Octopine catabolism/uptake operon regulatory protein OccR 1.68e-05 NA NA 0.4857
6. F P0ACQ8 HTH-type transcriptional regulator TdcA 8.18e-04 NA NA 0.4756
6. F A0T0G2 Probable RuBisCO transcriptional regulator 5.67e-07 NA NA 0.5274
6. F P0A2Q4 HTH-type transcriptional regulator MetR 1.94e-04 NA NA 0.5066
6. F A0KJ50 Membrane-bound lytic murein transglycosylase F 2.66e-03 NA NA 0.3807
6. F Q63H01 HTH-type transcriptional regulator CzcR 1.51e-06 NA NA 0.497
6. F P85173 Phosphate-binding protein 2.21e-04 NA NA 0.4943
6. F P0A4T3 Octopine catabolism/uptake operon regulatory protein OccR 1.82e-05 NA NA 0.4771
6. F P52684 Malonate utilization transcriptional regulator 4.08e-06 NA NA 0.4632
6. F P02910 Histidine-binding periplasmic protein 4.50e-03 NA NA 0.4296
6. F P73123 Probable RuBisCO transcriptional regulator 1.58e-06 NA NA 0.4955
6. F P44821 HTH-type transcriptional activator IlvY 3.61e-05 NA NA 0.436
6. F P52693 Probable nitrogen assimilation transcriptional activator 3.73e-07 NA NA 0.4949
6. F P0ACQ6 Hydrogen peroxide-inducible genes activator 7.69e-05 NA NA 0.4648
6. F Q1XDT2 Probable RuBisCO transcriptional regulator 5.92e-07 NA NA 0.498
6. F B1X9U0 HTH-type transcriptional regulator YidZ 1.67e-04 NA NA 0.4409
6. F P59214 Maltooligosaccharide ABC transporter solute-binding lipoprotein 4.89e-02 NA NA 0.3235
6. F O87324 Probable hydrogen peroxide-inducible genes activator 5.42e-06 NA NA 0.4617
6. F Q73EY2 HTH-type transcriptional regulator CzcR 1.45e-06 NA NA 0.4859
6. F P94403 HTH-type transcriptional regulator BsdA 2.00e-05 NA NA 0.5034
6. F P39647 HTH-type transcriptional regulator CysL 1.86e-06 NA NA 0.5191
6. F P52666 HTH-type transcriptional regulator BudR 1.12e-04 NA NA 0.4872
6. F Q8VWE6 Probable HTH-type transcriptional regulator LrhA 6.43e-04 NA NA 0.4385
6. F B5YXB5 HTH-type transcriptional regulator YidZ 1.67e-04 NA NA 0.4348
6. F Q8ZKY0 HTH-type transcriptional regulator YidZ 1.45e-04 NA NA 0.4
6. F B7NU32 HTH-type transcriptional regulator HdfR 1.23e-03 NA NA 0.4139
6. F Q8ZAA7 HTH-type transcriptional regulator HdfR 1.12e-03 NA NA 0.4439
6. F B7L8A6 HTH-type transcriptional regulator HdfR 5.15e-04 NA NA 0.4239
6. F Q6B936 Probable RuBisCO transcriptional regulator 5.27e-07 NA NA 0.5341
6. F Q9HW38 HTH-type transcriptional regulator ArgP 7.47e-05 NA NA 0.4953
6. F Q02H78 HTH-type transcriptional regulator ArgP 7.42e-05 NA NA 0.4922
6. F P52669 HTH-type transcriptional regulator TtuA 5.98e-06 NA NA 0.5319
6. F P0AEQ5 Glutamine-binding periplasmic protein 8.58e-04 NA NA 0.4863
6. F P52670 HTH-type transcriptional regulator IlvR 7.79e-05 NA NA 0.4973
6. F O58758 Uncharacterized ABC transporter extracellular-binding protein PH1039 3.09e-02 NA NA 0.3428
6. F P39592 Uncharacterized HTH-type transcriptional regulator YwbI 1.76e-06 NA NA 0.5191
6. F P0ACQ9 HTH-type transcriptional regulator TdcA 3.38e-04 NA NA 0.4631
6. F Q329U3 HTH-type transcriptional regulator HdfR 8.78e-04 NA NA 0.4416
6. F P49518 Probable RuBisCO transcriptional regulator 6.66e-07 NA NA 0.5059
6. F O19892 Probable RuBisCO transcriptional regulator 9.52e-07 NA NA 0.5058
6. F P02911 Lysine/arginine/ornithine-binding periplasmic protein 4.72e-03 NA NA 0.4754
6. F B4E8V9 HTH-type transcriptional regulator CysB 2.85e-05 NA NA 0.4803
6. F Q55459 HTH-type transcriptional activator CmpR 2.68e-06 NA NA 0.555
6. F P9WMF2 Uncharacterized HTH-type transcriptional regulator MT2340 2.24e-06 NA NA 0.4993
6. F P52685 Mau operon transcriptional activator 1.88e-04 NA NA 0.4433
6. F Q0TAV4 HTH-type transcriptional regulator HdfR 1.08e-03 NA NA 0.4272
6. F O32186 Uncharacterized HTH-type transcriptional regulator YusT 6.86e-06 NA NA 0.5303
6. F P0A4T7 HTH-type transcriptional regulator PcaQ 1.85e-04 NA NA 0.4572
6. F Q9F1R2 HTH-type transcriptional activator CmpR 5.27e-06 NA NA 0.4935
6. F B7M5B2 HTH-type transcriptional regulator HdfR 4.16e-04 NA NA 0.4236
6. F Q8ZPP6 Tetrathionate sensor histidine kinase TtrS 1.71e-02 NA NA 0.3743
6. F P52690 HTH-type transcriptional regulator CbbR 7.34e-06 NA NA 0.4893
6. F P72294 Octopine catabolism/uptake operon regulatory protein OccR 4.33e-05 NA NA 0.499
6. F Q85G62 Probable RuBisCO transcriptional regulator 5.38e-06 NA NA 0.5004
6. F B7LUJ5 HTH-type transcriptional regulator HdfR 1.19e-03 NA NA 0.4226
6. F P10183 HTH-type transcriptional activator NahR 1.83e-04 NA NA 0.4614
6. F O33945 Probable cat1 operon transcriptional activator 2.06e-05 NA NA 0.4439
6. F B1JQ39 HTH-type transcriptional regulator HdfR 5.36e-05 NA NA 0.4696
6. F P59369 HTH-type transcriptional regulator HdfR 7.60e-04 NA NA 0.42
6. F P25544 RuBisCO operon transcriptional regulator 3.07e-06 NA NA 0.5477
6. F P0A9G3 Transcriptional activator protein NhaR 1.04e-05 NA NA 0.4547
6. F P45600 HTH-type transcriptional regulator CysB 1.55e-05 NA NA 0.4455
6. F O35038 HTH-type transcriptional regulator YtlI 3.42e-05 NA NA 0.4735
6. F Q08598 HTH-type transcriptional regulator cbl 3.76e-05 NA NA 0.4694
6. F P18561 HTH-type transcriptional regulator SyrM 3.26e-05 NA NA 0.4318
6. F P71025 HTH-type transcriptional regulator CzcR 1.50e-06 NA NA 0.5201
6. F B1X9Y2 HTH-type transcriptional regulator HdfR 1.18e-03 NA NA 0.4259
6. F C3LRZ9 HTH-type transcriptional regulator ArgP 1.13e-05 NA NA 0.4436
6. F P70785 HTH-type transcriptional regulator TtuA 5.04e-05 NA NA 0.5138
6. F Q81VJ1 HTH-type transcriptional regulator CzcR 1.58e-06 NA NA 0.4959
6. F Q8FBU9 HTH-type transcriptional regulator YidZ 5.22e-04 NA NA 0.423
6. F P74422 Probable nitrogen assimilation transcriptional activator 8.65e-07 NA NA 0.5152
6. F B2TU26 HTH-type transcriptional regulator HdfR 7.26e-05 NA NA 0.4264
6. F P67668 Uncharacterized HTH-type transcriptional regulator Mb2303c 1.76e-06 NA NA 0.4988
6. F P0ACR5 Uncharacterized HTH-type transcriptional regulator YeiE 1.33e-06 NA NA 0.5272
6. F P52691 Probable HTH-type transcriptional regulator LrrA 6.29e-06 NA NA 0.5032
6. F P16400 Malolactic fermentation system transcriptional activator 4.74e-05 NA NA 0.4045
6. F P0ACQ5 Hydrogen peroxide-inducible genes activator 7.70e-05 NA NA 0.464
6. F C4ZYY9 HTH-type transcriptional regulator YidZ 1.81e-04 NA NA 0.4215
6. F B4TAV5 HTH-type transcriptional regulator YidZ 1.52e-04 NA NA 0.413
6. F Q05840 HTH-type transcriptional regulator ClcR 8.71e-05 NA NA 0.4724
6. F P52679 PCP degradation transcriptional activation protein 4.77e-05 NA NA 0.4859
6. F P0ACR3 Uncharacterized HTH-type transcriptional regulator YdhB 2.82e-05 NA NA 0.4739
6. F P9WMF6 Uncharacterized HTH-type transcriptional regulator MT0391 7.30e-06 NA NA 0.4866
6. F B5EYX8 HTH-type transcriptional regulator YidZ 1.59e-04 NA NA 0.4024
6. F A2CI69 Probable RuBisCO transcriptional regulator 5.96e-06 NA NA 0.4967
6. F Q6HPH4 HTH-type transcriptional regulator CzcR 1.44e-06 NA NA 0.4951
6. F P44418 Hydrogen peroxide-inducible genes activator 9.16e-06 NA NA 0.5149
6. F Q4G384 Probable RuBisCO transcriptional regulator 5.56e-07 NA NA 0.51
6. F P0A234 Phosphoglycerate transport regulatory protein PgtC 3.85e-04 NA NA 0.3373
6. F A4TRF4 HTH-type transcriptional regulator HdfR 6.23e-05 NA NA 0.4779
6. F P94387 Uncharacterized HTH-type transcriptional regulator YcgK 6.59e-05 NA NA 0.485
6. F P20667 HTH-type transcriptional regulator CatR 1.28e-05 NA NA 0.4379
6. F Q3YWK2 HTH-type transcriptional regulator YidZ 2.25e-04 NA NA 0.4511
6. F Q1CNN4 HTH-type transcriptional regulator HdfR 5.35e-04 NA NA 0.4365
6. F P0AEU1 Histidine-binding periplasmic protein 3.45e-03 NA NA 0.4291
6. F Q06610 RuBisCO operon transcriptional regulator 2.61e-06 NA NA 0.5537
6. F Q9KPI4 Uncharacterized HTH-type transcriptional regulator VC_2383 4.27e-05 NA NA 0.442
6. F A5F9F1 HTH-type transcriptional regulator ArgP 1.05e-05 NA NA 0.4388
6. F P33651 HTH-type transcriptional regulator BlaA 5.17e-03 NA NA 0.4386
6. F Q00678 Regulatory protein NocR 1.93e-05 NA NA 0.4667
6. F O34701 Uncharacterized HTH-type transcriptional regulator YoaU 3.73e-04 NA NA 0.4902
6. F P0AEQ4 Glutamine-binding periplasmic protein 8.37e-04 NA NA 0.4964
6. F P45091 ABC transporter arginine-binding protein 1.96e-03 NA NA 0.4472
6. F A0R8S0 HTH-type transcriptional regulator CzcR 1.69e-06 NA NA 0.4817
6. F P52667 HTH-type transcriptional regulator EstR 5.86e-05 NA NA 0.4852
6. F Q9ZN79 HTH-type transcriptional regulator LinR 3.27e-05 NA NA 0.472
6. F P0A4T6 HTH-type transcriptional regulator PcaQ 1.55e-04 NA NA 0.4536
6. F A9R8E7 HTH-type transcriptional regulator HdfR 5.69e-04 NA NA 0.4916
6. F P43160 Small neutral protease regulatory protein 1.03e-03 NA NA 0.44
6. F O78432 Probable RuBisCO transcriptional regulator 7.38e-07 NA NA 0.5098
6. F Q8RQM5 Lysine export transcriptional regulatory protein LysG 4.85e-05 NA NA 0.4767
6. F Q5N5I5 HTH-type transcriptional activator CmpR 5.22e-06 NA NA 0.5194
6. F A7ZTR6 HTH-type transcriptional regulator YidZ 2.33e-04 NA NA 0.4264
6. F O68014 HTH-type transcriptional regulator BenM 5.66e-06 NA NA 0.4978
6. F A7FD20 HTH-type transcriptional regulator HdfR 2.02e-04 NA NA 0.4361
6. F B7NF72 HTH-type transcriptional regulator HdfR 5.42e-04 NA NA 0.4164
6. F P96725 Uncharacterized HTH-type transcriptional regulator YwqM 1.30e-06 NA NA 0.4869
6. F Q8YQ82 Probable RuBisCO transcriptional regulator 3.43e-05 NA NA 0.4605
6. F P42722 HTH-type transcriptional regulator CfxR 2.84e-06 NA NA 0.5492
6. F Q9HWH8 HTH-type transcriptional regulator NmoR 2.20e-04 NA NA 0.4826
6. F P52692 Transcriptional activator protein NhaR 1.22e-04 NA NA 0.4693
6. F P37499 Uncharacterized HTH-type transcriptional regulator YybE 3.48e-06 NA NA 0.5249
6. F Q04778 HTH-type transcriptional regulator AlsR 2.50e-06 NA NA 0.4382
6. F Q66G51 HTH-type transcriptional regulator HdfR 3.87e-04 NA NA 0.4848
6. F B2JZG4 HTH-type transcriptional regulator HdfR 6.30e-05 NA NA 0.4735
6. F O34685 HTH-type transcriptional regulator YofA 9.97e-06 NA NA 0.5134
6. F Q578M8 Putative binding protein BruAb2_0484 2.43e-02 NA NA 0.332
6. F B4TN13 HTH-type transcriptional regulator YidZ 1.61e-04 NA NA 0.4189
6. F P0A8S0 HTH-type transcriptional regulator HdfR 4.59e-04 NA NA 0.4278
6. F B7L852 HTH-type transcriptional regulator YidZ 2.17e-04 NA NA 0.4295
6. F Q3K7N4 HTH-type transcriptional regulator ArgP 6.82e-06 NA NA 0.4913
6. F P0AEU2 Histidine-binding periplasmic protein 3.87e-03 NA NA 0.4437
6. F Q8XB23 HTH-type transcriptional regulator YidZ 2.33e-05 NA NA 0.4354
6. F Q9X5P2 Probable hydrogen peroxide-inducible genes activator 3.73e-06 NA NA 0.5214
6. F P55733 HTH-type transcriptional regulator SyrM 2 1.86e-04 NA NA 0.3799
6. F P55181 Uncharacterized HTH-type transcriptional regulator YxjO 2.57e-04 NA NA 0.4448
6. F O06703 HTH-type transcriptional regulator BbuR 7.59e-06 NA NA 0.4445
6. F P39127 HTH-type transcriptional regulator CitR 1.21e-05 NA NA 0.4937
6. F P52661 HTH-type transcriptional regulator GbpR 2.32e-05 NA NA 0.4446
6. F A7ZTW7 HTH-type transcriptional regulator HdfR 1.06e-03 NA NA 0.421
6. F Q81IX0 HTH-type transcriptional regulator CzcR 1.30e-06 NA NA 0.4961
6. F P44876 Uncharacterized HTH-type transcriptional regulator HI_0775 2.15e-06 NA NA 0.5377
6. F Q8FK66 HTH-type transcriptional activator AllS 9.98e-05 NA NA 0.4489
6. F P48271 Probable RuBisCO transcriptional regulator 4.57e-06 NA NA 0.5214
6. F B1IX27 HTH-type transcriptional regulator YidZ 1.83e-04 NA NA 0.4247
6. F B4E8S9 HTH-type transcriptional regulator SsuR 2.10e-04 NA NA 0.4813
6. F P29822 Lactose-binding protein 5.35e-03 NA NA 0.3718
6. F Q9X725 Hydrogen peroxide-inducible genes activator 1.16e-05 NA NA 0.4873
6. F O06989 Maltodextrin-binding protein MdxE 6.16e-02 NA NA 0.3127
6. F B6I3U4 HTH-type transcriptional regulator YidZ 1.67e-04 NA NA 0.4437
6. F P0A2Q5 HTH-type transcriptional regulator MetR 2.38e-05 NA NA 0.4337
6. F B5EZ22 HTH-type transcriptional regulator HdfR 7.77e-04 NA NA 0.4356
6. F Q87LL6 HTH-type transcriptional regulator ArgP 1.35e-04 NA NA 0.4446
6. F O33812 Uncharacterized HTH-type transcriptional regulator in lacR 5'region (Fragment) 1.33e-05 NA NA 0.4841
6. F B5QUQ7 HTH-type transcriptional regulator YidZ 4.83e-04 NA NA 0.3944
6. F P71318 Hydrogen peroxide-inducible genes activator 1.12e-05 NA NA 0.5036
6. F Q8Z2P0 HTH-type transcriptional regulator YidZ 1.31e-04 NA NA 0.4125
6. F P59213 Maltooligosaccharide ABC transporter solute-binding lipoprotein 6.47e-02 NA NA 0.3263
6. F Q328Z9 HTH-type transcriptional regulator YidZ 1.71e-04 NA NA 0.4267
6. F A8A6H3 HTH-type transcriptional regulator YidZ 1.67e-04 NA NA 0.4251
6. F P25545 HTH-type transcriptional regulator CbbR 6.19e-06 NA NA 0.5188
6. F P52678 Probable hydrogen peroxide-inducible genes activator 7.59e-06 NA NA 0.4887
6. F Q44311 HTH-type transcriptional regulator SoxR 3.71e-06 NA NA 0.5191
6. F Q0SYV7 HTH-type transcriptional regulator HdfR 1.19e-03 NA NA 0.4241
6. F B7MGH6 HTH-type transcriptional regulator HdfR 1.19e-03 NA NA 0.4231
6. F P52686 SDS degradation transcriptional activation protein 4.81e-04 NA NA 0.4576
6. F Q53684 Uncharacterized lipoprotein in oleD 5'region 2.40e-02 NA NA 0.3245
6. F B5FN16 HTH-type transcriptional regulator YidZ 1.53e-04 NA NA 0.4134
6. F P56885 HTH-type transcriptional regulator CbbR 2.44e-06 NA NA 0.5351
6. F O06702 UPF0065 protein BB4329 2.32e-03 NA NA 0.4799
6. F Q1R4H3 HTH-type transcriptional regulator HdfR 1.32e-03 NA NA 0.4269
6. F P07774 HTH-type transcriptional regulator CatM 4.63e-06 NA NA 0.4373
6. F P0A9F5 HTH-type transcriptional regulator CysB 1.71e-05 NA NA 0.4556
6. F P45349 HTH-type transcriptional regulator MetR 4.17e-06 NA NA 0.5434
6. F P0A2Q1 HTH-type transcriptional regulator HdfR 6.53e-04 NA NA 0.441
6. F P27102 HTH-type transcriptional regulator TcbR 4.84e-05 NA NA 0.4677
6. F B4SYB4 HTH-type transcriptional regulator YidZ 1.44e-04 NA NA 0.4087
6. F P52595 HTH-type transcriptional regulator CbbR 9.14e-06 NA NA 0.5422
6. F P94501 HTH-type transcriptional regulator GltR 9.66e-07 NA NA 0.5103
6. F Q2IN45 Phosphonates import ATP-binding protein PhnC 1.53e-04 NA NA 0.5167
6. F P0ACR8 Uncharacterized HTH-type transcriptional regulator YfeR 6.04e-06 NA NA 0.5315