Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54788.1
JCVISYN3A_0426
Phosphate ABC transporter permease.
M. mycoides homolog: Q6MTC2.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 40
Unique PROST Go: 2
Unique BLAST Go: 4
Unique Foldseek Go: 12
Total Homologs: 173
Unique PROST Homologs: 2
Unique BLAST Homologs: 15
Unique Foldseek Homologs: 94
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P47651
(Phosphate transport system permease protein PstA homolog) with a FATCAT P-Value: 0 and RMSD of 2.99 angstrom. The sequence alignment identity is 29.8%.
Structural alignment shown in left. Query protein AVX54788.1 colored as red in alignment, homolog P47651 colored as blue.
Query protein AVX54788.1 is also shown in right top, homolog P47651 showed in right bottom. They are colored based on secondary structures.
AVX54788.1 MLFKKITNNVQFRMIKQKKETSFVCLKSIIITLT-IFVLLAL---VILL------G--FVMIKTNVLFNKQSFFEFVFGKNWSPDSKQFGILTITLMTLI 88 P47651 MQ-KKIKK----RL---KKEN---LLRIFSKTLAFLFLVLFISFFVFLLTEATKIGPDFA--KS--LFN----LEFNLG-N-----KQAGIWFPLLVSFI 75 AVX54788.1 LIFISMLIAVPLTIFTSFFISEYLTLK---SQKVTITIIKLLAGIPSVVFGLFAREQIGALF-----KLMGASSNDNLM--VASLTMAFMAIPIMISLSY 178 P47651 VSIGALIIASYIGVRTSFFL-VY-RCKPKIRKKLSL-IIDILSGIPSVIFGLFAS-QILSIFFRDILKLPPLS----LLNVIAMLS--FMIIPIVISLT- 164 AVX54788.1 DAIKSVPFIYRD-ASLALGISKEKTT--FNIIRKSATPKIISAVILGMARVIGETMAIMMIAGNSTAWFDT-NNGVSGFLFSSIRTLSSTIGLEML--EN 272 P47651 --TNTLTYVNNDLISVVVSLGENKTSAIYKIIKKEIKPQLTVILTLAFARAISETMAVNFVL-QSVNYQEVINN--NRFFTSDLKTLGSVIST-FIFSEN 258 AVX54788.1 SS-SLHESALYAIGMFLFILVFIINLLILFVSNKNSIS-----KKI-----HLVLF-KNKKTHKIK--HVKL-YQKQTLDQI-ITNRTENKL-FK-KIYS 354 P47651 GDEQIN-GVLYIFGIIILILVSLLNFFAIWSANPKTLERYPFLKKISNFIYQVVWFIPN----NISALFVDLTSTRQSVKKIKVNNINERSLFFKERLQS 353 AVX54788.1 TIMLVLMWLSISFVI-MF-----TF----WIVFTTIF---NGLSSLKYS---EAFLTIEGED-GIFAAILTTLLLILCTLLFAIPLALACAIYLSEFANK 437 P47651 -----VVWIKLNYFLKIFQELICTFLAFGFVLAILLFVFING--SVAINNNGSTVFSFEADSTG--RALVNTLVIILITITITFPLALLIAIWLNEY-N- 442 AVX54788.1 NSYFAK-FFRFLLNLAASTPSIIFGIFGLSVFIIYLKLPF------SIFSASITMTIVVLPMLIKNFEDALTSVPLSYREAAIALGLSKTKTLFKIVLPN 530 P47651 NSKVVKNVFNFVIDSLSSMPSIIYGLFGLSFFLRVLQLSAGGANGTSLIAGILTISVVILLFLIRTCQQALNNVSWDLRISAFALGISKREVIFKIVLPS 542 AVX54788.1 ALQAIITGTILAMARIIGESAPIYLTLGTAIKYPDRGF-LS-SGSTLTTGIY-KIASESAPGQGNDIAWLM---SLITIIFVLTLNLSSSKL--SLLLVK 622 P47651 ALKGLIVALILSINRIIAETAPFFITSGLS---SSNLFHLSLPGQTLTTRIYGQLFS----INSNAIS-VMLETSLVSVVFLILLIFFSSYLIPSLFLLN 634 AVX54788.1 TNK----KVKFE-FKQIYKNFINKQFYKTQFNLFKNSLKQFIKSLKKYLNITNLFKEIKKTIKYKKEYKKLKKRDNNYE 696 P47651 KQKWLVIKSKFQSFK-LWKRT---------------------------------------------------------- 654
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0022857 | transmembrane transporter activity |
| 1. PBF | GO:0005315 | inorganic phosphate transmembrane transporter activity |
| 1. PBF | GO:0055085 | transmembrane transport |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0005887 | integral component of plasma membrane |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0035435 | phosphate ion transmembrane transport |
| 1. PBF | GO:0006817 | phosphate ion transport |
| 1. PBF | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
| 2. PF | GO:0015888 | thiamine transport |
| 2. PF | GO:0015716 | organic phosphonate transport |
| 2. PF | GO:0015416 | ABC-type phosphonate transporter activity |
| 2. PF | GO:0006811 | ion transport |
| 2. PF | GO:0055072 | iron ion homeostasis |
| 3. BF | GO:0031969 | chloroplast membrane |
| 3. BF | GO:0015419 | ABC-type sulfate transporter activity |
| 3. BF | GO:0015112 | nitrate transmembrane transporter activity |
| 3. BF | GO:0031460 | glycine betaine transport |
| 3. BF | GO:0048473 | D-methionine transport |
| 3. BF | GO:0015098 | molybdate ion transmembrane transporter activity |
| 3. BF | GO:0006865 | amino acid transport |
| 3. BF | GO:0042170 | plastid membrane |
| 5. P | GO:0015234 | thiamine transmembrane transporter activity |
| 5. P | GO:0071934 | thiamine transmembrane transport |
| 6. F | GO:0033223 | 2-aminoethylphosphonate transport |
| 6. F | GO:0042956 | maltodextrin transport |
| 6. F | GO:0015675 | nickel cation transport |
| 6. F | GO:0008643 | carbohydrate transport |
| 6. F | GO:0015423 | ABC-type maltose transporter activity |
| 6. F | GO:0042128 | nitrate assimilation |
| 6. F | GO:0015774 | polysaccharide transport |
| 6. F | GO:0015199 | amino-acid betaine transmembrane transporter activity |
| 6. F | GO:1990060 | maltose transport complex |
| 6. F | GO:0015226 | carnitine transmembrane transporter activity |
| 6. F | GO:0015768 | maltose transport |
| 6. F | GO:0015879 | carnitine transport |
| 7. B | GO:0008272 | sulfate transport |
| 7. B | GO:0010921 | regulation of phosphatase activity |
| 7. B | GO:0051701 | biological process involved in interaction with host |
| 7. B | GO:0009314 | response to radiation |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0005315 | inorganic phosphate transmembrane transporter activity |
| GO:0055085 | transmembrane transport |
| GO:0005887 | integral component of plasma membrane |
| GO:0016021 | integral component of membrane |
| GO:0005886 | plasma membrane |
| GO:0035435 | phosphate ion transmembrane transport |
| GO:0016020 | membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P75185 | Phosphate transport system permease protein PstA homolog | 0.00e+00 | 9.38e-23 | 4.98e-49 | 0.8268 |
| 1. PBF | P47651 | Phosphate transport system permease protein PstA homolog | 0.00e+00 | 5.49e-19 | 1.02e-38 | 0.8195 |
| 2. PF | P71338 | Fe(3+)-transport system permease protein FbpB 2 | 2.42e-14 | 5.49e-08 | NA | 0.7532 |
| 2. PF | Q8FYV0 | Thiamine transport system permease protein ThiP | 2.93e-14 | 3.56e-09 | NA | 0.7483 |
| 2. PF | P44985 | Thiamine transport system permease protein ThiP | 0.00e+00 | 9.24e-07 | NA | 0.706 |
| 2. PF | P75369 | ABC transport system permease protein p69 | 1.09e-10 | 2.05e-05 | NA | 0.4943 |
| 2. PF | Q57BC3 | Thiamine transport system permease protein ThiP | 3.05e-14 | 2.75e-12 | NA | 0.7458 |
| 2. PF | P21409 | Fe(3+)-transport system permease protein SfuB | 8.29e-13 | 2.78e-09 | NA | 0.7424 |
| 2. PF | A0QQ68 | Phosphate-import permease protein PhnE | 3.13e-09 | 1.04e-02 | NA | 0.5707 |
| 2. PF | P47533 | ABC transport system permease protein p69 | 5.78e-10 | 7.03e-08 | NA | 0.5227 |
| 2. PF | Q8YJ03 | Thiamine transport system permease protein ThiP | 0.00e+00 | 1.12e-12 | NA | 0.7343 |
| 2. PF | P15362 | ABC transport system permease protein p69 | 4.51e-10 | 4.12e-08 | NA | 0.5535 |
| 2. PF | P55452 | Probable ABC transporter permease protein y4fN | 2.44e-15 | 2.25e-08 | NA | 0.7026 |
| 2. PF | Q8ZRV1 | Thiamine transport system permease protein ThiP | 3.77e-15 | 4.11e-07 | NA | 0.7633 |
| 2. PF | Q2YLW7 | Thiamine transport system permease protein ThiP | 2.25e-14 | 2.75e-12 | NA | 0.7464 |
| 3. BF | P0A627 | Phosphate transport system permease protein PstA 2 | 2.91e-12 | NA | 9.87e-22 | 0.7946 |
| 3. BF | Q98FL4 | Phosphate transport system permease protein PstA | 3.33e-16 | NA | 1.24e-15 | 0.8788 |
| 3. BF | P0AGI0 | Phosphate transport system permease protein PstC | 7.11e-15 | NA | 3.22e-21 | 0.7688 |
| 3. BF | Q9TKU8 | Probable sulfate transport system permease protein cysT | 3.16e-13 | NA | 0.004 | 0.704 |
| 3. BF | Q8X800 | D-methionine transport system permease protein MetI | 4.44e-10 | NA | 0.006 | 0.7857 |
| 3. BF | Q8ZRN0 | D-methionine transport system permease protein MetI | 4.43e-10 | NA | 0.011 | 0.7603 |
| 3. BF | P26246 | Probable sulfate transport system permease protein cysT | 1.11e-12 | NA | 0.001 | 0.7279 |
| 3. BF | P0A631 | Phosphate transport system permease protein PstC 2 | 3.30e-11 | NA | 6.58e-16 | 0.7337 |
| 3. BF | Q50097 | Phosphate transport system permease protein PstA | 1.11e-16 | NA | 6.56e-18 | 0.7374 |
| 3. BF | Q9V2C1 | Molybdate/tungstate transport system permease protein WtpB | 1.53e-12 | NA | 0.006 | 0.6328 |
| 3. BF | P45322 | Molybdenum transport system permease protein ModB | 2.21e-10 | NA | 3.77e-06 | 0.7136 |
| 3. BF | Q9CNJ6 | Phosphate transport system permease protein PstA | 0.00e+00 | NA | 8.96e-25 | 0.8709 |
| 3. BF | Q50098 | Phosphate transport system permease protein PstC | 8.88e-16 | NA | 2.59e-16 | 0.7272 |
| 3. BF | Q87C89 | Phosphate transport system permease protein PstA | 5.44e-15 | NA | 2.91e-22 | 0.8156 |
| 3. BF | Q9PBK2 | Phosphate transport system permease protein PstC | 1.11e-16 | NA | 6.61e-23 | 0.7773 |
| 3. BF | P46339 | Probable ABC transporter permease protein YqgH | 3.33e-16 | NA | 2.88e-30 | 0.8748 |
| 3. BF | P0AF02 | Molybdenum transport system permease protein ModB | 3.51e-11 | NA | 1.21e-04 | 0.731 |
| 3. BF | Q9CNJ5 | Phosphate transport system permease protein PstC | 1.67e-15 | NA | 1.70e-21 | 0.7794 |
| 3. BF | P9WG06 | Phosphate transport system permease protein PstC 1 | 2.66e-15 | NA | 6.12e-21 | 0.7254 |
| 3. BF | P45191 | Phosphate transport system permease protein PstC | 0.00e+00 | NA | 5.87e-20 | 0.7872 |
| 3. BF | P18795 | Probable transport system permease protein NifC | 1.12e-13 | NA | 0.008 | 0.6771 |
| 3. BF | Q5MZ55 | Bicarbonate transport system permease protein CmpB | 6.59e-07 | NA | 0.025 | 0.6174 |
| 3. BF | Q6QJE2 | Sulfate permease 2, chloroplastic | 2.07e-09 | NA | 0.048 | 0.7016 |
| 3. BF | Q9TJR4 | Probable sulfate transport system permease protein cysT | 1.09e-12 | NA | 3.79e-04 | 0.718 |
| 3. BF | Q55106 | Bicarbonate transport system permease protein CmpB | 8.86e-07 | NA | 0.025 | 0.6161 |
| 3. BF | D4GSY8 | Probable anion ABC transporter permease protein HVO_1887 | 7.61e-11 | NA | 4.12e-05 | 0.7272 |
| 3. BF | Q9PBK1 | Phosphate transport system permease protein PstA | 5.55e-15 | NA | 3.35e-22 | 0.8141 |
| 3. BF | P9WG08 | Phosphate transport system permease protein PstA 2 | 2.73e-12 | NA | 9.87e-22 | 0.8138 |
| 3. BF | P9WG04 | Phosphate transport system permease protein PstC 2 | 5.28e-11 | NA | 6.58e-16 | 0.7196 |
| 3. BF | P41032 | Sulfate transport system permease protein CysT | 8.33e-13 | NA | 9.51e-05 | 0.729 |
| 3. BF | P9WG10 | Phosphate transport system permease protein PstA 1 | 1.20e-11 | NA | 8.06e-18 | 0.7352 |
| 3. BF | P56343 | Probable sulfate transport system permease protein cysT | 6.37e-13 | NA | 6.91e-04 | 0.7289 |
| 3. BF | Q8ZPK1 | Osmoprotectant import permease protein OsmY | 1.52e-08 | NA | 6.17e-05 | 0.7277 |
| 3. BF | Q98FL3 | Phosphate transport system permease protein PstC | 2.22e-16 | NA | 1.03e-23 | 0.7971 |
| 3. BF | A2CI71 | Probable sulfate transport system permease protein cysT | 3.00e-10 | NA | 3.67e-06 | 0.7234 |
| 3. BF | P0A629 | Phosphate transport system permease protein PstC 1 | 2.33e-15 | NA | 6.12e-21 | 0.7375 |
| 3. BF | P0AGH9 | Phosphate transport system permease protein PstC | 1.04e-14 | NA | 3.22e-21 | 0.7732 |
| 3. BF | P45190 | Phosphate transport system permease protein PstA | 7.77e-16 | NA | 1.50e-23 | 0.8468 |
| 3. BF | Q8U4K4 | Molybdate/tungstate transport system permease protein WtpB | 1.12e-12 | NA | 9.44e-06 | 0.7592 |
| 3. BF | Q8Z991 | D-methionine transport system permease protein MetI | 5.23e-10 | NA | 0.017 | 0.7599 |
| 3. BF | P46340 | Probable ABC transporter permease protein YqgI | 8.88e-16 | NA | 6.21e-26 | 0.795 |
| 3. BF | P58655 | Phosphate transport system permease protein PstA | 3.33e-16 | NA | 9.58e-25 | 0.8503 |
| 3. BF | P0A625 | Molybdenum transport system permease protein ModB | 1.65e-11 | NA | 0.008 | 0.6943 |
| 3. BF | P9WG12 | Molybdenum transport system permease protein ModB | 1.94e-11 | NA | 0.008 | 0.7196 |
| 3. BF | Q9MUL9 | Probable sulfate transport system permease protein cysT | 9.62e-13 | NA | 8.57e-05 | 0.742 |
| 3. BF | Q32RF7 | Probable sulfate transport system permease protein cysT | 4.79e-13 | NA | 7.21e-05 | 0.6584 |
| 3. BF | Q87C90 | Phosphate transport system permease protein PstC | 1.11e-16 | NA | 7.03e-22 | 0.762 |
| 5. P | P31549 | Thiamine transport system permease protein ThiP | 1.55e-15 | 8.57e-08 | NA | NA |
| 5. P | P76224 | Inner membrane ABC transporter permease protein YnjC | 6.33e-15 | 4.58e-07 | NA | NA |
| 6. F | P0A2J8 | Spermidine/putrescine transport system permease protein PotB | 1.37e-12 | NA | NA | 0.711 |
| 6. F | O57893 | Molybdate/tungstate transport system permease protein WtpB | 1.43e-12 | NA | NA | 0.7673 |
| 6. F | P40980 | Putative ABC transporter permease protein ORF2 | 1.64e-08 | NA | NA | 0.6848 |
| 6. F | P0CL49 | Spermidine/putrescine transport system permease protein PotB | 1.12e-12 | NA | NA | 0.5944 |
| 6. F | P96064 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 4.29e-12 | NA | NA | 0.5907 |
| 6. F | P94529 | Arabinooligosaccharides transport system permease protein AraP | 3.71e-08 | NA | NA | 0.6297 |
| 6. F | Q8RVC7 | Sulfate permease 1, chloroplastic | 1.09e-06 | NA | NA | 0.7227 |
| 6. F | P45169 | Spermidine/putrescine transport system permease protein PotC | 2.78e-12 | NA | NA | 0.7464 |
| 6. F | Q45461 | Choline transport system permease protein OpuBB | 6.24e-07 | NA | NA | 0.7063 |
| 6. F | Q9KHT8 | Carnitine transport permease protein OpuCB | 1.20e-07 | NA | NA | 0.7617 |
| 6. F | Q9CK96 | Probable D-methionine transport system permease protein MetI | 2.88e-05 | NA | NA | 0.7505 |
| 6. F | D4GQ17 | Probable molybdenum ABC transporter permease protein HVO_B0370 | 1.36e-09 | NA | NA | 0.6992 |
| 6. F | Q8Z8W9 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 4.45e-12 | NA | NA | 0.5912 |
| 6. F | P39775 | Choline transport system permease protein OpuBD | 1.90e-07 | NA | NA | 0.7482 |
| 6. F | P96065 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 1.49e-13 | NA | NA | 0.747 |
| 6. F | Q8Z8X0 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 3.52e-13 | NA | NA | 0.7599 |
| 6. F | Q8ZH39 | D-methionine transport system permease protein MetI | 5.01e-10 | NA | NA | 0.8086 |
| 6. F | P18812 | Maltose/maltodextrin transport system permease protein MalF | 6.14e-04 | NA | NA | 0.6376 |
| 6. F | Q8Z1U2 | Maltose/maltodextrin transport system permease protein MalF | 1.73e-03 | NA | NA | 0.6322 |
| 6. F | P75057 | Spermidine/putrescine transport system permease protein PotC homolog | 1.54e-09 | NA | NA | 0.6389 |
| 6. F | Q97UZ0 | Glucose import system permease protein GlcT | 1.61e-12 | NA | NA | 0.6596 |
| 6. F | P73451 | Nitrate import permease protein NrtB | 1.59e-06 | NA | NA | 0.6939 |
| 6. F | O06990 | Maltodextrin transport system permease protein MdxF | 1.30e-06 | NA | NA | 0.4065 |
| 6. F | P55603 | Probable ABC transporter permease protein y4oR | 1.87e-08 | NA | NA | 0.6545 |
| 6. F | Q8ZPK3 | Osmoprotectant import permease protein OsmW | 6.04e-08 | NA | NA | 0.7837 |
| 6. F | P74547 | Sulfate transport system permease protein CysW | 2.73e-12 | NA | NA | 0.7169 |
| 6. F | Q83RR7 | Spermidine/putrescine transport system permease protein PotC | 1.01e-12 | NA | NA | 0.6737 |
| 6. F | P37731 | Molybdenum transport system permease protein ModB | 4.57e-11 | NA | NA | 0.7411 |
| 6. F | O07011 | Galactooligosaccharides transport system permease protein GanQ | 1.82e-09 | NA | NA | 0.6767 |
| 6. F | O31519 | Probable ABC transporter permease protein YesP | 2.37e-08 | NA | NA | 0.6096 |
| 6. F | P38044 | Nitrate import permease protein NrtB | 4.57e-07 | NA | NA | 0.6976 |
| 6. F | O32155 | Probable ABC transporter permease protein YurN | 7.96e-12 | NA | NA | 0.6572 |
| 6. F | O50501 | Diacetylchitobiose uptake system permease protein NgcG | 1.84e-07 | NA | NA | 0.5976 |
| 6. F | P46492 | Probable D-methionine transport system permease protein MetI | 6.12e-11 | NA | NA | 0.8492 |
| 6. F | Q6CZ32 | sn-glycerol-3-phosphate transport system permease protein UgpA | 4.71e-12 | NA | NA | 0.6697 |
| 6. F | P0AFS0 | Inner membrane ABC transporter permease protein YdcV | 7.32e-12 | NA | NA | 0.8008 |
| 6. F | Q9K489 | Diacetylchitobiose uptake system permease protein DasC | 1.78e-08 | NA | NA | 0.6706 |
| 6. F | D4GP36 | Xylose/arabinose import permease protein XacH | 2.41e-08 | NA | NA | 0.6155 |
| 6. F | G2JZ41 | Carnitine transport permease protein OpuCD | 1.14e-06 | NA | NA | 0.7529 |
| 6. F | Q576D9 | Probable ABC transporter permease protein BruAb2_1124 | 7.50e-07 | NA | NA | 0.6934 |
| 6. F | P75263 | Probable ABC transporter permease protein MG188 homolog | 1.54e-07 | NA | NA | 0.5729 |
| 6. F | P27370 | Sulfate transport system permease protein CysW | 1.19e-10 | NA | NA | 0.7354 |
| 6. F | Q44123 | Ferric transport system permease protein FbpB | 0.00e+00 | NA | NA | 0.6606 |
| 6. F | Q5PFQ5 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 1.49e-13 | NA | NA | 0.7454 |
| 6. F | Q08382 | Molybdenum transport system permease protein ModB | 8.15e-11 | NA | NA | 0.7153 |
| 6. F | P47290 | Spermidine/putrescine transport system permease protein PotC homolog | 8.97e-10 | NA | NA | 0.6882 |
| 6. F | P0AFK8 | Spermidine/putrescine transport system permease protein PotC | 5.57e-13 | NA | NA | 0.7098 |
| 6. F | Q9KHT6 | Carnitine transport permease protein OpuCD | 1.07e-06 | NA | NA | 0.753 |
| 6. F | Q9KTJ6 | Probable D-methionine transport system permease protein MetI | 2.34e-05 | NA | NA | 0.7675 |
| 6. F | P27367 | Sulfate transport system permease protein CysT | 3.53e-09 | NA | NA | 0.7391 |
| 6. F | P0AFK5 | Spermidine/putrescine transport system permease protein PotB | 2.89e-12 | NA | NA | 0.6954 |
| 6. F | Q9KL06 | Maltose/maltodextrin transport system permease protein MalF | 1.49e-03 | NA | NA | 0.5999 |
| 6. F | Q8FUN2 | Probable ABC transporter permease protein BRA1188/BS1330_II1179 | 6.94e-07 | NA | NA | 0.6944 |
| 6. F | Q0P886 | Tungstate uptake system permease protein TupB | 9.93e-09 | NA | NA | 0.701 |
| 6. F | Q93KD5 | Tungstate uptake system permease protein TupB | 4.57e-10 | NA | NA | 0.7748 |
| 6. F | Q57341 | Putative ferric transport system permease protein FbpB 1 | 0.00e+00 | NA | NA | 0.6141 |
| 6. F | P0AFL2 | Putrescine transport system permease protein PotI | 3.36e-09 | NA | NA | 0.6836 |
| 6. F | P94530 | Arabinooligosaccharides transport system permease protein AraQ | 7.90e-07 | NA | NA | 0.6396 |
| 6. F | Q323W3 | Glutathione transport system permease protein GsiC | 1.14e-05 | NA | NA | 0.623 |
| 6. F | O34706 | Melibiose/raffinose/stachyose import permease protein MelD | 4.98e-12 | NA | NA | 0.6568 |
| 6. F | O30143 | Molybdate/tungstate transport system permease protein WtpB | 2.88e-12 | NA | NA | 0.7498 |
| 6. F | Q85AI0 | Probable sulfate transport system permease protein cysT | 7.32e-13 | NA | NA | 0.7333 |
| 6. F | Q2EEX6 | Probable sulfate transport system permease protein cysT | 1.15e-12 | NA | NA | 0.7559 |
| 6. F | P55602 | Probable ABC transporter permease protein y4oQ | 5.72e-09 | NA | NA | 0.6 |
| 6. F | Q00750 | Multiple sugar-binding transport system permease protein MsmF | 5.98e-12 | NA | NA | 0.6552 |
| 6. F | P0AFK7 | Spermidine/putrescine transport system permease protein PotC | 1.06e-12 | NA | NA | 0.7028 |
| 6. F | O32154 | Probable ABC transporter permease protein YurM | 1.94e-07 | NA | NA | 0.6543 |
| 6. F | O31520 | Probable ABC transporter permease protein YesQ | 3.76e-07 | NA | NA | 0.6247 |
| 6. F | Q55461 | Bicarbonate transport system permease protein CmpB | 1.05e-06 | NA | NA | 0.6277 |
| 6. F | Q83S26 | Glutathione transport system permease protein GsiC | 1.84e-06 | NA | NA | 0.6742 |
| 6. F | P45170 | Spermidine/putrescine transport system permease protein PotB | 2.10e-12 | NA | NA | 0.5661 |
| 6. F | Q5JEB3 | Molybdate/tungstate transport system permease protein WtpB | 1.07e-12 | NA | NA | 0.7821 |
| 6. F | Q2YJB4 | Probable ABC transporter permease protein BAB2_1148 | 7.95e-07 | NA | NA | 0.6903 |
| 6. F | Q01895 | Sulfate transport system permease protein CysT | 7.40e-10 | NA | NA | 0.7311 |
| 6. F | O69053 | Phosphite transport system permease protein PtxC | 5.51e-07 | NA | NA | 0.5666 |
| 6. F | Q57SD7 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 4.59e-12 | NA | NA | 0.5898 |
| 6. F | Q7A5Q6 | Nickel import system permease protein NikB | 9.78e-06 | NA | NA | 0.5308 |
| 6. F | P0AFR8 | Inner membrane ABC transporter permease protein YcjO | 1.41e-11 | NA | NA | 0.6228 |
| 6. F | O32209 | Putative molybdenum transport system permease protein YvgM | 1.31e-10 | NA | NA | 0.7887 |
| 6. F | O51924 | Trehalose/maltose transport system permease protein MalF | 2.13e-08 | NA | NA | 0.6753 |
| 6. F | O34742 | Glycine betaine/carnitine/choline transport system permease protein OpuCD | 3.17e-05 | NA | NA | 0.7291 |
| 6. F | G2JZ43 | Carnitine transport permease protein OpuCB | 1.98e-07 | NA | NA | 0.7148 |
| 6. F | Q9RR45 | Glycine betaine/carnitine transport permease protein GbuB | 1.28e-07 | NA | NA | 0.5998 |
| 6. F | E1WF94 | Spermidine/putrescine transport system permease protein PotB | 1.43e-12 | NA | NA | 0.703 |
| 6. F | Q57SD8 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 2.22e-13 | NA | NA | 0.7463 |
| 6. F | Q7N984 | Maltose/maltodextrin transport system permease protein MalF | 7.35e-04 | NA | NA | 0.6413 |
| 6. F | O32168 | Methionine import system permease protein MetP | 1.29e-09 | NA | NA | 0.7935 |
| 6. F | P0AEB1 | Sulfate transport system permease protein CysW | 8.36e-14 | NA | NA | 0.6972 |
| 6. F | Q55473 | Osmoprotective compounds uptake permease protein GgtD | 1.70e-09 | NA | NA | 0.658 |
| 6. F | Q51881 | Nitrate import permease protein NrtB | 5.17e-07 | NA | NA | 0.6512 |
| 6. F | Q9KEF0 | Arabinooligosaccharides transport system permease protein AraP | 1.57e-08 | NA | NA | 0.6077 |
| 6. F | Q8YDR8 | Probable ABC transporter permease protein BMEII0107 | 6.39e-07 | NA | NA | 0.695 |
| 6. F | Q5PFQ6 | Putative 2-aminoethylphosphonate transport system permease protein PhnU | 4.23e-12 | NA | NA | 0.6115 |
| 6. F | P37730 | Probable starch degradation products transport system permease protein AmyD | 1.01e-09 | NA | NA | 0.6913 |
| 7. B | P9WG09 | Phosphate transport system permease protein PstA 2 | 2.54e-12 | NA | 9.87e-22 | NA |
| 7. B | P16701 | Sulfate transport system permease protein CysT | 1.11e-12 | NA | 4.03e-04 | NA |
| 7. B | P07654 | Phosphate transport system permease protein PstA | 1.11e-16 | NA | 2.87e-27 | NA |
| 7. B | P9WG07 | Phosphate transport system permease protein PstC 1 | 2.11e-15 | NA | 6.12e-21 | NA |
| 7. B | P0AGH8 | Phosphate transport system permease protein PstC | 8.33e-15 | NA | 3.22e-21 | NA |
| 7. B | Q58419 | Probable phosphate transport system permease protein PstA | 1.55e-15 | NA | 1.39e-16 | NA |
| 7. B | Q58420 | Probable phosphate transport system permease protein PstC | 1.22e-15 | NA | 3.36e-16 | NA |
| 7. B | P0AF01 | Molybdenum transport system permease protein ModB | 4.60e-11 | NA | 1.21e-04 | NA |
| 7. B | P9WG11 | Phosphate transport system permease protein PstA 1 | 1.11e-16 | NA | 8.02e-18 | NA |
| 7. B | P9WG13 | Molybdenum transport system permease protein ModB | 1.66e-11 | NA | 0.008 | NA |
| 7. B | E0SCY2 | Glycine betaine/choline transport system permease protein OusW | 2.86e-05 | NA | 4.15e-04 | NA |
| 7. B | Q8RQL4 | Glutamate transport system permease protein GluD | 1.22e-06 | NA | 0.003 | NA |
| 7. B | Q58763 | Molybdate/tungstate transport system permease protein WtpB | 5.69e-12 | NA | 0.003 | NA |
| 7. B | P48245 | Glutamate transport system permease protein GluD | 1.97e-06 | NA | 0.009 | NA |
| 7. B | P9WG05 | Phosphate transport system permease protein PstC 2 | 6.73e-11 | NA | 6.58e-16 | NA |