Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54791.1
JCVISYN3A_0429

Signal recognition particle-docking protein.
M. mycoides homolog: Q6MTB9.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 45
Unique PROST Go: 11
Unique BLAST Go: 9
Unique Foldseek Go: 0

Total Homologs: 185
Unique PROST Homologs: 14
Unique BLAST Homologs: 38
Unique Foldseek Homologs: 3

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: ftsY; Signal recognition particle receptor FtsY
Zhang et al. [4]: GO:0006614|SRP-dependent cotranslational protein targeting to membrane
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P47539 (Signal recognition particle receptor FtsY) with a FATCAT P-Value: 0 and RMSD of 2.45 angstrom. The sequence alignment identity is 36.3%.
Structural alignment shown in left. Query protein AVX54791.1 colored as red in alignment, homolog P47539 colored as blue. Query protein AVX54791.1 is also shown in right top, homolog P47539 showed in right bottom. They are colored based on secondary structures.

  AVX54791.1 MGFWAKLKEKLIKKTNQVEQDEPILDQQEQQEEQEQIIEKEIEQEPVVNQDIQVEIIKENK-IKKTKTSETKKQ-EKQTETLKEKKKREKQK--EKDKKV 96
      P47539 -----------------------------------------------------MGFL--SKLIAKLK---PKKSVAKQ---LKE--EVEKQSLFQTNNKT 37

  AVX54791.1 -EKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSN-LVRK-KTKRDTSFENIKDALVES--LYQAYTDNDWTNKKYRID--F 189
      P47539 YYQGLKKSATTFAKTINELSKRYVNVDEQFKENLFEGLVLLDVGYHAANKICDAIIEQIKLNRITDFQLIKELIIDQIIVY--YI-QD---KLFDTDLIV 131

  AVX54791.1 KENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKTN-KLNADPASVVFDAIKKAKEQNYDLLLIDT 288
      P47539 KPNFTNVYLFVGVNGVGKTTTLAKIADFFIKQNKRVLLVAGDTFRAGAIEQLNQWAKL-LN--CDIVLPNPKEQT-PA-VIFRGVKKGIDDKYDFVLCDT 226

  AVX54791.1 AGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAE---EFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDL 385
      P47539 SGRLQNKLNLMNELQKIYQIIQKVSGSEPSETLLVLDGTVGQTGLSQAKVFNEFSK---LTGIVLTKMDGSAKGGIILAIKDMFNLPVKLIGFGEKTSDL 323

  AVX54791.1 LAFDIDQYIVHLSSGFMQG---DEVEK 409
      P47539 AIFDLEKYVL----GLLNNLNLDNKEN 346

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0016020 membrane
1. PBF GO:0003924 GTPase activity
1. PBF GO:0031226 intrinsic component of plasma membrane
1. PBF GO:0006605 protein targeting
1. PBF GO:0006614 SRP-dependent cotranslational protein targeting to membrane
1. PBF GO:0005047 signal recognition particle binding
1. PBF GO:0044781 bacterial-type flagellum organization
1. PBF GO:0005525 GTP binding
2. PF GO:0051536 iron-sulfur cluster binding
2. PF GO:0016226 iron-sulfur cluster assembly
3. BF GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
3. BF GO:0019003 GDP binding
3. BF GO:0045047 protein targeting to ER
3. BF GO:0005785 signal recognition particle receptor complex
3. BF GO:0005786 signal recognition particle, endoplasmic reticulum targeting
3. BF GO:0008312 7S RNA binding
3. BF GO:0031017 exocrine pancreas development
3. BF GO:0048500 signal recognition particle
3. BF GO:0016607 nuclear speck
3. BF GO:0005524 ATP binding
3. BF GO:0030851 granulocyte differentiation
3. BF GO:0043021 ribonucleoprotein complex binding
3. BF GO:0030942 endoplasmic reticulum signal peptide binding
3. BF GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
3. BF GO:0030593 neutrophil chemotaxis
5. P GO:0006353 DNA-templated transcription, termination
5. P GO:0008186 ATP-dependent activity, acting on RNA
5. P GO:0140603 obsolete ATP hydrolysis activity
5. P GO:0005886 plasma membrane
5. P GO:0004386 helicase activity
5. P GO:0003678 DNA helicase activity
5. P GO:1990077 primosome complex
5. P GO:0005737 cytoplasm
5. P GO:0051604 protein maturation
5. P GO:0016787 hydrolase activity
5. P GO:0006269 DNA replication, synthesis of RNA primer
7. B GO:0005783 endoplasmic reticulum
7. B GO:0070814 hydrogen sulfide biosynthetic process
7. B GO:0016021 integral component of membrane
7. B GO:0006613 cotranslational protein targeting to membrane
7. B GO:0046872 metal ion binding
7. B GO:0070208 protein heterotrimerization
7. B GO:0005789 endoplasmic reticulum membrane
7. B GO:0000103 sulfate assimilation
7. B GO:0004020 adenylylsulfate kinase activity

Uniprot GO Annotations

GO Description
GO:0005886 plasma membrane
GO:0003924 GTPase activity
GO:0016020 membrane
GO:0005737 cytoplasm
GO:0031226 intrinsic component of plasma membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006612 protein targeting to membrane
GO:0000166 nucleotide binding
GO:0005525 GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q9Z6T7 Signal recognition particle receptor FtsY 0.00e+00 2.53e-06 3.78e-45 0.8869
1. PBF A9CHH2 Signal recognition particle receptor FtsY 7.68e-14 4.16e-20 2.48e-63 0.6905
1. PBF Q89B28 Signal recognition particle receptor FtsY 1.89e-15 3.89e-53 1.53e-50 0.7081
1. PBF D4GYW6 Signal recognition particle receptor FtsY 2.22e-08 2.15e-19 1.59e-41 0.6121
1. PBF P27414 Signal recognition particle receptor FtsY 1.05e-09 3.28e-51 1.26e-41 0.6073
1. PBF O33010 Signal recognition particle receptor FtsY 4.66e-13 8.82e-23 9.61e-47 0.7003
1. PBF O05948 Signal recognition particle receptor FtsY 0.00e+00 1.85e-09 1.30e-56 0.8999
1. PBF P57137 Signal recognition particle receptor FtsY 4.44e-16 3.66e-46 2.18e-59 0.7485
1. PBF P75362 Signal recognition particle receptor FtsY 0.00e+00 3.58e-23 1.14e-74 0.9052
1. PBF Q9ZM34 Flagellar biosynthesis protein FlhF 2.30e-09 4.13e-14 1.30e-10 0.5401
1. PBF P66843 Signal recognition particle receptor FtsY 2.79e-12 9.95e-25 1.79e-48 0.8565
1. PBF Q9ZL80 Signal recognition particle receptor FtsY 0.00e+00 1.10e-06 2.15e-45 0.8412
1. PBF Q6MTB9 Signal recognition particle receptor FtsY 0.00e+00 9.94e-101 0.0 0.8194
1. PBF Q8TIN7 Signal recognition particle receptor FtsY 8.79e-11 1.27e-39 4.55e-42 0.6014
1. PBF Q726P7 Signal recognition particle receptor FtsY 7.42e-12 2.71e-23 2.73e-60 0.8728
1. PBF P57010 Signal recognition particle receptor FtsY 7.11e-15 1.43e-30 3.35e-59 0.8903
1. PBF P73930 Signal recognition particle receptor FtsY 1.07e-12 3.19e-18 1.42e-52 0.6783
1. PBF Q4UK46 Signal recognition particle receptor FtsY 0.00e+00 3.10e-11 1.31e-57 0.9122
1. PBF P44870 Signal recognition particle receptor FtsY 5.22e-15 4.47e-46 3.41e-56 0.6944
1. PBF Q8G736 Signal recognition particle receptor FtsY 2.86e-14 1.46e-27 2.52e-51 0.6781
1. PBF P51835 Signal recognition particle receptor FtsY 0.00e+00 8.23e-16 4.35e-78 0.9346
1. PBF O25679 Flagellar biosynthesis protein FlhF 6.91e-09 1.10e-14 1.51e-10 0.5338
1. PBF Q8KA77 Signal recognition particle receptor FtsY 0.00e+00 1.27e-33 5.73e-61 0.8469
1. PBF Q1RKK5 Signal recognition particle receptor FtsY 0.00e+00 4.01e-12 2.38e-55 0.9114
1. PBF P47539 Signal recognition particle receptor FtsY 0.00e+00 1.49e-23 1.45e-75 0.9029
1. PBF P83749 Signal recognition particle receptor FtsY 0.00e+00 1.47e-10 5.34e-52 0.8667
1. PBF O32861 Signal recognition particle receptor FtsY 0.00e+00 7.31e-26 3.02e-82 0.8589
1. PBF P14929 Signal recognition particle receptor FtsY 0.00e+00 9.08e-33 3.12e-56 0.8601
1. PBF Q8CWX8 Signal recognition particle receptor FtsY 2.33e-15 2.79e-18 1.87e-77 0.7266
1. PBF O67066 Signal recognition particle receptor FtsY 1.12e-10 1.54e-16 6.10e-63 0.8851
1. PBF Q9RS67 Signal recognition particle receptor FtsY 0.00e+00 6.90e-12 2.13e-52 0.8394
1. PBF D3UJA7 Signal recognition particle receptor FtsY 0.00e+00 2.92e-05 1.06e-46 0.8499
1. PBF Q9HJ93 Signal recognition particle receptor FtsY 0.00e+00 1.41e-04 1.00e-45 0.866
1. PBF Q92GB8 Signal recognition particle receptor FtsY 0.00e+00 2.52e-11 5.60e-57 0.9115
1. PBF O30391 Signal recognition particle receptor FtsY 4.55e-15 2.71e-35 7.36e-58 0.8784
1. PBF P9WGD8 Signal recognition particle receptor FtsY 6.98e-13 9.95e-25 1.79e-48 0.7163
1. PBF Q56339 Flagellar biosynthesis protein FlhF 1.35e-07 5.10e-14 1.06e-08 0.7095
1. PBF P57011 Signal recognition particle receptor FtsY 6.04e-14 1.61e-31 3.43e-59 0.8919
1. PBF Q68VX4 Signal recognition particle receptor FtsY 0.00e+00 3.94e-09 6.80e-60 0.8956
1. PBF O25458 Signal recognition particle receptor FtsY 0.00e+00 6.46e-07 5.53e-46 0.8538
3. BF P75054 Signal recognition particle protein 0.00e+00 NA 5.44e-23 0.8125
3. BF A3DML3 Signal recognition particle 54 kDa protein 1.22e-15 NA 6.53e-34 0.7532
3. BF Q977V2 Signal recognition particle 54 kDa protein 2.11e-15 NA 1.02e-25 0.7408
3. BF Q4R965 Signal recognition particle 54 kDa protein 0.00e+00 NA 8.82e-31 0.8125
3. BF C3NDW4 Signal recognition particle 54 kDa protein 1.55e-15 NA 2.24e-33 0.7221
3. BF A1RS43 Signal recognition particle 54 kDa protein 1.11e-16 NA 3.04e-27 0.7516
3. BF A9A9B0 Signal recognition particle 54 kDa protein 2.22e-16 NA 1.68e-33 0.7581
3. BF A4FVX4 Signal recognition particle 54 kDa protein 2.22e-16 NA 1.72e-34 0.7918
3. BF Q92J55 Signal recognition particle protein 0.00e+00 NA 8.69e-30 0.8396
3. BF Q2NE47 Signal recognition particle 54 kDa protein 5.55e-16 NA 8.09e-34 0.7497
3. BF O29633 Signal recognition particle 54 kDa protein 4.44e-16 NA 6.28e-34 0.7667
3. BF P49968 Signal recognition particle 54 kDa protein 1 0.00e+00 NA 5.55e-33 0.8219
3. BF Q01442 Signal recognition particle protein 0.00e+00 NA 4.50e-27 0.8088
3. BF Q8PXF3 Signal recognition particle 54 kDa protein 6.66e-16 NA 1.82e-33 0.7627
3. BF P49971 Signal recognition particle 54 kDa protein 1 1.11e-16 NA 2.30e-32 0.7971
3. BF P47294 Signal recognition particle protein 0.00e+00 NA 1.78e-25 0.8167
3. BF P74214 Signal recognition particle protein 0.00e+00 NA 6.61e-31 0.8115
3. BF P9WGD6 Signal recognition particle protein 3.33e-16 NA 3.04e-22 0.8094
3. BF A5UMY7 Signal recognition particle 54 kDa protein 1.67e-15 NA 3.59e-33 0.74
3. BF Q89AE4 Signal recognition particle protein 0.00e+00 NA 6.10e-27 0.8164
3. BF Q6LX03 Signal recognition particle 54 kDa protein 2.22e-16 NA 3.72e-34 0.7892
3. BF B1Y9L4 Signal recognition particle 54 kDa protein 1.11e-16 NA 1.71e-27 0.8022
3. BF B6YSS1 Signal recognition particle 54 kDa protein 0.00e+00 NA 2.77e-41 0.7883
3. BF C3NHT9 Signal recognition particle 54 kDa protein 2.22e-15 NA 1.89e-33 0.7031
3. BF O33013 Signal recognition particle protein 0.00e+00 NA 3.85e-26 0.7985
3. BF Q3MHE8 Signal recognition particle receptor subunit alpha 1.64e-08 NA 9.22e-26 0.6452
3. BF Q12ZG8 Signal recognition particle 54 kDa protein 9.99e-16 NA 9.12e-32 0.775
3. BF P49969 Signal recognition particle 54 kDa protein 2 0.00e+00 NA 6.25e-33 0.8217
3. BF C4KGX6 Signal recognition particle 54 kDa protein 1.55e-15 NA 4.55e-33 0.7165
3. BF C3MYM8 Signal recognition particle 54 kDa protein 4.44e-16 NA 4.55e-33 0.7274
3. BF O59307 Signal recognition particle 54 kDa protein 0.00e+00 NA 1.16e-41 0.7718
3. BF A3MWX6 Signal recognition particle 54 kDa protein 1.11e-16 NA 2.21e-29 0.7907
3. BF Q68XJ4 Signal recognition particle protein 0.00e+00 NA 1.97e-28 0.8402
3. BF Q5R4R6 Signal recognition particle 54 kDa protein 0.00e+00 NA 8.82e-31 0.8307
3. BF Q9HKT0 Signal recognition particle 54 kDa protein 8.88e-16 NA 4.43e-29 0.7508
3. BF Q2T9U1 Signal recognition particle 54 kDa protein 0.00e+00 NA 8.82e-31 0.8309
3. BF A4WLQ3 Signal recognition particle 54 kDa protein 0.00e+00 NA 1.78e-27 0.8072
3. BF Q8U070 Signal recognition particle 54 kDa protein 0.00e+00 NA 5.35e-41 0.7842
3. BF C3MPN4 Signal recognition particle 54 kDa protein 1.89e-15 NA 1.35e-33 0.7148
3. BF Q8MZJ6 Signal recognition particle 54 kDa protein 1.11e-16 NA 9.92e-29 0.8136
3. BF O42816 Signal recognition particle 54 kDa protein homolog 1.55e-15 NA 3.13e-35 0.7807
3. BF Q5UY20 Signal recognition particle 54 kDa protein 8.99e-15 NA 5.81e-24 0.7426
3. BF P49972 Signal recognition particle 54 kDa protein 2 0.00e+00 NA 3.20e-32 0.8189
3. BF Q971S9 Signal recognition particle 54 kDa protein 0.00e+00 NA 2.03e-33 0.7871
3. BF Q979Y8 Signal recognition particle 54 kDa protein 4.44e-16 NA 7.20e-25 0.7676
3. BF Q8THD0 Signal recognition particle 54 kDa protein 8.88e-16 NA 2.21e-33 0.7684
3. BF P56005 Signal recognition particle protein 0.00e+00 NA 5.83e-37 0.8665
3. BF Q99150 Signal recognition particle 54 kDa protein homolog 3.22e-15 NA 2.76e-36 0.8094
3. BF O15821 Signal recognition particle 54 kDa protein 2.22e-16 NA 3.23e-30 0.8105
3. BF P61010 Signal recognition particle 54 kDa protein 0.00e+00 NA 8.82e-31 0.8127
3. BF O67615 Signal recognition particle protein 1.11e-16 NA 5.02e-34 0.7891
3. BF A2BNB5 Signal recognition particle 54 kDa protein 0.00e+00 NA 1.46e-35 0.8057
3. BF O27376 Signal recognition particle 54 kDa protein 1.11e-16 NA 1.07e-35 0.7651
3. BF Q0W2G1 Signal recognition particle 54 kDa protein 4.44e-16 NA 1.28e-31 0.7358
3. BF C5A233 Signal recognition particle 54 kDa protein 0.00e+00 NA 5.82e-38 0.776
3. BF Q4UKH4 Signal recognition particle protein 0.00e+00 NA 4.06e-30 0.8419
3. BF Q9HMN5 Signal recognition particle 54 kDa protein 3.33e-15 NA 4.72e-23 0.754
3. BF A6UQJ8 Signal recognition particle 54 kDa protein 1.11e-16 NA 1.04e-36 0.7934
3. BF P66845 Signal recognition particle protein 7.77e-16 NA 3.04e-22 0.805
3. BF A4YHL0 Signal recognition particle 54 kDa protein 1.67e-15 NA 1.62e-40 0.7575
3. BF Q1RHD6 Signal recognition particle protein 0.00e+00 NA 3.34e-31 0.8266
3. BF Q18EV2 Signal recognition particle 54 kDa protein 1.67e-15 NA 4.28e-26 0.746
3. BF Q9V1E8 Signal recognition particle 54 kDa protein 0.00e+00 NA 2.95e-41 0.7923
3. BF Q00179 Signal recognition particle 54 kDa protein homolog 1.11e-16 NA 2.08e-32 0.8215
3. BF Q5JJC8 Signal recognition particle 54 kDa protein 0.00e+00 NA 1.98e-38 0.7913
3. BF Q9ZDZ0 Signal recognition particle protein 0.00e+00 NA 1.16e-27 0.8324
3. BF Q9YB62 Signal recognition particle 54 kDa protein 0.00e+00 NA 3.41e-35 0.7457
3. BF A6VHE0 Signal recognition particle 54 kDa protein 1.11e-16 NA 1.58e-34 0.7915
3. BF P70722 Signal recognition particle 54 kDa protein (Fragment) 4.44e-16 NA 7.02e-30 0.8104
3. BF A0B638 Signal recognition particle 54 kDa protein 6.66e-16 NA 2.59e-33 0.7835
3. BF Q3IUP1 Signal recognition particle 54 kDa protein 1.11e-15 NA 1.12e-24 0.7734
3. BF A6UWG4 Signal recognition particle 54 kDa protein 1.11e-16 NA 2.64e-36 0.7781
3. BF Q9ZK62 Signal recognition particle protein 0.00e+00 NA 1.62e-36 0.8669
3. BF C3N5B0 Signal recognition particle 54 kDa protein 1.78e-15 NA 4.55e-33 0.7056
3. BF P49970 Signal recognition particle 54 kDa protein 3 0.00e+00 NA 2.21e-32 0.8165
3. BF Q8ZT95 Signal recognition particle 54 kDa protein 0.00e+00 NA 1.89e-29 0.8022
3. BF Q54431 Signal recognition particle protein 1.11e-16 NA 6.96e-28 0.8205
3. BF B9LT33 Signal recognition particle 54 kDa protein 3.77e-15 NA 7.51e-26 0.775
3. BF P37105 Signal recognition particle protein 0.00e+00 NA 3.25e-32 0.8016
3. BF Q55311 Signal recognition particle protein 0.00e+00 NA 1.20e-31 0.8159
4. PB Q9I3P8 Flagellar biosynthesis protein FlhF 7.43e-08 2.15e-19 5.93e-11 NA
4. PB Q44758 Flagellar biosynthesis protein FlhF 8.91e-07 7.72e-18 8.98e-06 NA
4. PB O67266 Flagellar biosynthesis protein FlhF 4.46e-08 1.55e-15 1.06e-11 NA
4. PB O52256 Flagellar biosynthesis protein FlhF 2.26e-08 2.03e-20 3.79e-09 NA
4. PB P10121 Signal recognition particle receptor FtsY 1.27e-14 2.26e-21 2.14e-58 NA
4. PB Q01960 Flagellar biosynthesis protein FlhF 2.61e-08 5.15e-19 5.77e-04 NA
4. PB P9WGD9 Signal recognition particle receptor FtsY 3.31e-14 9.95e-25 1.79e-48 NA
4. PB O52908 Flagellar biosynthesis protein FlhF 2.65e-08 6.19e-10 8.78e-15 NA
4. PB Q57739 Signal recognition particle receptor FtsY 3.83e-09 5.13e-50 9.35e-47 NA
4. PB O80842 Cell division protein FtsY homolog, chloroplastic 0.00e+00 2.94e-18 1.55e-58 NA
5. P P33561 Transcription termination factor Rho 9.10e-03 4.57e-02 NA NA
5. P Q4UKB5 Iron-sulfur cluster carrier protein 1.32e-04 7.72e-03 NA NA
5. P Q7UGV0 Transcription termination factor Rho 1.23e-02 2.10e-02 NA NA
5. P Q46259 Probable plasmid replicative DNA helicase 2.08e-03 4.53e-03 NA NA
5. P O83097 Replicative DNA helicase 2.73e-03 1.88e-02 NA NA
5. P Q9ZE27 Iron-sulfur cluster carrier protein 4.27e-04 1.01e-02 NA NA
5. P Q92JA4 Iron-sulfur cluster carrier protein 1.85e-05 1.06e-02 NA NA
5. P Q1RHB0 Iron-sulfur cluster carrier protein 9.03e-05 3.96e-03 NA NA
5. P P28155 Hydrogenase maturation factor HypB 8.17e-03 8.93e-04 NA NA
5. P Q68XP6 Iron-sulfur cluster carrier protein 8.27e-04 4.84e-03 NA NA
5. P Q46437 Probable plasmid replicative DNA helicase 1.46e-03 4.07e-02 NA NA
5. P P26410 Hydrogenase maturation factor HypB 1.30e-02 3.39e-03 NA NA
5. P B0BCM3 Probable plasmid replicative DNA helicase 5.22e-03 1.60e-02 NA NA
5. P P0CE16 Probable plasmid replicative DNA helicase 2.41e-03 1.60e-02 NA NA
6. F P9WJN6 Iron-sulfur cluster carrier protein 1.54e-04 NA NA 0.3986
6. F P65442 Iron-sulfur cluster carrier protein 1.53e-04 NA NA 0.4393
6. F P53382 Iron-sulfur cluster carrier protein 2.78e-04 NA NA 0.4518
7. B P49966 Signal recognition particle 54 kDa protein 2 3.33e-16 NA 8.93e-23 NA
7. B P32916 Signal recognition particle receptor subunit alpha homolog 2.63e-07 NA 1.31e-22 NA
7. B P49967 Signal recognition particle 54 kDa protein 3 0.00e+00 NA 2.73e-31 NA
7. B Q87SX6 Adenylyl-sulfate kinase 6.91e-02 NA 2.13e-04 NA
7. B P37106 Signal recognition particle 54 kDa protein 1 0.00e+00 NA 6.93e-32 NA
7. B P9WGD7 Signal recognition particle protein 3.33e-16 NA 3.04e-22 NA
7. B P44518 Signal recognition particle protein 1.11e-16 NA 6.14e-31 NA
7. B O07347 Signal recognition particle protein 1.11e-16 NA 2.92e-32 NA
7. B P14576 Signal recognition particle 54 kDa protein 0.00e+00 NA 3.65e-31 NA
7. B P08240 Signal recognition particle receptor subunit alpha 5.75e-07 NA 1.08e-25 NA
7. B A2STI3 Signal recognition particle 54 kDa protein 3.33e-16 NA 5.57e-27 NA
7. B Q9U5L1 Signal recognition particle receptor subunit alpha homolog 3.27e-09 NA 2.75e-26 NA
7. B P57473 Signal recognition particle protein 0.00e+00 NA 1.63e-26 NA
7. B Q57565 Signal recognition particle 54 kDa protein 0.00e+00 NA 1.96e-37 NA
7. B P0AGD8 Signal recognition particle protein 0.00e+00 NA 8.50e-31 NA
7. B O43032 Signal recognition particle receptor subunit alpha homolog 5.19e-07 NA 1.89e-25 NA
7. B P61011 Signal recognition particle 54 kDa protein 0.00e+00 NA 8.82e-31 NA
7. B Q8TUY9 Signal recognition particle 54 kDa protein 2.22e-16 NA 9.06e-39 NA
7. B Q46631 Putative tyrosine-protein kinase AmsA 3.90e-03 NA 0.029 NA
7. B Q9DBG7 Signal recognition particle receptor subunit alpha 1.91e-07 NA 9.24e-26 NA
7. B Q7MPF0 Adenylyl-sulfate kinase 8.09e-02 NA 0.009 NA
7. B Q8K9F7 Signal recognition particle protein 0.00e+00 NA 3.86e-29 NA
7. B P0AGD9 Signal recognition particle protein 0.00e+00 NA 8.50e-31 NA
7. B P21565 Signal recognition particle 54 kDa protein homolog 1.11e-16 NA 2.94e-33 NA
7. B Q6AYB5 Signal recognition particle 54 kDa protein 0.00e+00 NA 1.25e-30 NA
7. B Q54ZR7 Signal recognition particle receptor subunit alpha 2.43e-07 NA 1.38e-25 NA
7. B P0AGD7 Signal recognition particle protein 0.00e+00 NA 8.50e-31 NA
7. B Q8DE75 Adenylyl-sulfate kinase 8.21e-02 NA 0.009 NA
7. B B0R7X3 Signal recognition particle 54 kDa protein 3.22e-15 NA 4.72e-23 NA
7. B Q9KP21 Adenylyl-sulfate kinase 6.84e-02 NA 0.023 NA
7. B O07853 Signal recognition particle 54 kDa protein 3.33e-16 NA 1.29e-32 NA
7. B P37107 Signal recognition particle 54 kDa protein, chloroplastic 2.82e-11 NA 5.73e-32 NA
7. B Q75K18 Signal recognition particle 54 kDa protein 5.55e-16 NA 1.00e-25 NA
7. B Q46E01 Signal recognition particle 54 kDa protein 3.33e-16 NA 2.03e-34 NA
7. B Q97ZE7 Signal recognition particle 54 kDa protein 1.44e-15 NA 6.19e-34 NA
7. B P20424 Signal recognition particle subunit SRP54 0.00e+00 NA 2.10e-36 NA
7. B Q7ZVN5 Signal recognition particle 54 kDa protein 0.00e+00 NA 2.72e-30 NA
7. B P06625 Signal recognition particle receptor subunit alpha 6.62e-07 NA 1.05e-24 NA