Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54792.1
JCVISYN3A_0430

Uncharacterized DNA-binding protein.
M. mycoides homolog: Q6MTB8.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 7
Unique PROST Go: 6
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 178
Unique PROST Homologs: 46
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: component of the signal recognition particle protein membrane-targeting pathway|may interact with secretion system 4.5S RNA
Yang and Tsui [2]: Uridylate kinase PyrH
Antczak et al. [3]: DNA-binding protein, sigma factors
Zhang et al. [4]: GO:0006355|regulation of transcription, DNA-templated
Bianchi et al. [5]: ylxM-like Effector of Signal Recognition Particle

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was P03052 (TrfB transcriptional repressor protein) with a FATCAT P-Value: 6.4e-06 and RMSD of 2.15 angstrom. The sequence alignment identity is 23.7%.
Structural alignment shown in left. Query protein AVX54792.1 colored as red in alignment, homolog P03052 colored as blue. Query protein AVX54792.1 is also shown in right top, homolog P03052 showed in right bottom. They are colored based on secondary structures. 

  AVX54792.1 MKLKNNLLE-------KTLEL-SELFKIYKELLTD-KQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKT--SKLLFNL-E-----TKLHLKQKQDL 83
      P03052 MK-K-RLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFAT----SLGLTRGA----VSQ-AVH-RVWAAFEDK---NLPEGYARVTAV-LPEHQ-- 82

  AVX54792.1 LISLINKIETNQIDEKQFIKS-LKEVIWWKY 113
      P03052 -AYIVRKWEA---DAKK--KQETKR------ 101

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0030695 GTPase regulator activity
5. P GO:0003677 DNA binding
5. P GO:0045892 negative regulation of transcription, DNA-templated
5. P GO:0043493 viral terminase complex
5. P GO:0046677 response to antibiotic
5. P GO:0030541 plasmid partitioning
5. P GO:0097710 viral terminase, small subunit

Uniprot GO Annotations

GO Description

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q88WJ7 UPF0122 protein lp_1634 1.07e-09 8.41e-34 1.03e-17 0.6989
1. PBF Q92AK6 UPF0122 protein lin1916 3.11e-15 3.97e-28 3.40e-13 0.6613
1. PBF C3P5P7 UPF0122 protein BAA_4008 7.99e-15 5.52e-29 4.52e-16 0.6974
1. PBF P96468 UPF0122 protein SMU_1061 6.99e-15 5.30e-37 3.28e-18 0.825
1. PBF B8ZJV2 UPF0122 protein SPN23F11830 8.67e-10 4.22e-39 4.30e-18 0.7687
1. PBF Q895M5 UPF0122 protein CTC_01247 6.36e-12 5.73e-24 4.46e-11 0.6019
1. PBF C1CL23 UPF0122 protein SPP_1327 1.08e-14 4.22e-39 4.30e-18 0.8308
1. PBF C3L781 UPF0122 protein BAMEG_0647 2.22e-16 5.52e-29 4.52e-16 0.7143
1. PBF Q04K36 UPF0122 protein SPD_1143 8.79e-10 4.22e-39 4.30e-18 0.7684
1. PBF B9DPJ5 UPF0122 protein Sca_0859 1.57e-11 7.92e-39 3.17e-17 0.8818
1. PBF Q5M4P2 UPF0122 protein stu0888 8.47e-10 3.86e-38 4.49e-18 0.7757
1. PBF Q2YXI0 UPF0122 protein SAB1100 0.00e+00 1.18e-40 2.73e-18 0.9195
1. PBF B7JJT3 UPF0122 protein BCAH820_3860 5.33e-15 5.52e-29 4.52e-16 0.6979
1. PBF P0DG81 UPF0122 protein SPs1042 6.77e-15 3.66e-42 1.12e-18 0.8274
1. PBF P67248 UPF0122 protein SAV1236 0.00e+00 1.18e-40 2.73e-18 0.9187
1. PBF Q8ER03 UPF0122 protein OB1530 2.28e-14 1.85e-35 1.99e-16 0.8263
1. PBF Q4L5T8 UPF0122 protein SH1678 1.55e-11 3.42e-39 1.08e-15 0.8739
1. PBF Q49X20 UPF0122 protein SSP1533 1.50e-11 2.39e-39 9.08e-15 0.8797
1. PBF Q6GHJ9 UPF0122 protein SAR1212 1.48e-11 1.50e-39 2.91e-18 0.8792
1. PBF Q819W1 UPF0122 protein BC_3844 5.55e-15 5.52e-29 4.52e-16 0.6979
1. PBF B9E1H2 UPF0122 protein CKR_1296 1.79e-12 5.52e-29 1.10e-12 0.6529
1. PBF Q8CSV1 UPF0122 protein SE_0911 1.84e-11 6.59e-40 7.47e-17 0.8792
1. PBF Q2SS09 UPF0122 protein MCAP_0480 0.00e+00 2.74e-99 5.80e-69 0.9894
1. PBF Q0TPN9 UPF0122 protein CPF_1968 6.09e-13 1.26e-26 1.40e-08 0.7247
1. PBF Q1JBN1 UPF0122 protein MGAS2096_Spy0975 7.99e-15 3.66e-42 1.12e-18 0.8268
1. PBF Q03RT9 UPF0122 protein LVIS_0949 1.86e-13 4.04e-29 5.02e-18 0.6703
1. PBF B7HLH9 UPF0122 protein BCAH187_A3894 3.76e-10 5.52e-29 4.52e-16 0.6972
1. PBF A8FD61 UPF0122 protein BPUM_1495 1.07e-09 1.84e-33 2.23e-14 0.6767
1. PBF Q8Y694 UPF0122 protein lmo1802 4.55e-15 7.90e-28 7.55e-13 0.6607
1. PBF C1KWA1 UPF0122 protein Lm4b_01818 5.88e-15 6.83e-28 6.15e-13 0.6603
1. PBF Q03FW7 UPF0122 protein PEPE_0845 1.30e-09 1.19e-29 2.45e-13 0.8007
1. PBF A8AXA1 UPF0122 protein SGO_1122 9.66e-15 6.42e-39 4.35e-18 0.8328
1. PBF Q8R9W9 UPF0122 protein TTE1463 1.45e-14 1.10e-21 8.36e-09 0.6682
1. PBF A7GG38 UPF0122 protein CLI_2506 5.00e-12 2.83e-27 1.59e-10 0.603
1. PBF B7HDW9 UPF0122 protein BCB4264_A3945 5.88e-15 5.52e-29 4.52e-16 0.6981
1. PBF B0K9W9 UPF0122 protein Teth39_1278 1.78e-14 3.14e-21 1.46e-08 0.6907
1. PBF C1FSM0 UPF0122 protein CLM_2743 4.63e-12 2.39e-26 1.01e-10 0.5889
1. PBF P67250 UPF0122 protein MW1119 1.43e-11 1.18e-40 2.73e-18 0.8783
1. PBF A7FW14 UPF0122 protein CLB_2314 5.83e-12 2.39e-26 1.01e-10 0.6003
1. PBF A5VKN9 UPF0122 protein Lreu_1156 2.66e-13 1.00e-33 3.72e-16 0.6798
1. PBF P67255 UPF0122 protein spyM18_1152 1.37e-14 3.66e-42 1.12e-18 0.8257
1. PBF B5XLN6 UPF0122 protein Spy49_0946c 1.48e-14 3.66e-42 1.12e-18 0.8249
1. PBF A3DDH7 UPF0122 protein Cthe_0771 5.88e-12 1.18e-23 1.40e-10 0.6232
1. PBF C1EP70 UPF0122 protein BCA_3946 3.77e-15 8.27e-29 4.42e-16 0.6983
1. PBF B9IVD5 UPF0122 protein BCQ_3631 3.13e-10 5.52e-29 4.52e-16 0.6978
1. PBF B3WEU6 UPF0122 protein LCABL_18170 1.72e-09 1.06e-32 1.30e-17 0.7371
1. PBF Q81WJ1 UPF0122 protein BA_3984/GBAA_3984/BAS3697 3.29e-10 5.52e-29 4.52e-16 0.6982
1. PBF A5N811 UPF0122 protein CKL_1400 1.60e-12 5.52e-29 1.10e-12 0.6528
1. PBF A2RK52 UPF0122 protein llmg_1069 1.02e-14 4.65e-38 1.16e-18 0.8389
1. PBF Q6G9X7 UPF0122 protein SAS1170 1.52e-11 1.18e-40 2.73e-18 0.8794
1. PBF P37104 UPF0122 protein YlxM 9.13e-10 3.02e-32 1.37e-13 0.8416
1. PBF B2TJ26 UPF0122 protein CLL_A1244 2.66e-13 6.11e-25 1.40e-10 0.6883
1. PBF A2RED5 UPF0122 protein SpyM50882 1.87e-14 3.66e-42 1.12e-18 0.824
1. PBF A6QGD6 UPF0122 protein NWMN_1146 1.50e-11 1.18e-40 2.73e-18 0.8782
1. PBF Q97QD1 UPF0122 protein SP_1288 1.64e-14 1.14e-39 4.80e-18 0.8017
1. PBF Q71YL5 UPF0122 protein LMOf2365_1829 2.32e-10 6.83e-28 6.15e-13 0.6602
1. PBF Q8RDV6 UPF0122 protein FN1394 4.91e-13 4.39e-31 6.82e-13 0.8394
1. PBF Q03KY3 UPF0122 protein STER_0914 8.31e-10 3.86e-38 4.49e-18 0.776
1. PBF B1II81 UPF0122 protein CLD_2190 5.78e-12 2.39e-26 1.01e-10 0.6024
1. PBF Q67PE4 UPF0122 protein STH1464 1.30e-14 5.90e-25 5.64e-06 0.7831
1. PBF Q8EVS4 UPF0122 protein MYPE4850 3.08e-12 1.99e-42 1.12e-07 0.6698
1. PBF Q1J6G8 UPF0122 protein MGAS10750_Spy1065 8.99e-15 3.66e-42 1.12e-18 0.826
1. PBF C4L5Z9 UPF0122 protein EAT1b_2891 1.93e-10 2.08e-35 1.48e-14 0.8051
1. PBF A4J671 UPF0122 protein Dred_2057 6.97e-13 6.45e-24 6.04e-12 0.5871
1. PBF O05290 Probable UPF0122 protein 0.00e+00 4.36e-106 2.86e-71 0.9918
1. PBF B1KWP0 UPF0122 protein CLK_1827 5.15e-12 1.04e-26 1.95e-10 0.6029
1. PBF Q8XJP2 UPF0122 protein CPE1714 1.43e-12 4.51e-28 2.73e-09 0.6791
1. PBF B2IQ79 UPF0122 protein SPCG_1251 8.23e-10 4.22e-39 4.30e-18 0.7689
1. PBF Q9CFN3 UPF0122 protein YofM 1.01e-13 2.53e-37 5.98e-19 0.6753
1. PBF Q5M027 UPF0122 protein str0888 7.33e-15 3.86e-38 4.49e-18 0.8331
1. PBF Q38XR2 UPF0122 protein LCA_0713 4.40e-14 5.72e-33 6.82e-16 0.6981
1. PBF C0M9C0 UPF0122 protein SEQ_1180 8.97e-10 2.15e-39 1.11e-17 0.7686
1. PBF A7Z4L7 UPF0122 protein RBAM_015800 3.32e-13 3.58e-33 6.86e-14 0.7605
1. PBF C1CR18 UPF0122 protein SPT_0939 7.99e-15 4.22e-39 4.30e-18 0.8324
1. PBF P67253 UPF0122 protein SPy_1201/M5005_Spy0916 7.55e-15 3.66e-42 1.12e-18 0.8271
1. PBF Q9PR02 UPF0122 protein UU142 9.89e-10 4.47e-18 1.85e-07 0.7322
1. PBF C4Z927 UPF0122 protein EUBREC_1504 8.56e-14 1.86e-23 2.28e-11 0.7554
1. PBF Q9KA09 UPF0122 protein BH2485 7.67e-14 1.17e-29 2.52e-15 0.7858
1. PBF A0AJQ7 UPF0122 protein lwe1821 5.11e-15 1.36e-26 7.47e-13 0.6605
1. PBF Q5L0Q0 UPF0122 protein GK1195 4.84e-10 4.67e-27 3.86e-15 0.6771
1. PBF B7IUK5 UPF0122 protein BCG9842_B1298 5.33e-15 5.52e-29 4.52e-16 0.6978
1. PBF Q5XC23 UPF0122 protein M6_Spy0905 1.39e-14 3.07e-42 1.13e-18 0.8259
1. PBF P67251 UPF0122 protein gbs1018 8.86e-10 1.44e-39 3.84e-16 0.7754
1. PBF C3L0E8 UPF0122 protein CLJ_B2675 6.30e-12 9.02e-27 1.22e-10 0.5886
1. PBF Q038J5 UPF0122 protein LSEI_1603 1.49e-09 1.06e-32 1.30e-17 0.7372
1. PBF Q0SSA6 UPF0122 protein CPR_1686 9.78e-13 8.04e-28 3.49e-09 0.6807
1. PBF B4U300 UPF0122 protein Sez_1013 9.99e-15 7.21e-44 1.12e-17 0.8272
1. PBF A0RHL9 UPF0122 protein BALH_3477 5.11e-15 8.27e-29 4.42e-16 0.698
1. PBF A4W0Z7 UPF0122 protein SSU98_0878 2.11e-15 4.90e-43 4.08e-18 0.8361
1. PBF C1CEP3 UPF0122 protein SPJ_1203 8.68e-10 4.22e-39 4.30e-18 0.769
1. PBF Q8DPH0 UPF0122 protein spr1167 8.96e-10 4.22e-39 4.30e-18 0.7685
1. PBF B2G823 UPF0122 protein LAR_1089 4.66e-15 1.00e-33 3.72e-16 0.681
1. PBF A5ISC1 UPF0122 protein SaurJH9_1295 1.29e-11 1.18e-40 2.73e-18 0.8788
1. PBF B1AID1 UPF0122 protein UPA3_0148 1.73e-10 4.47e-18 1.85e-07 0.7318
1. PBF P67252 UPF0122 protein SAG0983 4.04e-14 1.44e-39 3.84e-16 0.8241
1. PBF A6U155 UPF0122 protein SaurJH1_1320 0.00e+00 1.18e-40 2.73e-18 0.9178
1. PBF Q5WFN0 UPF0122 protein ABC2295 1.06e-13 2.31e-32 1.61e-16 0.7938
1. PBF Q2FHK2 UPF0122 protein SAUSA300_1129 0.00e+00 1.18e-40 2.73e-18 0.8718
1. PBF A6LSM6 UPF0122 protein Cbei_1174 2.74e-13 1.62e-27 7.80e-09 0.6821
1. PBF Q5HGJ6 UPF0122 protein SACOL1252 1.41e-11 1.18e-40 2.73e-18 0.8795
1. PBF C5D8T9 UPF0122 protein GWCH70_1086 4.65e-10 2.09e-31 3.02e-14 0.7162
1. PBF Q1JGP9 UPF0122 protein MGAS10270_Spy1030 8.77e-15 3.66e-42 1.12e-18 0.8264
1. PBF Q1WU97 UPF0122 protein LSL_0628 1.55e-09 9.27e-34 1.29e-14 0.6741
1. PBF P75363 UPF0122 protein MPN_424 4.12e-10 4.67e-27 8.49e-15 0.8107
1. PBF B7GGE5 UPF0122 protein Aflv_1766 8.97e-10 4.77e-29 7.81e-15 0.6971
1. PBF A7X1K4 UPF0122 protein SAHV_1226 1.43e-11 1.18e-40 2.73e-18 0.8795
1. PBF Q6HEW9 UPF0122 protein BT9727_3587 3.33e-16 5.52e-29 4.52e-16 0.7142
1. PBF Q5HPV5 UPF0122 protein SERP0802 1.48e-11 3.94e-38 2.64e-17 0.88
1. PBF B1YIM8 UPF0122 protein Exig_1902 1.95e-10 2.59e-32 3.44e-14 0.829
1. PBF B1ICA2 UPF0122 protein SPH_1429 8.98e-10 4.22e-39 4.30e-18 0.7684
1. PBF Q48TF9 UPF0122 protein M28_Spy0888 1.52e-14 3.66e-42 1.12e-18 0.8245
1. PBF A9VT84 UPF0122 protein BcerKBAB4_3669 6.29e-14 4.68e-29 3.64e-16 0.6959
1. PBF Q65JQ2 UPF0122 protein BLi01817/BL02321 2.07e-10 9.16e-35 5.31e-14 0.8403
1. PBF A0Q0Y5 UPF0122 protein NT01CX_2214 3.12e-14 8.63e-21 1.31e-13 0.7293
1. PBF Q834F4 UPF0122 protein EF_1701 3.62e-14 4.59e-36 1.31e-16 0.6627
1. PBF Q1JLL4 UPF0122 protein MGAS9429_Spy1018 1.25e-14 3.66e-42 1.12e-18 0.8256
1. PBF Q02YE3 UPF0122 protein LACR_1522 9.01e-10 4.65e-38 1.16e-18 0.7761
1. PBF A5I4M8 UPF0122 protein CBO2450/CLC_2298 5.78e-12 2.39e-26 1.01e-10 0.5884
1. PBF P67249 UPF0122 protein SA1079 1.44e-11 1.18e-40 2.73e-18 0.8792
1. PBF B2GD39 UPF0122 protein LAF_1235 4.17e-14 3.82e-37 4.37e-16 0.655
1. PBF B0K1V2 UPF0122 protein Teth514_1714 1.78e-14 2.63e-21 1.60e-08 0.6923
1. PBF A4VUQ2 UPF0122 protein SSU05_0875 9.44e-15 4.90e-43 4.08e-18 0.8266
1. PBF C1C7R8 UPF0122 protein SP70585_1353 1.45e-14 1.14e-39 4.80e-18 0.8023
1. PBF A7GRH6 UPF0122 protein Bcer98_2498 2.22e-16 7.74e-31 1.59e-15 0.6965
1. PBF B2V4E0 UPF0122 protein CLH_1195 2.13e-13 7.51e-25 6.59e-11 0.6889
1. PBF Q97I99 UPF0122 protein CA_C1753 5.77e-14 3.35e-21 1.70e-10 0.6158
1. PBF B5ZAX5 UPF0122 protein UUR10_0158 1.74e-10 8.62e-22 2.69e-07 0.7318
1. PBF Q732M4 UPF0122 protein BCE_3888 6.88e-15 5.52e-29 4.52e-16 0.6973
1. PBF P0DG80 UPF0122 protein SpyM3_0842 6.99e-15 3.66e-42 1.12e-18 0.8271
1. PBF Q636I0 UPF0122 protein BCE33L3605 3.28e-10 5.52e-29 4.52e-16 0.6981
4. PB Q2FZ47 UPF0122 protein SAOUHSC_01206 0.00e+00 1.18e-40 2.73e-18 NA
4. PB B5E525 UPF0122 protein SPG_1182 NA 4.40e-40 5.06e-18 NA
5. P A8ZT78 UPF0251 protein Dole_1957 2.37e-04 2.22e-02 NA NA
5. P A6TN94 UPF0251 protein Amet_1463 3.01e-07 5.82e-05 NA NA
5. P A6LXM3 UPF0251 protein Cbei_2962 8.93e-04 1.50e-03 NA NA
5. P B0K6G7 UPF0251 protein Teth514_1147 3.39e-04 4.51e-06 NA NA
5. P A4SKL1 UPF0251 protein ASA_1331 1.50e-04 2.36e-05 NA NA
5. P P04893 Terminase, small subunit NA 4.23e-04 NA NA
5. P Q3ZWU0 UPF0251 protein cbdbA217 3.73e-04 1.20e-03 NA NA
5. P P68262 Methicillin resistance regulatory protein MecI 5.99e-03 3.32e-02 NA NA
5. P Q58482 Uncharacterized protein MJ1082 2.27e-03 3.61e-02 NA NA
5. P B8FRA6 UPF0251 protein Dhaf_1981 4.30e-04 5.60e-07 NA NA
5. P Q24RW2 UPF0251 protein DSY3441 4.27e-04 7.87e-08 NA NA
5. P A6USB4 UPF0251 protein Mevan_1492 5.40e-04 3.40e-10 NA NA
5. P Q8KDU4 UPF0251 protein CT0950 1.02e-03 2.44e-03 NA NA
5. P Q932L5 Methicillin resistance regulatory protein MecI 5.70e-03 4.49e-02 NA NA
5. P Q6LZK8 UPF0251 protein MMP0619 5.96e-04 3.34e-07 NA NA
5. P Q848W2 DNA-binding protein TubR 3.86e-03 2.42e-03 NA NA
5. P B0K7S0 UPF0251 protein Teth39_0655 3.86e-04 4.47e-06 NA NA
5. P Q8PY75 UPF0251 protein MM_0989 4.39e-04 2.97e-08 NA NA
5. P A5D4R0 UPF0251 protein PTH_0588 5.68e-04 7.80e-07 NA NA
5. P Q0AV72 UPF0251 protein Swol_2090 3.89e-04 8.51e-08 NA NA
5. P A6VJS4 UPF0251 protein MmarC7_1642 5.51e-04 3.61e-04 NA NA
5. P Q57423 TrfB transcriptional repressor protein 1.11e-05 7.64e-14 NA NA
5. P Q58640 UPF0251 protein MJ1243 4.46e-04 7.52e-06 NA NA
5. P B8CZ57 UPF0251 protein Hore_18270 5.72e-04 6.70e-04 NA NA
5. P Q2RHY2 UPF0251 protein Moth_1655 8.95e-04 9.05e-03 NA NA
5. P B4S888 UPF0251 protein Paes_1249 1.07e-03 5.57e-04 NA NA
5. P P16937 Terminase, small subunit NA 3.96e-03 NA NA
5. P A0PYX0 UPF0251 protein NT01CX_1491 9.31e-04 1.57e-02 NA NA
5. P P68263 Methicillin resistance regulatory protein MecI 6.23e-03 3.32e-02 NA NA
5. P B8I784 UPF0251 protein Ccel_0627 3.75e-04 1.46e-05 NA NA
5. P Q8EIV3 UPF0251 protein SO_0727 1.34e-04 1.10e-02 NA NA
5. P Q8TIB0 UPF0251 protein MA_4245 3.40e-04 7.72e-07 NA NA
5. P P03052 TrfB transcriptional repressor protein 6.40e-06 1.76e-13 NA NA
5. P Q7MCF1 UPF0251 protein VVA1436 1.46e-04 3.79e-02 NA NA
5. P Q8R8Y7 UPF0251 protein TTE1845 3.84e-04 1.40e-07 NA NA
5. P Q47133 F1845 adhesin operon regulatory protein 1.94e-04 9.90e-04 NA NA
5. P B3EJP4 UPF0251 protein Cphamn1_1487 7.63e-04 3.57e-03 NA NA
5. P A4XG37 UPF0251 protein Csac_0224 6.85e-04 2.41e-02 NA NA
5. P P68261 Methicillin resistance regulatory protein MecI 6.12e-03 3.32e-02 NA NA
5. P Q3Z9Y3 UPF0251 protein DET0218 2.93e-04 3.55e-02 NA NA
5. P B2A0V2 UPF0251 protein Nther_2417 3.47e-04 6.74e-08 NA NA
5. P A4FYK8 UPF0251 protein MmarC5_0986 4.33e-04 4.80e-06 NA NA
5. P Q8D5H3 UPF0251 protein VV2_0946 1.43e-04 2.18e-02 NA NA
5. P Q895A7 UPF0251 protein CTC_01373 3.28e-06 1.87e-03 NA NA
5. P A5FSQ2 UPF0251 protein DehaBAV1_0135 3.80e-04 9.13e-04 NA NA
5. P A9A6A5 UPF0251 protein MmarC6_0272 2.56e-03 1.25e-05 NA NA