Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54793.1
JCVISYN3A_0431
Uncharacterized metallophosphoesterase.
M. mycoides homolog: Q6MTB7.
TIGRfam Classification: 2=Generic.
Category: Essential.
Statistics
Total GO Annotation: 28
Unique PROST Go: 8
Unique BLAST Go: 0
Unique Foldseek Go: 14
Total Homologs: 32
Unique PROST Homologs: 19
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 9
Literature
Danchin and Fang [1]: 2'3' and 3'5' cyclic nucleotide monophosphates phosphodiesterase|cleaning of left overs after RNase activity
Yang and Tsui [2]: Metallophosphoesterase YmdB
Antczak et al. [3]: Metallophosphoesterase, YmdB-like
Zhang et al. [4]: GO:0008663|2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Bianchi et al. [5]: YmdB-like metallophosphoesterase
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q9RUV0
(Phosphatase/phosphodiesterase DR_1281) with a FATCAT P-Value: 0 and RMSD of 1.17 angstrom. The sequence alignment identity is 38.2%.
Structural alignment shown in left. Query protein AVX54793.1 colored as red in alignment, homolog Q9RUV0 colored as blue.
Query protein AVX54793.1 is also shown in right top, homolog Q9RUV0 showed in right bottom. They are colored based on secondary structures.
AVX54793.1 MKVLMIGDVYAKPGREMLEKHLKNIVDQNQIDFIVVNGENTTHGKSICKKHYDFYK-SL--NVDVITSGNHIFKNAEVLEYIKTTND---LLKPLNMSKH 94 Q9RUV0 MRVLFIGDVFGQPGRRVLQNHLPTI--RPQFDFVIVNMENSAGGFGM---HRDAARGALEAGAGCLTLGNHAWHHKDI--YPMLSEDTYPIVRPLNYADP 93 AVX54793.1 -TPGNGNVIVNKNKKKIAVVSLMGQSFMDAVNNPYDALDEFLKTNTDFDI--LLVDFHAESTAEKIAFAFNYDGIITAFVGTHTHVMTADERLLPNKTAF 191 Q9RUV0 GTPGVGWRTFDVNGEKLTVVNLLGRVFMEAVDNPFRTMDALLE--RD-DLGTVFVDFHAEATSEKEAMGWHLAGRVAAVIGTHTHVPTADTRILKGGTAY 190 AVX54793.1 ISDIGMTGVIDSIIGVEVNDVIKRAKTGLPVKFNIATGKCWLNAVIIEIDDKTNKATSIKRLT-IKD 257 Q9RUV0 QTDAGFTGPHDSIIGSAIEGPLQRFLTERPHRYGVAEGRAELNGVALHFEG--GKATAAERYRFIED 255
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0004113 | 2',3'-cyclic-nucleotide 3'-phosphodiesterase activity |
| 1. PBF | GO:0008663 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity |
| 1. PBF | GO:0050189 | phosphoenolpyruvate phosphatase activity |
| 1. PBF | GO:0046872 | metal ion binding |
| 2. PF | GO:0000166 | nucleotide binding |
| 3. BF | GO:0016787 | hydrolase activity |
| 5. P | GO:0008199 | ferric iron binding |
| 5. P | GO:0005618 | cell wall |
| 5. P | GO:0006198 | cAMP catabolic process |
| 5. P | GO:0042301 | phosphate ion binding |
| 5. P | GO:0042545 | cell wall modification |
| 5. P | GO:0008198 | ferrous iron binding |
| 5. P | GO:0016791 | phosphatase activity |
| 5. P | GO:0004115 | 3',5'-cyclic-AMP phosphodiesterase activity |
| 6. F | GO:0102485 | dATP phosphohydrolase activity |
| 6. F | GO:0016788 | hydrolase activity, acting on ester bonds |
| 6. F | GO:0045227 | capsule polysaccharide biosynthetic process |
| 6. F | GO:0008768 | UDP-sugar diphosphatase activity |
| 6. F | GO:0102486 | dCTP phosphohydrolase activity |
| 6. F | GO:0009166 | nucleotide catabolic process |
| 6. F | GO:0102487 | dUTP phosphohydrolase activity |
| 6. F | GO:0008253 | 5'-nucleotidase activity |
| 6. F | GO:0102489 | GTP phosphohydrolase activity |
| 6. F | GO:0102488 | dTTP phosphohydrolase activity |
| 6. F | GO:0030288 | outer membrane-bounded periplasmic space |
| 6. F | GO:0005576 | extracellular region |
| 6. F | GO:0102491 | dGTP phosphohydrolase activity |
| 6. F | GO:0102490 | 8-oxo-dGTP phosphohydrolase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0046872 | metal ion binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q9RUV0 | Phosphatase/phosphodiesterase DR_1281 | 0.00e+00 | 3.91e-43 | 2.51e-53 | 0.956 |
| 1. PBF | P47488 | Putative phosphatase/phosphodiesterase MG246 | 0.00e+00 | 9.72e-43 | 1.68e-51 | 0.9576 |
| 1. PBF | O31775 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase | 0.00e+00 | 9.80e-48 | 6.15e-73 | 0.9793 |
| 1. PBF | P75429 | Putative phosphatase/phosphodiesterase MPN_349 | 0.00e+00 | 4.28e-43 | 2.96e-52 | 0.9581 |
| 5. P | P44685 | 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA | 1.36e-04 | 3.95e-02 | NA | NA |
| 5. P | D5VAD8 | Probable cyclic nucleotide phosphodiesterase MCR_0369 | 3.50e-04 | 7.60e-03 | NA | NA |
| 5. P | C1A2D8 | Probable cyclic nucleotide phosphodiesterase RER_40650 | 1.70e-03 | 1.29e-04 | NA | NA |
| 5. P | P0AEW5 | 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA | 1.44e-04 | 1.19e-02 | NA | NA |
| 5. P | P0AEW4 | 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA | 1.50e-04 | 1.19e-02 | NA | NA |
| 5. P | D5V0N9 | Probable glycerophosphodiester phosphodiesterase GpdQ | 7.80e-04 | 1.06e-04 | NA | NA |
| 5. P | Q8YLG0 | 3',5'-cyclic-nucleotide phosphodiesterase alr5338 | 1.10e-04 | 5.91e-03 | NA | NA |
| 5. P | Q7U7W2 | Probable cyclic nucleotide phosphodiesterase SYNW0868 | 1.38e-04 | 1.52e-02 | NA | NA |
| 5. P | P9WP65 | cAMP/cGMP dual specificity phosphodiesterase Rv0805 | 4.16e-04 | 3.18e-02 | NA | NA |
| 5. P | D3UX49 | Probable cyclic nucleotide phosphodiesterase XBJ1_0953 | 6.84e-05 | 1.54e-02 | NA | NA |
| 5. P | C9RR52 | Probable cyclic nucleotide phosphodiesterase Fisuc_1441/FSU_1912 | 3.19e-03 | 2.96e-02 | NA | NA |
| 5. P | P9WM78 | Probable polyglutamine synthesis accessory protein MT0602 | 1.98e-07 | 6.44e-04 | NA | NA |
| 5. P | Q93GX3 | Probable glycerophosphodiester phosphodiesterase GpdQ | 1.41e-04 | 7.50e-06 | NA | NA |
| 5. P | P9WP64 | cAMP/cGMP dual specificity phosphodiesterase MT0825 | 4.09e-04 | 3.18e-02 | NA | NA |
| 5. P | Q6XBH1 | Glycerophosphodiester phosphodiesterase GpdQ | 9.49e-04 | 1.59e-04 | NA | NA |
| 5. P | A5GLK1 | Probable cyclic nucleotide phosphodiesterase SynWH7803_1390 | 3.29e-06 | 1.93e-04 | NA | NA |
| 5. P | P9WM79 | Probable polyglutamine synthesis accessory protein Rv0574c | 2.01e-07 | 6.44e-04 | NA | NA |
| 5. P | P96738 | PGA biosynthesis protein CapA | 1.83e-07 | 1.90e-03 | NA | NA |
| 5. P | E3GCF1 | Glycerophosphodiester phosphodiesterase GpdQ | 1.02e-03 | 1.66e-03 | NA | NA |
| 6. F | Q9XZ43 | Protein 5NUC | 4.11e-06 | NA | NA | 0.538 |
| 6. F | B3A0N5 | Apyrase | 1.43e-06 | NA | NA | 0.5971 |
| 6. F | P50635 | Apyrase | 1.32e-06 | NA | NA | 0.5876 |
| 6. F | Q56878 | Protein UshA | 4.82e-07 | NA | NA | 0.5815 |
| 6. F | E0D877 | Apyrase | 1.63e-06 | NA | NA | 0.5863 |
| 6. F | D4B093 | Secreted protein ARB_01864 | 1.08e-03 | NA | NA | 0.5264 |
| 6. F | O32133 | Uncharacterized metallophosphoesterase YunD | 4.48e-08 | NA | NA | 0.639 |
| 6. F | Q8YAJ5 | Cell wall protein Lmo0130 | 3.69e-05 | NA | NA | 0.604 |
| 6. F | P19579 | Capsule biosynthesis protein CapA | 4.27e-07 | NA | NA | 0.5716 |