Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54795.1
JCVISYN3A_0433

Uncharacterized protein.
M. mycoides homolog: Q6MTB5.
TIGRfam Classification: 1=Unknown.
Category: Nonessential.

Statistics

Total GO Annotation: 98
Unique PROST Go: 42
Unique BLAST Go: 7
Unique Foldseek Go: 26

Total Homologs: 2581
Unique PROST Homologs: 2314
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 115

Literature

Danchin and Fang [1]: TIM barrel protein binding a metal cofactor|the molecular 3D model of efCutC shows a triose phosphate isomerase (TIM) barrel motifs, described in CutC crystals but several residues are not conserved; may still bind a metal (probably not Cu(I)); possibly an enzyme; co-evolves with aminosugar metabolism and Zn-related functions
Yang and Tsui [2]: Copper homeostasis protein CutC
Antczak et al. [3]: cutC; Copper homeostasis protein CutC
Zhang et al. [4]: GO:0006878|cellular copper ion homeostasis
Bianchi et al. [5]: CutC-like copper homeostasis protein

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A6TB41 (Copper homeostasis protein CutC) with a FATCAT P-Value: 0 and RMSD of 2.23 angstrom. The sequence alignment identity is 29.7%.
Structural alignment shown in left. Query protein AVX54795.1 colored as red in alignment, homolog A6TB41 colored as blue. Query protein AVX54795.1 is also shown in right top, homolog A6TB41 showed in right bottom. They are colored based on secondary structures. 

  AVX54795.1 M-FLEVIAKDLSDIRVINNSKADRIEFCKNLEVGGLTPSLDEIILANQ-ITLKPLHIMIRNNSKDFFFDDYELIKQLEMISVIQKL--PNVHGIVIGALN 96
      A6TB41 MAVLEVCCYSVACAREAERCGADRIELCAAPQEGGLTPSYGVLVSAREAITL-PVHPIVRPRGGDFCYTEEEFAAMLNDIRMVRDLGFP---GLVTGVLD 96

  AVX54795.1 NDYTINEDFLQRVNKI---KGSLKITFNRAFDLVDDPINA---LNVL-VKHKIDTVLTSG-GTNLNTGLEVIRQLVDQNLDIQILI-GGGVDKNNIKQCL 187
      A6TB41 ADGQV--D-IPRMKKIMAAAGPLAVTFHRAFDLCADPRQAWKTLGTLGVKR----ILTSGQQSSAEKGISLITELIAAG-DTPIIMAGAGVRAANLP--L 186

  AVX54795.1 TVN---NQIH--LGR--AARMNSSW-NSDISVDEINLFKDLD--REQ--NNE-------------- 227
      A6TB41 FLQAGVKEVHSSAGHWLPSEMRFRHPGVSMSAD-----PDADEYRRYAVNGAAVAEMKRIISAWRS 247

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0006878 cellular copper ion homeostasis
1. PBF GO:0055070 copper ion homeostasis
1. PBF GO:0005507 copper ion binding
1. PBF GO:0005737 cytoplasm
2. PF GO:2001120 methanofuran biosynthetic process
2. PF GO:0003864 3-methyl-2-oxobutanoate hydroxymethyltransferase activity
2. PF GO:0033982 3-dehydro-L-gulonate-6-phosphate decarboxylase activity
2. PF GO:0000162 tryptophan biosynthetic process
2. PF GO:0004807 triose-phosphate isomerase activity
2. PF GO:0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity
2. PF GO:0009423 chorismate biosynthetic process
2. PF GO:0003824 catalytic activity
2. PF GO:0004789 thiamine-phosphate diphosphorylase activity
2. PF GO:0009228 thiamine biosynthetic process
2. PF GO:0004834 tryptophan synthase activity
2. PF GO:0008652 cellular amino acid biosynthetic process
2. PF GO:0005975 carbohydrate metabolic process
2. PF GO:0003855 3-dehydroquinate dehydratase activity
2. PF GO:0009229 thiamine diphosphate biosynthetic process
2. PF GO:0006094 gluconeogenesis
2. PF GO:0004640 phosphoribosylanthranilate isomerase activity
2. PF GO:0016830 carbon-carbon lyase activity
2. PF GO:0009073 aromatic amino acid family biosynthetic process
5. P GO:0008615 pyridoxine biosynthetic process
5. P GO:0003723 RNA binding
5. P GO:0043801 hexulose-6-phosphate synthase activity
5. P GO:0046279 3,4-dihydroxybenzoate biosynthetic process
5. P GO:0019262 N-acetylneuraminate catabolic process
5. P GO:0005886 plasma membrane
5. P GO:1990107 thiazole synthase activity
5. P GO:0006051 N-acetylmannosamine metabolic process
5. P GO:0009385 N-acylmannosamine-6-phosphate 2-epimerase activity
5. P GO:0008152 metabolic process
5. P GO:0019647 formaldehyde assimilation via ribulose monophosphate cycle
5. P GO:0008700 4-hydroxy-2-oxoglutarate aldolase activity
5. P GO:0019854 L-ascorbic acid catabolic process
5. P GO:0046474 glycerophospholipid biosynthetic process
5. P GO:0005739 mitochondrion
5. P GO:0005634 nucleus
5. P GO:0004750 D-ribulose-phosphate 3-epimerase activity
5. P GO:0034194 D-galactonate catabolic process
5. P GO:0046872 metal ion binding
5. P GO:0009220 pyrimidine ribonucleotide biosynthetic process
5. P GO:0033984 indole-3-glycerol-phosphate lyase activity
5. P GO:0006053 N-acetylmannosamine catabolic process
5. P GO:0004659 prenyltransferase activity
5. P GO:0047465 N-acylglucosamine-6-phosphate 2-epimerase activity
5. P GO:0044205 'de novo' UMP biosynthetic process
5. P GO:0042802 identical protein binding
5. P GO:0004590 orotidine-5'-phosphate decarboxylase activity
5. P GO:0001072 transcription antitermination factor activity, RNA binding
5. P GO:0000287 magnesium ion binding
5. P GO:0047294 phosphoglycerol geranylgeranyltransferase activity
5. P GO:0008674 2-dehydro-3-deoxy-6-phosphogalactonate aldolase activity
5. P GO:0006096 glycolytic process
5. P GO:0033856 pyridoxine 5'-phosphate synthase activity
5. P GO:0008675 2-dehydro-3-deoxy-phosphogluconate aldolase activity
5. P GO:0016020 membrane
5. P GO:0046166 glyceraldehyde-3-phosphate biosynthetic process
5. P GO:0006730 one-carbon metabolic process
5. P GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
5. P GO:0015940 pantothenate biosynthetic process
5. P GO:0005654 nucleoplasm
5. P GO:0002094 polyprenyltransferase activity
5. P GO:0106009 (4S)-4-hydroxy-2-oxoglutarate aldolase activity
6. F GO:0004139 deoxyribose-phosphate aldolase activity
6. F GO:0004765 shikimate kinase activity
6. F GO:0000105 histidine biosynthetic process
6. F GO:0004801 transaldolase activity
6. F GO:0016052 carbohydrate catabolic process
6. F GO:0006098 pentose-phosphate shunt
6. F GO:0008815 citrate (pro-3S)-lyase activity
6. F GO:0106313 methylenetetrahydrofolate reductase NADPH activity
6. F GO:0016829 lyase activity
6. F GO:0000049 tRNA binding
6. F GO:0005524 ATP binding
6. F GO:0050660 flavin adenine dinucleotide binding
6. F GO:0106312 methylenetetrahydrofolate reductase NADH activity
6. F GO:0010181 FMN binding
6. F GO:0009346 ATP-independent citrate lyase complex
6. F GO:0003866 3-phosphoshikimate 1-carboxyvinyltransferase activity
6. F GO:0003856 3-dehydroquinate synthase activity
6. F GO:0016832 aldehyde-lyase activity
6. F GO:0008840 4-hydroxy-tetrahydrodipicolinate synthase activity
6. F GO:0008833 deoxyribonuclease IV (phage-T4-induced) activity
6. F GO:0004764 shikimate 3-dehydrogenase (NADP+) activity
6. F GO:0006281 DNA repair
6. F GO:0017150 tRNA dihydrouridine synthase activity
6. F GO:0009264 deoxyribonucleotide catabolic process
6. F GO:0008816 citryl-CoA lyase activity
6. F GO:0046386 deoxyribose phosphate catabolic process
7. B GO:0055120 striated muscle dense body
7. B GO:0051262 protein tetramerization
7. B GO:0040025 vulval development
7. B GO:0032504 multicellular organism reproduction
7. B GO:0006825 copper ion transport
7. B GO:0046688 response to copper ion
7. B GO:0018991 oviposition

Uniprot GO Annotations

GO Description

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q9KU00 Copper homeostasis protein CutC 0.00e+00 3.95e-28 5.65e-24 0.8949
1. PBF B5R144 Copper homeostasis protein CutC 0.00e+00 6.47e-28 5.83e-29 0.8945
1. PBF B8F7C5 Copper homeostasis protein CutC 0.00e+00 2.49e-34 4.31e-31 0.8716
1. PBF Q322J3 Copper homeostasis protein CutC 0.00e+00 1.30e-30 1.08e-24 0.8852
1. PBF A4WBM9 Copper homeostasis protein CutC 0.00e+00 3.15e-26 7.07e-22 0.8875
1. PBF A5F8U2 Copper homeostasis protein CutC 0.00e+00 3.95e-28 5.65e-24 0.8774
1. PBF B6EK72 Copper homeostasis protein CutC 0.00e+00 3.56e-30 2.41e-20 0.9061
1. PBF B7L7S7 Copper homeostasis protein CutC 0.00e+00 2.61e-30 4.19e-24 0.8852
1. PBF B5FSM4 Copper homeostasis protein CutC 0.00e+00 1.48e-27 1.83e-28 0.8935
1. PBF B1JLM0 Copper homeostasis protein CutC 0.00e+00 3.10e-26 3.96e-23 0.8919
1. PBF A9MUB2 Copper homeostasis protein CutC 0.00e+00 1.08e-28 2.06e-28 0.8854
1. PBF B4SVF7 Copper homeostasis protein CutC 0.00e+00 1.98e-28 1.98e-23 0.9099
1. PBF Q9PDN8 Copper homeostasis protein CutC 0.00e+00 2.91e-18 1.10e-18 0.8693
1. PBF B2U4X5 Copper homeostasis protein CutC 0.00e+00 4.58e-31 2.73e-24 0.8848
1. PBF Q92SZ1 Copper homeostasis protein CutC 0.00e+00 3.43e-30 5.58e-15 0.8803
1. PBF Q66AU9 Copper homeostasis protein CutC 0.00e+00 9.06e-26 3.68e-23 0.892
1. PBF B5XPZ4 Copper homeostasis protein CutC 0.00e+00 7.73e-29 5.50e-26 0.883
1. PBF Q89ZG1 Copper homeostasis protein CutC 0.00e+00 3.76e-30 2.46e-22 0.9189
1. PBF B6I1F2 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 0.8853
1. PBF B7USQ1 Copper homeostasis protein CutC 0.00e+00 2.57e-32 5.08e-25 0.8856
1. PBF Q3Z2Q2 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 0.8854
1. PBF Q1CJH5 Copper homeostasis protein CutC 0.00e+00 1.23e-25 1.19e-22 0.8821
1. PBF A6TB41 Copper homeostasis protein CutC 0.00e+00 1.08e-28 7.81e-25 0.8829
1. PBF A7FID5 Copper homeostasis protein CutC 0.00e+00 1.94e-25 1.61e-23 0.8972
1. PBF Q5E3C5 Copper homeostasis protein CutC 0.00e+00 1.14e-31 3.31e-19 0.8572
1. PBF B4TYT0 Copper homeostasis protein CutC 0.00e+00 3.16e-29 1.14e-28 0.8868
1. PBF B5R8D0 Copper homeostasis protein CutC 0.00e+00 6.47e-28 5.83e-29 0.8935
1. PBF A1JRM5 Copper homeostasis protein CutC 0.00e+00 3.18e-27 3.66e-22 0.8921
1. PBF B7NBM5 Copper homeostasis protein CutC 0.00e+00 4.90e-33 3.23e-25 0.8859
1. PBF A6L8P3 Copper homeostasis protein CutC 0.00e+00 1.15e-32 9.67e-23 0.9206
1. PBF Q6D476 Copper homeostasis protein CutC 0.00e+00 6.02e-24 9.22e-20 0.8747
1. PBF Q830V2 Copper homeostasis protein CutC 0.00e+00 2.43e-12 3.35e-16 0.8605
1. PBF B5F3I3 Copper homeostasis protein CutC 0.00e+00 1.48e-27 1.83e-28 0.8934
1. PBF Q87S45 Copper homeostasis protein CutC 0.00e+00 1.75e-30 2.17e-18 0.856
1. PBF A8AFG8 Copper homeostasis protein CutC 0.00e+00 2.97e-30 3.23e-25 0.9041
1. PBF Q73KH5 Copper homeostasis protein CutC 0.00e+00 1.66e-34 1.24e-20 0.9344
1. PBF A7MT89 Copper homeostasis protein CutC 0.00e+00 2.67e-32 9.36e-20 0.8552
1. PBF Q8FGQ2 Copper homeostasis protein CutC 0.00e+00 2.57e-32 5.08e-25 0.8858
1. PBF A9QYY3 Copper homeostasis protein CutC 0.00e+00 5.82e-26 2.85e-22 0.8924
1. PBF C6DFE1 Copper homeostasis protein CutC 0.00e+00 2.51e-24 5.67e-20 0.9397
1. PBF A8GFJ9 Copper homeostasis protein CutC 0.00e+00 2.53e-21 3.46e-19 0.8807
1. PBF Q64Q87 Copper homeostasis protein CutC 0.00e+00 1.27e-25 7.32e-22 0.9194
1. PBF Q98L96 Copper homeostasis protein CutC 0.00e+00 3.68e-22 1.14e-28 0.9351
1. PBF C5B835 Copper homeostasis protein CutC 0.00e+00 2.19e-23 1.99e-24 0.8959
1. PBF B4T805 Copper homeostasis protein CutC 0.00e+00 6.59e-28 5.57e-28 0.8867
1. PBF B7MW68 Copper homeostasis protein CutC 0.00e+00 2.94e-29 5.02e-25 0.8851
1. PBF B5BH48 Copper homeostasis protein CutC 0.00e+00 1.75e-28 9.96e-28 0.8867
1. PBF Q5XDL5 Copper homeostasis protein CutC 0.00e+00 7.84e-13 1.62e-14 0.8796
1. PBF B7VJR1 Copper homeostasis protein CutC 0.00e+00 2.28e-27 6.50e-21 0.8562
1. PBF Q8ZNV0 Copper homeostasis protein CutC 0.00e+00 1.48e-27 1.83e-28 0.8942
1. PBF C4ZQF8 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 0.9018
1. PBF B2RIS4 Copper homeostasis protein CutC 0.00e+00 2.38e-32 5.44e-21 0.9015
1. PBF Q8PI07 Copper homeostasis protein CutC 0.00e+00 4.52e-34 4.88e-15 0.8784
1. PBF A1AC35 Copper homeostasis protein CutC 0.00e+00 3.42e-33 1.72e-24 0.8973
1. PBF B7NS44 Copper homeostasis protein CutC 0.00e+00 1.49e-32 5.58e-25 0.8859
1. PBF Q9A5T7 Copper homeostasis protein CutC 0.00e+00 1.69e-33 6.18e-15 0.9076
1. PBF Q1C825 Copper homeostasis protein CutC 0.00e+00 1.23e-25 1.19e-22 0.8919
1. PBF Q5PMZ0 Copper homeostasis protein CutC 0.00e+00 1.75e-28 9.96e-28 0.8868
1. PBF Q8DEX2 Copper homeostasis protein CutC 0.00e+00 2.91e-30 1.78e-21 0.8435
1. PBF B1J0L4 Copper homeostasis protein CutC 0.00e+00 5.33e-32 4.67e-25 0.8851
1. PBF A7ZN00 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 0.9021
1. PBF B1XHE2 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 0.8852
1. PBF B0RQ55 Copper homeostasis protein CutC 0.00e+00 1.00e-31 6.76e-15 0.8803
1. PBF Q7N557 Copper homeostasis protein CutC 0.00e+00 2.84e-20 3.51e-19 0.8809
1. PBF B2K314 Copper homeostasis protein CutC 0.00e+00 9.06e-26 3.68e-23 0.892
1. PBF B2VJB9 Copper homeostasis protein CutC 0.00e+00 4.94e-24 9.70e-22 0.9062
1. PBF Q9CNA6 Copper homeostasis protein CutC 0.00e+00 1.40e-34 6.36e-28 0.9378
1. PBF P67825 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 0.8853
1. PBF Q1RAR0 Copper homeostasis protein CutC 0.00e+00 3.42e-33 1.72e-24 0.8854
1. PBF B5YR19 Copper homeostasis protein CutC 0.00e+00 5.41e-29 4.34e-25 0.885
1. PBF B7M2G5 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 0.8858
1. PBF B4ETN7 Copper homeostasis protein CutC 0.00e+00 7.19e-28 5.14e-21 0.8946
1. PBF Q7NY61 Copper homeostasis protein CutC 0.00e+00 5.18e-36 1.51e-20 0.8766
1. PBF Q8P6Q4 Copper homeostasis protein CutC 0.00e+00 4.58e-31 2.96e-15 0.8801
1. PBF Q8ZEV5 Copper homeostasis protein CutC 0.00e+00 1.23e-25 1.19e-22 0.8918
1. PBF A6UF02 Copper homeostasis protein CutC 0.00e+00 5.13e-29 5.11e-20 0.8704
1. PBF Q87DU4 Copper homeostasis protein CutC 0.00e+00 1.31e-18 2.76e-23 0.886
1. PBF Q4UXF8 Copper homeostasis protein CutC 0.00e+00 4.58e-31 2.96e-15 0.8805
1. PBF Q7MWB6 Copper homeostasis protein CutC 0.00e+00 2.45e-31 6.29e-22 0.8798
1. PBF A8A176 Copper homeostasis protein CutC 0.00e+00 5.33e-32 4.67e-25 0.885
1. PBF B8GZC1 Copper homeostasis protein CutC 0.00e+00 1.69e-33 6.18e-15 0.9091
1. PBF B0URL9 Copper homeostasis protein CutC 0.00e+00 4.13e-33 2.10e-27 0.927
1. PBF Q5L9Y1 Copper homeostasis protein CutC 0.00e+00 4.21e-25 2.23e-21 0.9192
1. PBF Q8XCH4 Copper homeostasis protein CutC 0.00e+00 5.41e-29 4.34e-25 0.885
1. PBF C3LSY3 Copper homeostasis protein CutC 0.00e+00 3.95e-28 5.65e-24 0.8772
1. PBF A4TJL0 Copper homeostasis protein CutC 0.00e+00 1.23e-25 1.19e-22 0.8918
1. PBF Q7MNH9 Copper homeostasis protein CutC 0.00e+00 6.50e-31 2.75e-21 0.8473
1. PBF Q8Z5V9 Copper homeostasis protein CutC 0.00e+00 5.87e-21 9.21e-28 0.9414
1. PBF Q0TGV9 Copper homeostasis protein CutC 0.00e+00 2.57e-32 5.08e-25 0.8853
1. PBF Q32H71 Copper homeostasis protein CutC 0.00e+00 2.37e-29 1.56e-25 0.885
1. PBF Q0T3Q3 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 0.9015
1. PBF Q6LU78 Copper homeostasis protein CutC 0.00e+00 3.60e-35 4.11e-25 0.8804
1. PBF B7MBT3 Copper homeostasis protein CutC 0.00e+00 3.42e-33 1.72e-24 0.8854
1. PBF B5F9Z0 Copper homeostasis protein CutC 0.00e+00 3.81e-32 2.80e-19 0.8596
1. PBF Q2NTJ9 Copper homeostasis protein CutC 0.00e+00 4.05e-22 6.91e-19 0.9411
1. PBF Q8UCA5 Copper homeostasis protein CutC 0.00e+00 3.91e-27 4.59e-17 0.8844
1. PBF B1LCZ7 Copper homeostasis protein CutC 0.00e+00 7.57e-33 6.60e-25 0.8855
2. PF Q9ZBH3 Putative (5-formylfuran-3-yl)methyl phosphate synthase 1.80e-13 4.01e-08 NA 0.7838
2. PF A1T2Z5 Thiamine-phosphate synthase 2.71e-09 6.06e-07 NA 0.6624
2. PF P72966 Photosystem I biogenesis protein BtpA 2.63e-11 1.14e-04 NA 0.6704
2. PF C0QU74 Pyridoxine 5'-phosphate synthase 3.52e-10 5.27e-10 NA 0.6523
2. PF A6USK6 (5-formylfuran-3-yl)methyl phosphate synthase 8.04e-14 3.06e-11 NA 0.7604
2. PF A0R981 Thiamine-phosphate synthase 3.00e-09 1.54e-03 NA 0.637
2. PF Q8PXV2 (5-formylfuran-3-yl)methyl phosphate synthase 2.66e-13 5.69e-09 NA 0.787
2. PF Q8AAD8 Tryptophan synthase alpha chain 8.57e-08 9.99e-05 NA 0.5884
2. PF A6L9J8 Tryptophan synthase alpha chain 1.22e-07 1.00e-02 NA 0.588
2. PF A4W5B6 Thiamine-phosphate synthase 1.46e-09 5.03e-03 NA 0.66
2. PF O26244 (5-formylfuran-3-yl)methyl phosphate synthase 8.18e-14 1.66e-12 NA 0.7489
2. PF A3CV25 3-dehydroquinate dehydratase 2.44e-08 2.90e-02 NA 0.6562
2. PF A9VRN4 Thiamine-phosphate synthase 4.08e-09 1.57e-03 NA 0.6827
2. PF Q4J8X8 Tryptophan synthase alpha chain 1.11e-08 1.20e-06 NA 0.6362
2. PF Q6HP17 Thiamine-phosphate synthase 2.97e-09 1.09e-03 NA 0.6372
2. PF A5U2W9 Tryptophan synthase alpha chain 4.25e-08 2.73e-03 NA 0.5911
2. PF A0AFC5 Thiamine-phosphate synthase 1.43e-08 2.07e-04 NA 0.6392
2. PF O58974 Uncharacterized protein PH1209 5.34e-12 6.55e-05 NA 0.68
2. PF B1W5S5 Putative (5-formylfuran-3-yl)methyl phosphate synthase 9.51e-14 8.20e-08 NA 0.7878
2. PF Q82AF9 Thiamine-phosphate synthase 9.81e-09 1.80e-05 NA 0.6248
2. PF O29828 Uncharacterized protein AF_0419 1.61e-11 5.48e-05 NA 0.6559
2. PF A9A7Q1 (5-formylfuran-3-yl)methyl phosphate synthase 6.83e-14 6.15e-12 NA 0.7335
2. PF A5UNQ5 (5-formylfuran-3-yl)methyl phosphate synthase 1.24e-13 1.76e-11 NA 0.7583
2. PF O58462 Orotidine 5'-phosphate decarboxylase 2.14e-09 7.53e-09 NA 0.7404
2. PF P61410 Thiamine-phosphate synthase 1.71e-06 3.81e-03 NA 0.6234
2. PF Q9X4H5 Putative (5-formylfuran-3-yl)methyl phosphate synthase 1.24e-13 7.71e-06 NA 0.7822
2. PF P75293 Probable 3-keto-L-gulonate-6-phosphate decarboxylase 1.06e-09 4.16e-05 NA 0.6812
2. PF Q8THS6 (5-formylfuran-3-yl)methyl phosphate synthase 2.47e-13 9.27e-12 NA 0.7637
2. PF A6UU96 (5-formylfuran-3-yl)methyl phosphate synthase 6.73e-14 1.54e-08 NA 0.7809
2. PF Q8GEK8 Putative (5-formylfuran-3-yl)methyl phosphate synthase 6.72e-14 5.68e-08 NA 0.7514
2. PF A4W0K4 Thiamine-phosphate synthase 3.85e-09 1.93e-04 NA 0.6147
2. PF C3L627 Thiamine-phosphate synthase 2.48e-06 2.00e-03 NA 0.6381
2. PF P9WFY0 Tryptophan synthase alpha chain 4.25e-08 2.73e-03 NA 0.5642
2. PF A4FY92 (5-formylfuran-3-yl)methyl phosphate synthase 7.61e-14 1.58e-12 NA 0.779
2. PF Q9UZT4 Uncharacterized protein PYRAB10620 8.53e-12 3.48e-06 NA 0.6679
2. PF A0B6K7 3-dehydroquinate dehydratase 1.63e-08 5.41e-04 NA 0.6298
2. PF Q971Z6 Tryptophan synthase alpha chain 8.56e-09 5.52e-07 NA 0.6462
2. PF A8G8F3 Thiamine-phosphate synthase 8.34e-10 2.85e-04 NA 0.6691
2. PF Q6LZC1 (5-formylfuran-3-yl)methyl phosphate synthase 7.32e-14 2.74e-11 NA 0.7776
2. PF O22018 Tryptophan synthase alpha chain 5.01e-08 4.89e-05 NA 0.6415
2. PF C1ANN5 Tryptophan synthase alpha chain 4.18e-08 2.73e-03 NA 0.5603
2. PF P66981 Tryptophan synthase alpha chain 4.36e-08 2.73e-03 NA 0.5604
2. PF O28087 (5-formylfuran-3-yl)methyl phosphate synthase 1.59e-13 6.97e-12 NA 0.7595
2. PF P61412 Thiamine-phosphate synthase 3.62e-09 1.44e-05 NA 0.6566
2. PF Q46DH3 (5-formylfuran-3-yl)methyl phosphate synthase 3.15e-13 3.33e-12 NA 0.7683
2. PF A1KJ29 Tryptophan synthase alpha chain 4.24e-08 2.73e-03 NA 0.5648
2. PF Q18DY7 3-dehydroquinate dehydratase 1.30e-07 1.37e-03 NA 0.5807
2. PF A6VK15 (5-formylfuran-3-yl)methyl phosphate synthase 7.43e-14 1.81e-11 NA 0.779
2. PF Q9S2V2 Thiamine-phosphate synthase 4.71e-09 2.81e-05 NA 0.5976
4. PB P34630 Copper homeostasis protein cutC homolog 0.00e+00 8.19e-34 3.60e-17 NA
4. PB Q9VF71 Copper homeostasis protein cutC homolog 0.00e+00 6.90e-26 2.78e-18 NA
4. PB Q9NTM9 Copper homeostasis protein cutC homolog 0.00e+00 1.28e-13 1.61e-26 NA
4. PB Q54K76 Copper homeostasis protein cutC homolog 0.00e+00 9.06e-26 3.41e-20 NA
4. PB P67826 Copper homeostasis protein CutC 0.00e+00 1.52e-32 9.91e-24 NA
4. PB Q9D8X1 Copper homeostasis protein cutC homolog 0.00e+00 1.55e-17 2.14e-25 NA
5. P C1EV72 Heptaprenylglyceryl phosphate synthase 5.60e-08 1.16e-02 NA NA
5. P Q3MBD2 Tryptophan synthase alpha chain 1.18e-07 1.60e-02 NA NA
5. P A8FEJ7 Tryptophan synthase alpha chain 4.43e-05 2.51e-03 NA NA
5. P Q8NMD0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.15e-08 8.37e-03 NA NA
5. P Q64SX3 Tryptophan synthase alpha chain 9.32e-08 7.09e-03 NA NA
5. P A6L645 Thiamine-phosphate synthase 2.56e-08 4.36e-03 NA NA
5. P Q8U213 Geranylgeranylglyceryl phosphate synthase 1.60e-07 2.01e-02 NA NA
5. P Q5V0G6 Thiamine-phosphate synthase 6.27e-09 2.16e-02 NA NA
5. P Q88MY2 Pyridoxine 5'-phosphate synthase 2.52e-10 7.27e-03 NA NA
5. P P63588 3-dehydroquinate dehydratase 1.94e-05 2.57e-03 NA NA
5. P Q31K20 Orotidine 5'-phosphate decarboxylase 1.56e-08 1.59e-02 NA NA
5. P A2RCG2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.10e-08 7.05e-06 NA NA
5. P A8AKT3 Thiazole synthase 5.81e-05 2.23e-02 NA NA
5. P Q31R76 Tryptophan synthase alpha chain 8.35e-08 6.31e-03 NA NA
5. P C0Q3N3 Tryptophan synthase alpha chain 3.99e-07 8.51e-04 NA NA
5. P B3DF93 Pyridoxine 5'-phosphate synthase 1.09e-09 8.02e-06 NA NA
5. P A8ZZW7 Tryptophan synthase alpha chain 3.26e-05 5.08e-04 NA NA
5. P Q8PXE7 3-dehydroquinate dehydratase 2.06e-08 8.07e-04 NA NA
5. P B4TX39 Tryptophan synthase alpha chain 4.83e-07 2.55e-03 NA NA
5. P B5R6M4 Tryptophan synthase alpha chain 4.33e-07 5.71e-04 NA NA
5. P P0DC68 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.14e-08 1.10e-06 NA NA
5. P A5IBF6 N-(5'-phosphoribosyl)anthranilate isomerase 7.28e-10 5.49e-16 NA NA
5. P Q31HP0 Pyridoxine 5'-phosphate synthase 4.31e-10 2.42e-03 NA NA
5. P P66921 Thiamine-phosphate synthase 2 6.88e-10 2.19e-05 NA NA
5. P A0KMD1 Tryptophan synthase alpha chain 2.58e-07 3.15e-02 NA NA
5. P Q0A9A1 Tryptophan synthase alpha chain 1.14e-05 2.56e-02 NA NA
5. P B7V0S0 Tryptophan synthase alpha chain 3.07e-05 1.96e-04 NA NA
5. P Q5XCK8 Orotidine 5'-phosphate decarboxylase 2.63e-08 5.52e-03 NA NA
5. P P66917 Thiamine-phosphate synthase 1.96e-08 3.11e-06 NA NA
5. P B5FU65 Tryptophan synthase alpha chain 3.06e-03 5.71e-04 NA NA
5. P P26920 Tryptophan synthase alpha chain 8.74e-08 2.25e-06 NA NA
5. P Q82UQ7 Thiamine-phosphate synthase 5.11e-09 1.74e-03 NA NA
5. P Q2JSG7 Pyridoxine 5'-phosphate synthase 2.49e-09 4.88e-08 NA NA
5. P Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 2.09e-10 1.22e-06 NA NA
5. P Q7U8P3 Orotidine 5'-phosphate decarboxylase 6.96e-09 2.19e-02 NA NA
5. P O84173 Tryptophan synthase alpha chain 1.17e-06 1.20e-02 NA NA
5. P A6U4X9 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.27e-06 1.54e-03 NA NA
5. P A5F6Y1 Orotidine 5'-phosphate decarboxylase 2.16e-07 5.71e-04 NA NA
5. P B0KV24 Pyridoxine 5'-phosphate synthase 2.68e-10 1.56e-02 NA NA
5. P Q3MA33 N-(5'-phosphoribosyl)anthranilate isomerase 1.82e-10 4.39e-14 NA NA
5. P B0T3H6 Pyridoxine 5'-phosphate synthase 3.43e-10 3.11e-06 NA NA
5. P Q8CPB0 Tryptophan synthase alpha chain 3.90e-08 7.91e-05 NA NA
5. P Q31AB8 Pyridoxine 5'-phosphate synthase 1.58e-09 3.06e-11 NA NA
5. P B9LQ97 N-(5'-phosphoribosyl)anthranilate isomerase 8.07e-11 5.86e-19 NA NA
5. P Q1J7B3 3-dehydroquinate dehydratase 1.24e-05 2.36e-02 NA NA
5. P Q9HJH3 Geranylgeranylglyceryl phosphate synthase 3.03e-08 2.44e-02 NA NA
5. P B8GQE5 Tryptophan synthase alpha chain 6.56e-08 1.76e-02 NA NA
5. P A3CN89 Orotidine 5'-phosphate decarboxylase 4.74e-08 2.26e-03 NA NA
5. P B9JMX8 Thiazole synthase 6.63e-05 7.09e-03 NA NA
5. P B7HSW3 Heptaprenylglyceryl phosphate synthase 5.65e-08 1.90e-02 NA NA
5. P Q5FHH4 Pyridoxine 5'-phosphate synthase 7.08e-10 1.81e-07 NA NA
5. P B1J538 N-(5'-phosphoribosyl)anthranilate isomerase 5.64e-10 1.07e-19 NA NA
5. P C6DYM2 N-(5'-phosphoribosyl)anthranilate isomerase 1.04e-09 2.04e-18 NA NA
5. P Q5HL35 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.81e-08 1.67e-02 NA NA
5. P Q5LZW9 Orotidine 5'-phosphate decarboxylase 3.99e-08 3.72e-02 NA NA
5. P P63589 3-dehydroquinate dehydratase 1.98e-05 2.57e-03 NA NA
5. P Q4L7M1 Heptaprenylglyceryl phosphate synthase 2.80e-08 3.93e-05 NA NA
5. P B2I656 Orotidine 5'-phosphate decarboxylase 1.06e-09 2.92e-03 NA NA
5. P C1FSC1 Thiamine-phosphate synthase 3.75e-09 6.68e-05 NA NA
5. P B6J6K1 3-dehydroquinate dehydratase 8.64e-09 2.75e-04 NA NA
5. P O67098 Ribulose-phosphate 3-epimerase 3.23e-11 5.61e-03 NA NA
5. P Q6LPA3 Tryptophan synthase alpha chain 3.40e-07 1.81e-02 NA NA
5. P A3MUC6 Triosephosphate isomerase 6.89e-09 1.08e-03 NA NA
5. P P12291 Tryptophan synthase alpha chain 5.44e-08 5.75e-03 NA NA
5. P Q875I3 N-(5'-phosphoribosyl)anthranilate isomerase 1.19e-08 3.95e-15 NA NA
5. P A4IQ83 N-(5'-phosphoribosyl)anthranilate isomerase 1.33e-11 4.78e-16 NA NA
5. P B5XS09 Orotidine 5'-phosphate decarboxylase 6.45e-08 2.88e-02 NA NA
5. P A7HPD4 N-(5'-phosphoribosyl)anthranilate isomerase 7.23e-10 4.35e-19 NA NA
5. P Q5HG46 Tryptophan synthase alpha chain 3.42e-08 5.40e-06 NA NA
5. P Q9X4E3 N-(5'-phosphoribosyl)anthranilate isomerase 1.88e-09 1.15e-16 NA NA
5. P B1J5Q0 Orotidine 5'-phosphate decarboxylase 5.86e-08 2.44e-03 NA NA
5. P B7L4B7 Orotidine 5'-phosphate decarboxylase 3.79e-08 2.13e-02 NA NA
5. P B8DCI1 3-dehydroquinate dehydratase 5.22e-09 2.28e-03 NA NA
5. P Q88LE0 N-(5'-phosphoribosyl)anthranilate isomerase 8.48e-10 6.81e-19 NA NA
5. P A8MAX6 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.49e-06 4.40e-03 NA NA
5. P Q58114 Uncharacterized protein MJ0703 5.56e-07 4.82e-02 NA NA
5. P B5E5N5 3-dehydroquinate dehydratase 2.06e-05 3.35e-03 NA NA
5. P B3PYJ5 Orotidine 5'-phosphate decarboxylase 2.28e-09 6.76e-04 NA NA
5. P Q57700 Orotidine 5'-phosphate decarboxylase 1.56e-08 6.35e-04 NA NA
5. P B9JXN7 Pyridoxine 5'-phosphate synthase 1.34e-08 2.55e-05 NA NA
5. P B1GZC1 N-(5'-phosphoribosyl)anthranilate isomerase 2.95e-10 2.84e-20 NA NA
5. P B2VD79 Thiazole synthase 1.11e-05 3.74e-03 NA NA
5. P Q1QDV0 Pyridoxine 5'-phosphate synthase 4.65e-09 7.27e-03 NA NA
5. P A5VRD3 Pyridoxine 5'-phosphate synthase 2.55e-08 1.88e-06 NA NA
5. P Q8P3D7 Orotidine 5'-phosphate decarboxylase 5.96e-10 1.39e-03 NA NA
5. P Q02YB8 Tryptophan synthase alpha chain 3.01e-08 3.63e-02 NA NA
5. P Q465F4 Tryptophan synthase alpha chain 4.49e-08 4.93e-02 NA NA
5. P A1RJR5 Thiazole synthase 5.93e-06 4.53e-02 NA NA
5. P Q1C1U8 Thiamine-phosphate synthase 2.00e-09 1.20e-02 NA NA
5. P A6L7N1 Tryptophan synthase alpha chain 5.40e-08 3.78e-02 NA NA
5. P Q1GU89 Orotidine 5'-phosphate decarboxylase 2.29e-08 1.05e-02 NA NA
5. P Q8P1C0 Orotidine 5'-phosphate decarboxylase 3.18e-08 1.15e-02 NA NA
5. P Q0T5B6 Orotidine 5'-phosphate decarboxylase 4.40e-08 2.19e-02 NA NA
5. P Q2G0K7 3-hexulose-6-phosphate synthase 2.96e-12 2.22e-07 NA NA
5. P B1XG01 3-dehydroquinate dehydratase 3.95e-09 1.65e-02 NA NA
5. P Q6KZH9 Thiamine-phosphate synthase 2.87e-06 2.32e-06 NA NA
5. P B9JXV5 N-(5'-phosphoribosyl)anthranilate isomerase 5.77e-10 1.04e-13 NA NA
5. P A5IPI5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.31e-08 2.88e-04 NA NA
5. P Q3YX25 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.10e-06 8.93e-05 NA NA
5. P B5ENK9 Thiazole synthase 1.23e-09 1.91e-02 NA NA
5. P Q2P0U0 N-(5'-phosphoribosyl)anthranilate isomerase 1.20e-09 5.55e-15 NA NA
5. P A4XSC7 Pyridoxine 5'-phosphate synthase 2.70e-10 8.13e-05 NA NA
5. P A9M276 Pyridoxine 5'-phosphate synthase 4.86e-10 7.94e-06 NA NA
5. P P65522 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.24e-08 1.86e-06 NA NA
5. P Q3V8B3 Pyridoxine 5'-phosphate synthase 8.02e-09 2.47e-06 NA NA
5. P B5R486 Orotidine 5'-phosphate decarboxylase 5.62e-08 1.51e-02 NA NA
5. P P31605 Uncharacterized protein ycf23 7.30e-10 7.59e-04 NA NA
5. P Q2IWU8 Pyridoxine 5'-phosphate synthase 6.12e-10 1.68e-03 NA NA
5. P C0Q9S7 Pyridoxine 5'-phosphate synthase 1.54e-09 2.59e-03 NA NA
5. P B9K256 Thiazole synthase 8.25e-06 1.52e-03 NA NA
5. P A5GN53 Orotidine 5'-phosphate decarboxylase 4.59e-08 4.47e-03 NA NA
5. P Q30XT2 Orotidine 5'-phosphate decarboxylase 2.57e-08 9.17e-03 NA NA
5. P A8IEY6 Thiazole synthase 1.01e-04 1.03e-02 NA NA
5. P B1I7S8 N-(5'-phosphoribosyl)anthranilate isomerase 8.29e-10 6.86e-16 NA NA
5. P A5IKT2 N-(5'-phosphoribosyl)anthranilate isomerase 3.63e-09 1.56e-20 NA NA
5. P O28673 Tryptophan synthase alpha chain 2.69e-08 4.95e-03 NA NA
5. P Q8U094 Tryptophan synthase alpha chain 1.73e-07 5.41e-04 NA NA
5. P O58851 Geranylgeranylglyceryl phosphate synthase 1.14e-07 9.63e-03 NA NA
5. P Q63Q73 Thiazole synthase 9.78e-05 2.07e-04 NA NA
5. P Q2IM25 Thiamine-phosphate synthase 7.14e-10 3.41e-05 NA NA
5. P C5A0T1 Thiazole synthase 5.19e-05 5.25e-03 NA NA
5. P Q8A0V3 Pyridoxine 5'-phosphate synthase 1.12e-06 2.73e-05 NA NA
5. P A5W7B0 Orotidine 5'-phosphate decarboxylase 4.30e-08 1.01e-02 NA NA
5. P Q1JNJ8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.12e-08 1.10e-06 NA NA
5. P Q1LKN4 Pyridoxine 5'-phosphate synthase 4.31e-10 7.26e-04 NA NA
5. P Q7TTU0 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.62e-06 2.09e-03 NA NA
5. P P67005 N-(5'-phosphoribosyl)anthranilate isomerase 2.61e-11 1.12e-19 NA NA
5. P Q88WI1 N-(5'-phosphoribosyl)anthranilate isomerase 1.90e-09 1.52e-12 NA NA
5. P A8AW04 N-(5'-phosphoribosyl)anthranilate isomerase 6.19e-10 1.10e-17 NA NA
5. P P66920 Thiamine-phosphate synthase 2 7.38e-10 2.19e-05 NA NA
5. P C3K758 Orotidine 5'-phosphate decarboxylase 4.38e-08 5.61e-03 NA NA
5. P Q12UJ8 3-dehydroquinate dehydratase 4.03e-08 2.68e-02 NA NA
5. P Q5JHG3 Triosephosphate isomerase 3.00e-08 1.08e-06 NA NA
5. P Q893R2 Thiazole synthase 3.37e-10 2.88e-02 NA NA
5. P Q5WWJ5 Thiazole synthase 3.21e-05 4.58e-03 NA NA
5. P A8FVN0 Orotidine 5'-phosphate decarboxylase 6.35e-08 3.08e-03 NA NA
5. P Q97P31 N-(5'-phosphoribosyl)anthranilate isomerase 9.45e-10 4.52e-16 NA NA
5. P A2BX94 Pyridoxine 5'-phosphate synthase 1.23e-09 7.12e-09 NA NA
5. P B1XBN2 Orotidine 5'-phosphate decarboxylase 5.51e-08 2.25e-02 NA NA
5. P Q47HQ6 N-(5'-phosphoribosyl)anthranilate isomerase 5.61e-10 3.14e-16 NA NA
5. P B3PIG8 Thiazole synthase 6.26e-05 2.33e-04 NA NA
5. P Q4L9T7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.00e-06 4.47e-03 NA NA
5. P B8H661 Tryptophan synthase alpha chain 5.40e-08 5.75e-03 NA NA
5. P Q3YUZ4 Thiazole synthase 5.37e-05 7.77e-03 NA NA
5. P O27695 N-(5'-phosphoribosyl)anthranilate isomerase 1.24e-09 1.77e-17 NA NA
5. P P62003 Triosephosphate isomerase 1.78e-08 2.06e-06 NA NA
5. P A6QK86 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.27e-08 1.74e-03 NA NA
5. P Q57H62 Thiamine-phosphate synthase 1.77e-09 2.97e-03 NA NA
5. P Q47QR3 Tryptophan synthase alpha chain 4.31e-08 1.39e-03 NA NA
5. P P50386 N-(5'-phosphoribosyl)anthranilate isomerase 1.40e-09 2.53e-19 NA NA
5. P B7I0F1 N-(5'-phosphoribosyl)anthranilate isomerase 1.75e-09 4.21e-16 NA NA
5. P Q6AIT8 3-dehydroquinate dehydratase 7.49e-09 2.56e-02 NA NA
5. P Q3V7S9 Pyridoxine 5'-phosphate synthase 5.04e-10 6.18e-04 NA NA
5. P P0DC80 Orotidine 5'-phosphate decarboxylase 2.46e-08 1.06e-02 NA NA
5. P Q884R0 Orotidine 5'-phosphate decarboxylase 4.52e-08 2.40e-03 NA NA
5. P B7UJV6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.23e-06 8.29e-05 NA NA
5. P C1C8S3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.24e-08 3.54e-05 NA NA
5. P Q87FA3 Orotidine 5'-phosphate decarboxylase 1.48e-09 2.92e-03 NA NA
5. P Q49VB7 3-hexulose-6-phosphate synthase 3 3.58e-12 5.58e-07 NA NA
5. P A4XG66 Thiamine-phosphate synthase 5.33e-10 7.58e-03 NA NA
5. P Q57NV3 Orotidine 5'-phosphate decarboxylase 3.39e-08 2.21e-02 NA NA
5. P Q5JDB0 Orotidine 5'-phosphate decarboxylase 6.24e-09 1.14e-06 NA NA
5. P Q8D249 Thiazole synthase 4.39e-05 4.97e-02 NA NA
5. P Q3IT31 Geranylgeranylglyceryl phosphate synthase 7.64e-09 1.88e-02 NA NA
5. P P59442 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.06e-06 1.73e-04 NA NA
5. P Q8PXE2 Triosephosphate isomerase 1.31e-07 2.09e-05 NA NA
5. P Q8NYC4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.39e-08 2.41e-05 NA NA
5. P Q5E317 Pyridoxine 5'-phosphate synthase 2.33e-10 4.71e-05 NA NA
5. P Q9UWN5 Triosephosphate isomerase 1.23e-07 1.08e-07 NA NA
5. P Q6LPE7 Orotidine 5'-phosphate decarboxylase 1.31e-07 3.74e-03 NA NA
5. P A4QEI3 Orotidine 5'-phosphate decarboxylase 1.58e-05 2.28e-02 NA NA
5. P B5R0R3 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.33e-09 2.27e-08 NA NA
5. P A9WDL8 Thiamine-phosphate synthase 5.12e-10 7.03e-03 NA NA
5. P Q8CSN5 N-(5'-phosphoribosyl)anthranilate isomerase 3.05e-11 1.68e-18 NA NA
5. P B2RIJ5 Pyridoxine 5'-phosphate synthase 3.19e-09 1.66e-09 NA NA
5. P C3K2K2 Thiamine-phosphate synthase 7.89e-06 3.18e-04 NA NA
5. P Q9PNL3 Thiamine-phosphate synthase 2.87e-09 7.52e-04 NA NA
5. P Q216G8 Thiazole synthase 5.64e-05 4.67e-02 NA NA
5. P A7ZUK8 Thiamine-phosphate synthase 1.73e-09 6.52e-03 NA NA
5. P B1LGI8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.99e-06 1.69e-04 NA NA
5. P Q92B82 Tryptophan synthase alpha chain 5.35e-08 1.66e-04 NA NA
5. P Q6N3W7 Thiazole synthase 7.09e-06 3.66e-02 NA NA
5. P Q81GG6 N-(5'-phosphoribosyl)anthranilate isomerase 5.29e-09 1.32e-14 NA NA
5. P Q5F6P1 Pyridoxine 5'-phosphate synthase 5.28e-10 8.18e-06 NA NA
5. P A0Q2A0 Thiamine-phosphate synthase 3.63e-09 2.22e-03 NA NA
5. P Q8U192 Thiamine-phosphate synthase 3.85e-10 1.00e-02 NA NA
5. P Q0BWJ4 N-(5'-phosphoribosyl)anthranilate isomerase 1.18e-10 3.67e-13 NA NA
5. P B1HQC3 Orotidine 5'-phosphate decarboxylase 2.02e-07 5.25e-03 NA NA
5. P A5FY58 Tryptophan synthase alpha chain 2.56e-08 2.28e-05 NA NA
5. P Q49YV0 Heptaprenylglyceryl phosphate synthase 9.64e-08 4.00e-06 NA NA
5. P B2V6U1 Pyridoxine 5'-phosphate synthase 1.75e-09 8.24e-09 NA NA
5. P B8DKC9 Orotidine 5'-phosphate decarboxylase 2.31e-07 7.00e-05 NA NA
5. P Q9YGA9 Tryptophan synthase alpha chain 9.69e-08 4.65e-06 NA NA
5. P A1W068 Thiamine-phosphate synthase 2.87e-09 2.09e-03 NA NA
5. P Q38ZM1 Thiamine-phosphate synthase 3.94e-08 3.95e-04 NA NA
5. P B2HQX9 Tryptophan synthase alpha chain 4.54e-08 2.60e-02 NA NA
5. P Q2NT53 Tryptophan synthase alpha chain 8.54e-04 2.36e-02 NA NA
5. P P35146 3-dehydroquinate dehydratase 1.07e-09 1.50e-04 NA NA
5. P Q0VP22 Pyridoxine 5'-phosphate synthase 1.03e-09 5.42e-03 NA NA
5. P A9KL42 N-(5'-phosphoribosyl)anthranilate isomerase 3.60e-09 1.54e-10 NA NA
5. P B5BKK4 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.26e-09 2.27e-08 NA NA
5. P Q74HT0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.42e-08 2.23e-04 NA NA
5. P Q9ZN53 Orotidine 5'-phosphate decarboxylase 5.51e-08 3.20e-02 NA NA
5. P A0LTK3 Thiamine-phosphate synthase 1.47e-08 2.34e-05 NA NA
5. P Q4J8X6 N-(5'-phosphoribosyl)anthranilate isomerase 5.68e-10 2.05e-19 NA NA
5. P P65656 3-methyl-2-oxobutanoate hydroxymethyltransferase 5.75e-06 1.54e-03 NA NA
5. P Q8DUW4 3-dehydroquinate dehydratase 1.37e-05 1.26e-04 NA NA
5. P A6WNR8 Thiazole synthase 6.41e-06 1.94e-02 NA NA
5. P Q9F812 Thiazole synthase 4.66e-05 3.90e-02 NA NA
5. P Q83CG2 Tryptophan synthase alpha chain 5.39e-07 1.82e-02 NA NA
5. P Q62GC6 Thiazole synthase 9.13e-05 2.07e-04 NA NA
5. P Q9KQT7 Orotidine 5'-phosphate decarboxylase 9.88e-08 7.93e-04 NA NA
5. P Q5WGS0 Tryptophan synthase alpha chain 1.77e-05 3.22e-02 NA NA
5. P Q57FG5 Thiazole synthase 2.65e-05 6.02e-04 NA NA
5. P C1DMY6 Thiamine-phosphate synthase 4.49e-06 2.21e-06 NA NA
5. P B5RFJ1 Thiamine-phosphate synthase 1.82e-09 1.91e-02 NA NA
5. P A8Z5Y2 Tryptophan synthase alpha chain 5.66e-05 4.40e-04 NA NA
5. P C1CT52 N-(5'-phosphoribosyl)anthranilate isomerase 7.82e-10 4.84e-16 NA NA
5. P B7UQK5 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.87e-10 1.77e-07 NA NA
5. P A4SWX7 Tryptophan synthase alpha chain 2.18e-05 6.41e-03 NA NA
5. P Q96Y90 3-dehydroquinate dehydratase 8.47e-06 8.73e-03 NA NA
5. P B4S2W0 Thiazole synthase 5.22e-05 1.48e-02 NA NA
5. P Q4UYA4 Thiamine-phosphate synthase 6.53e-08 1.84e-03 NA NA
5. P O26666 3-dehydroquinate dehydratase 1.40e-04 5.16e-03 NA NA
5. P A7ZZJ6 Tryptophan synthase alpha chain 2.81e-03 3.74e-03 NA NA
5. P Q8FHU2 Orotidine 5'-phosphate decarboxylase 4.46e-08 3.38e-02 NA NA
5. P C1CSU8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.23e-08 3.54e-05 NA NA
5. P P07344 Tryptophan synthase alpha chain 3.08e-05 2.60e-04 NA NA
5. P B5FDB6 Tryptophan synthase alpha chain 6.29e-05 1.64e-02 NA NA
5. P Q1D282 Thiamine-phosphate synthase 1.66e-09 4.18e-02 NA NA
5. P A5W8E9 Pyridoxine 5'-phosphate synthase 2.15e-10 2.36e-04 NA NA
5. P B7LY16 Tryptophan synthase alpha chain 4.18e-03 4.62e-03 NA NA
5. P Q7TU60 3-methyl-2-oxobutanoate hydroxymethyltransferase 5.93e-06 7.65e-04 NA NA
5. P A0RN82 3-methyl-2-oxobutanoate hydroxymethyltransferase 8.53e-06 4.28e-02 NA NA
5. P O25514 Thiamine-phosphate synthase 1.10e-08 4.99e-03 NA NA
5. P B7J4T0 N-(5'-phosphoribosyl)anthranilate isomerase 1.73e-09 5.93e-22 NA NA
5. P Q9JVD1 N-(5'-phosphoribosyl)anthranilate isomerase 2.22e-09 5.72e-14 NA NA
5. P B2I669 Pyridoxine 5'-phosphate synthase 2.69e-09 1.01e-06 NA NA
5. P B7JET1 Tryptophan synthase alpha chain 2.19e-08 2.60e-05 NA NA
5. P A1US08 Thiazole synthase 7.20e-06 3.75e-02 NA NA
5. P Q3V7I6 Pyridoxine 5'-phosphate synthase 1.59e-10 5.50e-09 NA NA
5. P A5ISQ5 Tryptophan synthase alpha chain 3.00e-08 4.29e-06 NA NA
5. P Q8DVF4 N-(5'-phosphoribosyl)anthranilate isomerase 1.26e-09 9.87e-17 NA NA
5. P Q7NMK3 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.70e-06 4.64e-04 NA NA
5. P Q0HJ08 Thiazole synthase 4.50e-06 1.99e-02 NA NA
5. P B5F1H6 Thiamine-phosphate synthase 2.06e-09 9.17e-03 NA NA
5. P Q8ZN19 Pyridoxine 5'-phosphate synthase 2.39e-10 4.30e-11 NA NA
5. P B7MU99 Tryptophan synthase alpha chain 9.07e-04 4.07e-03 NA NA
5. P Q2FV21 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.15e-06 1.54e-03 NA NA
5. P Q03JC2 Tryptophan synthase alpha chain 7.69e-08 4.58e-03 NA NA
5. P C1C965 Tryptophan synthase alpha chain 5.50e-08 9.39e-06 NA NA
5. P Q822W2 Tryptophan synthase alpha chain 5.01e-05 3.53e-03 NA NA
5. P Q2YXU8 N-(5'-phosphoribosyl)anthranilate isomerase 2.62e-11 1.09e-16 NA NA
5. P B7LRJ1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.12e-06 7.98e-05 NA NA
5. P B7I534 Orotidine 5'-phosphate decarboxylase 2.64e-08 9.63e-04 NA NA
5. P A5G6M1 Tryptophan synthase alpha chain 2.72e-08 5.48e-05 NA NA
5. P A9VJW3 Tryptophan synthase alpha chain 1.95e-08 7.98e-05 NA NA
5. P Q9A077 Orotidine 5'-phosphate decarboxylase 2.71e-08 4.51e-03 NA NA
5. P Q3SHM0 Tryptophan synthase alpha chain 8.78e-08 5.27e-04 NA NA
5. P Q2JW90 N-(5'-phosphoribosyl)anthranilate isomerase 7.23e-10 1.77e-13 NA NA
5. P B6I9Z7 Orotidine 5'-phosphate decarboxylase 3.99e-08 2.13e-02 NA NA
5. P P57365 Tryptophan synthase alpha chain 3.58e-05 2.65e-04 NA NA
5. P P70938 N-(5'-phosphoribosyl)anthranilate isomerase 3.84e-10 6.96e-16 NA NA
5. P Q1QJD6 Thiazole synthase 7.21e-06 4.15e-02 NA NA
5. P Q5V216 Orotidine 5'-phosphate decarboxylase 8.62e-07 2.42e-02 NA NA
5. P B5R3P3 Tryptophan synthase alpha chain 5.19e-07 5.71e-04 NA NA
5. P B0BU73 Tryptophan synthase alpha chain 2.06e-04 3.27e-03 NA NA
5. P P25053 Thiazole tautomerase 2.12e-09 9.57e-06 NA NA
5. P Q9A808 Pyridoxine 5'-phosphate synthase 7.59e-10 1.42e-04 NA NA
5. P A7I4T3 Tryptophan synthase alpha chain 5.03e-08 2.83e-04 NA NA
5. P Q8FH42 3-dehydroquinate dehydratase 3.87e-09 2.60e-02 NA NA
5. P Q07UH2 N-(5'-phosphoribosyl)anthranilate isomerase 2.01e-10 9.78e-20 NA NA
5. P A1U0X2 Tryptophan synthase alpha chain 6.17e-08 4.18e-02 NA NA
5. P B1LE43 3-dehydroquinate dehydratase 3.89e-09 1.65e-02 NA NA
5. P C1KZ34 Thiamine-phosphate synthase 1.76e-08 9.53e-05 NA NA
5. P Q11PM4 Pyridoxine 5'-phosphate synthase 3.68e-09 2.34e-07 NA NA
5. P B7UYW9 Pyridoxine 5'-phosphate synthase 2.48e-10 8.03e-08 NA NA
5. P P66919 Thiamine-phosphate synthase 7.34e-08 6.66e-07 NA NA
5. P Q6DAM1 Thiamine-phosphate synthase 2.14e-09 6.74e-05 NA NA
5. P P61411 Putative thiamine-phosphate synthase 1.64e-08 2.27e-04 NA NA
5. P Q48DP2 Thiamine-phosphate synthase 6.51e-06 1.09e-02 NA NA
5. P A1TZF4 Orotidine 5'-phosphate decarboxylase 3.26e-08 1.51e-02 NA NA
5. P C5BSJ7 Orotidine 5'-phosphate decarboxylase 1.35e-07 3.66e-02 NA NA
5. P B8FA37 Tryptophan synthase alpha chain 1.36e-07 6.39e-06 NA NA
5. P Q8XXY2 Tryptophan synthase alpha chain 2.20e-05 5.52e-03 NA NA
5. P C1CMD2 Tryptophan synthase alpha chain 5.63e-08 1.02e-05 NA NA
5. P Q0TI84 Orotidine 5'-phosphate decarboxylase 4.55e-08 2.98e-02 NA NA
5. P Q39SS2 Tryptophan synthase alpha chain 8.24e-08 1.55e-02 NA NA
5. P A4XLM3 Tryptophan synthase alpha chain 1.23e-07 1.73e-03 NA NA
5. P A7NRF7 Thiamine-phosphate synthase 1.15e-08 9.02e-03 NA NA
5. P O66833 Thiamine-phosphate synthase 1 2.66e-09 1.62e-04 NA NA
5. P Q3SFU7 Thiamine-phosphate synthase 5.28e-09 6.07e-04 NA NA
5. P P9WFY1 Tryptophan synthase alpha chain 4.54e-08 2.73e-03 NA NA
5. P P66982 Tryptophan synthase alpha chain 2.44e-08 4.29e-06 NA NA
5. P C3P3T9 N-(5'-phosphoribosyl)anthranilate isomerase 2.14e-09 2.58e-14 NA NA
5. P Q8K940 Ribulose-phosphate 3-epimerase 1.02e-09 1.96e-02 NA NA
5. P Q3V7R4 Pyridoxine 5'-phosphate synthase 4.55e-07 9.43e-10 NA NA
5. P Q00384 KHG/KDPG aldolase 1.01e-08 8.22e-04 NA NA
5. P A6WVK9 Thiazole synthase 3.10e-05 1.01e-03 NA NA
5. P Q3AZD9 Orotidine 5'-phosphate decarboxylase 4.85e-08 2.59e-03 NA NA
5. P Q3ZZ13 N-(5'-phosphoribosyl)anthranilate isomerase 1.24e-09 2.59e-08 NA NA
5. P B4U6B2 Thiamine-phosphate synthase 8.44e-09 4.94e-05 NA NA
5. P Q9HIQ4 Thiamine-phosphate synthase 1.49e-08 2.73e-03 NA NA
5. P Q478V2 Thiamine-phosphate synthase 2.89e-09 5.66e-04 NA NA
5. P Q7V5Y2 Orotidine 5'-phosphate decarboxylase 6.56e-09 9.89e-04 NA NA
5. P Q5SL86 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.47e-06 5.85e-03 NA NA
5. P Q5QZ42 Orotidine 5'-phosphate decarboxylase 3.79e-08 3.41e-02 NA NA
5. P B7HH00 N-(5'-phosphoribosyl)anthranilate isomerase 2.20e-09 3.22e-15 NA NA
5. P B6I5K4 Thiamine-phosphate synthase 2.10e-09 2.48e-03 NA NA
5. P A1WYL4 Thiamine-phosphate synthase 4.22e-06 1.82e-04 NA NA
5. P A9BNH8 Tryptophan synthase alpha chain 2.25e-07 3.35e-02 NA NA
5. P A4T2R5 Thiamine-phosphate synthase 4.46e-09 2.68e-06 NA NA
5. P A6L7N0 N-(5'-phosphoribosyl)anthranilate isomerase 4.68e-08 2.78e-18 NA NA
5. P B1XDU7 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.65e-10 1.77e-07 NA NA
5. P Q71VW2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.06e-06 1.75e-02 NA NA
5. P Q2JRY1 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.32e-06 3.33e-02 NA NA
5. P Q1QDK2 Tryptophan synthase alpha chain 6.74e-08 8.00e-04 NA NA
5. P Q7MM57 Tryptophan synthase alpha chain 6.65e-05 1.13e-02 NA NA
5. P A0QLT6 Thiamine-phosphate synthase 4.19e-09 9.96e-06 NA NA
5. P B0T410 Orotidine 5'-phosphate decarboxylase 2.44e-08 9.48e-03 NA NA
5. P Q2FH63 Tryptophan synthase alpha chain 2.75e-08 5.40e-06 NA NA
5. P Q0HRH6 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.46e-08 3.54e-02 NA NA
5. P Q3K6C1 Thiamine-phosphate synthase 6.01e-06 3.41e-05 NA NA
5. P Q5PLF1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 2.87e-06 3.05e-03 NA NA
5. P Q476U3 Thiazole synthase 2.22e-05 4.48e-04 NA NA
5. P B7IUW3 Heptaprenylglyceryl phosphate synthase 6.91e-08 2.09e-03 NA NA
5. P B2TWH8 Thiazole synthase 5.11e-05 7.77e-03 NA NA
5. P P73761 Orotidine 5'-phosphate decarboxylase 3.57e-08 1.84e-03 NA NA
5. P C5CFR2 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.97e-06 3.43e-02 NA NA
5. P Q0AQ76 Thiazole synthase 1.55e-05 3.22e-02 NA NA
5. P A7IM59 Pyridoxine 5'-phosphate synthase 5.08e-10 4.68e-11 NA NA
5. P Q5HBN7 Pyridoxine 5'-phosphate synthase 8.17e-10 1.75e-07 NA NA
5. P B0UU33 Tryptophan synthase alpha chain 1.63e-04 1.40e-03 NA NA
5. P A6L9J9 N-(5'-phosphoribosyl)anthranilate isomerase 4.74e-08 1.87e-16 NA NA
5. P Q2GG30 Pyridoxine 5'-phosphate synthase 4.35e-10 5.42e-11 NA NA
5. P Q6G9I6 Tryptophan synthase alpha chain 3.78e-08 5.40e-06 NA NA
5. P Q4L678 N-(5'-phosphoribosyl)anthranilate isomerase 1.97e-11 1.06e-16 NA NA
5. P A1KWF0 Thiazole synthase 1.01e-06 2.55e-03 NA NA
5. P Q3V7K1 Pyridoxine 5'-phosphate synthase 3.64e-10 4.10e-11 NA NA
5. P A1AIG4 Thiamine-phosphate synthase 3.54e-09 3.38e-03 NA NA
5. P Q185B2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.04e-06 3.41e-03 NA NA
5. P A1KBR9 Orotidine 5'-phosphate decarboxylase 4.45e-07 2.16e-02 NA NA
5. P Q830K5 Thiamine-phosphate synthase 1.30e-09 5.36e-04 NA NA
5. P A9N936 Pyridoxine 5'-phosphate synthase 1.02e-09 2.45e-08 NA NA
5. P B7US32 3-dehydroquinate dehydratase 3.94e-09 2.60e-02 NA NA
5. P A5UUL3 Thiamine-phosphate synthase 2.36e-06 3.65e-03 NA NA
5. P C5D8Q3 Orotidine 5'-phosphate decarboxylase 7.39e-08 1.48e-02 NA NA
5. P A2SSK1 Geranylgeranylglyceryl phosphate synthase 5.90e-08 2.53e-04 NA NA
5. P Q6GBR7 3-hexulose-6-phosphate synthase 2.92e-12 7.86e-07 NA NA
5. P C5D4J0 Heptaprenylglyceryl phosphate synthase 8.31e-08 2.33e-04 NA NA
5. P C5VXY0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.48e-08 1.11e-05 NA NA
5. P C6E497 Orotidine 5'-phosphate decarboxylase 2.08e-08 1.87e-02 NA NA
5. P Q9JTR9 3-dehydroquinate dehydratase 4.09e-09 4.78e-02 NA NA
5. P A1AY12 Thiazole synthase 6.40e-06 4.05e-02 NA NA
5. P Q8THC4 3-dehydroquinate dehydratase 1.37e-08 2.02e-02 NA NA
5. P A1VCV9 Pyridoxine 5'-phosphate synthase 1.06e-09 3.84e-06 NA NA
5. P B8GHM9 Geranylgeranylglyceryl phosphate synthase 7.10e-08 8.22e-04 NA NA
5. P A5CVZ0 Thiazole synthase 9.21e-06 2.42e-02 NA NA
5. P Q6GH34 N-(5'-phosphoribosyl)anthranilate isomerase 3.06e-11 3.10e-17 NA NA
5. P A6Q826 Orotidine 5'-phosphate decarboxylase 1.79e-08 4.21e-03 NA NA
5. P Q63GK3 Thiamine-phosphate synthase 2.57e-06 2.87e-03 NA NA
5. P Q21XI7 Tryptophan synthase alpha chain 1.69e-07 4.93e-02 NA NA
5. P Q97LQ9 Thiamine-phosphate synthase 2.82e-10 1.36e-04 NA NA
5. P B8DD13 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.75e-06 9.13e-04 NA NA
5. P B0RZ30 Orotidine 5'-phosphate decarboxylase 5.72e-10 8.58e-03 NA NA
5. P P56141 Tryptophan synthase alpha chain 3.02e-05 1.66e-04 NA NA
5. P B1IQQ6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.84e-06 1.73e-04 NA NA
5. P Q7M9N9 Thiamine-phosphate synthase 1.96e-06 4.28e-04 NA NA
5. P Q31ZX5 Orotidine 5'-phosphate decarboxylase 5.17e-08 2.70e-02 NA NA
5. P Q8FAI9 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.04e-09 7.36e-08 NA NA
5. P B5F7D7 3-dehydroquinate dehydratase 4.66e-09 6.15e-03 NA NA
5. P A1KFN6 Thiamine-phosphate synthase 2.01e-08 3.11e-06 NA NA
5. P C0RFZ2 Tryptophan synthase alpha chain 2.33e-07 1.05e-02 NA NA
5. P A4YJI7 N-(5'-phosphoribosyl)anthranilate isomerase 1.60e-10 1.59e-18 NA NA
5. P B1VH82 Tryptophan synthase alpha chain 8.73e-08 3.47e-03 NA NA
5. P B7JUK2 Tryptophan synthase alpha chain 4.58e-08 7.33e-03 NA NA
5. P A4WIJ6 Triosephosphate isomerase 2.33e-08 2.98e-02 NA NA
5. P P52563 N-(5'-phosphoribosyl)anthranilate isomerase 1.30e-11 2.42e-13 NA NA
5. P Q8TMD6 Thiamine-phosphate synthase 5.81e-10 4.56e-04 NA NA
5. P Q2YAN9 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.37e-08 2.42e-03 NA NA
5. P B3QUZ7 Thiazole synthase 2.04e-05 5.47e-03 NA NA
5. P Q83BL1 Pyridoxine 5'-phosphate synthase 6.46e-10 2.45e-08 NA NA
5. P Q8NQ40 Orotidine 5'-phosphate decarboxylase 1.69e-05 1.67e-02 NA NA
5. P B0RLF1 Pyridoxine 5'-phosphate synthase 1.81e-08 1.20e-08 NA NA
5. P Q31KC5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.49e-06 1.43e-02 NA NA
5. P B6YX10 3-dehydroquinate dehydratase 5.70e-07 7.58e-03 NA NA
5. P A6WX30 Tryptophan synthase alpha chain 1.96e-07 1.59e-02 NA NA
5. P C1L0D5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.26e-06 1.30e-02 NA NA
5. P Q8Y0H8 Pyridoxine 5'-phosphate synthase 6.08e-10 1.52e-05 NA NA
5. P Q5LYI8 Tryptophan synthase alpha chain 2.14e-05 6.05e-03 NA NA
5. P Q10X41 Pyridoxine 5'-phosphate synthase 1.24e-09 4.25e-06 NA NA
5. P Q72RH2 N-(5'-phosphoribosyl)anthranilate isomerase 4.93e-09 6.04e-19 NA NA
5. P Q5E3Z6 Orotidine 5'-phosphate decarboxylase 4.44e-08 3.30e-04 NA NA
5. P Q1GHT0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1 8.34e-09 4.82e-02 NA NA
5. P B7NTQ2 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.07e-09 7.36e-08 NA NA
5. P A3PFF2 Thiazole synthase 8.08e-06 2.46e-02 NA NA
5. P Q65DK0 Thiamine-phosphate synthase 1.69e-09 8.17e-03 NA NA
5. P A5UEU6 Tryptophan synthase alpha chain 1.49e-04 1.24e-02 NA NA
5. P Q8ZEH0 Tryptophan synthase alpha chain 6.03e-05 3.64e-04 NA NA
5. P Q65L94 Thiazole synthase 1.82e-09 1.13e-02 NA NA
5. P B7JM94 Heptaprenylglyceryl phosphate synthase 6.56e-08 1.78e-02 NA NA
5. P A2BY17 3-methyl-2-oxobutanoate hydroxymethyltransferase 5.40e-06 1.32e-03 NA NA
5. P Q8AA13 Thiamine-phosphate synthase 9.51e-09 4.07e-03 NA NA
5. P Q7W049 Thiamine-phosphate synthase 2.84e-09 5.29e-03 NA NA
5. P Q38X91 3-dehydroquinate dehydratase 3.56e-05 2.95e-02 NA NA
5. P B1YAF0 Geranylgeranylglyceryl phosphate synthase 7.28e-08 9.99e-05 NA NA
5. P A8ER78 Thiazole synthase 1.00e-05 4.36e-04 NA NA
5. P Q8FB81 Thiazole synthase 5.52e-05 9.48e-03 NA NA
5. P C6E5P6 Pyridoxine 5'-phosphate synthase 7.59e-10 2.14e-08 NA NA
5. P B7KC08 N-(5'-phosphoribosyl)anthranilate isomerase 7.03e-10 1.16e-15 NA NA
5. P B5EK17 Tryptophan synthase alpha chain 5.41e-08 1.24e-02 NA NA
5. P Q81TL7 Tryptophan synthase alpha chain 1.90e-08 1.80e-05 NA NA
5. P Q2NB00 Thiamine-phosphate synthase 3.29e-06 5.13e-05 NA NA
5. P A5GU97 Pyridoxine 5'-phosphate synthase 1.13e-09 1.12e-07 NA NA
5. P B7MUC3 Orotidine 5'-phosphate decarboxylase 4.57e-08 3.38e-02 NA NA
5. P Q8EEE1 Thiazole synthase 4.05e-05 1.81e-02 NA NA
5. P Q81IG8 Thiamine-phosphate synthase 3.37e-06 2.02e-03 NA NA
5. P A7ZV66 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.07e-09 7.36e-08 NA NA
5. P Q8R9M8 N-(5'-phosphoribosyl)anthranilate isomerase 4.24e-10 1.04e-17 NA NA
5. P B7VH29 Orotidine 5'-phosphate decarboxylase 1.69e-07 1.30e-03 NA NA
5. P B3Q604 N-(5'-phosphoribosyl)anthranilate isomerase 1.44e-10 8.95e-22 NA NA
5. P Q1QVK2 Orotidine 5'-phosphate decarboxylase 1.44e-08 1.54e-03 NA NA
5. P B5R9E3 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.39e-09 2.27e-08 NA NA
5. P Q8TYA2 Tryptophan synthase alpha chain 2.54e-08 9.46e-04 NA NA
5. P A3D465 Thiazole synthase 6.37e-06 2.75e-02 NA NA
5. P C3L061 Thiamine-phosphate synthase 2.07e-09 1.15e-04 NA NA
5. P Q0AFV0 Thiamine-phosphate synthase 3.65e-09 2.56e-02 NA NA
5. P C1CT50 Tryptophan synthase alpha chain 6.62e-08 1.49e-05 NA NA
5. P Q82WI1 Tryptophan synthase alpha chain 1.05e-07 3.46e-02 NA NA
5. P B9DVU8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.68e-08 1.55e-06 NA NA
5. P A0RNS2 Pyridoxine 5'-phosphate synthase 2.21e-09 7.39e-03 NA NA
5. P Q2SCG0 Orotidine 5'-phosphate decarboxylase 3.58e-08 1.14e-02 NA NA
5. P A0AMC4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.56e-06 5.47e-03 NA NA
5. P Q62AJ6 Tryptophan synthase alpha chain 1.27e-07 1.30e-03 NA NA
5. P Q2P8Z6 Orotidine 5'-phosphate decarboxylase 5.34e-10 4.21e-03 NA NA
5. P B1VZU6 Thiazole synthase 1.77e-05 1.68e-02 NA NA
5. P Q7NPF2 Pyridoxine 5'-phosphate synthase 1.41e-09 3.95e-07 NA NA
5. P Q32AG3 Thiazole synthase 6.75e-06 9.56e-03 NA NA
5. P Q0B004 N-(5'-phosphoribosyl)anthranilate isomerase 1.60e-09 4.45e-18 NA NA
5. P C5D3D3 Tryptophan synthase alpha chain 1.60e-05 4.99e-03 NA NA
5. P A4Y6R6 Thiazole synthase 4.86e-06 8.37e-03 NA NA
5. P B9J523 Thiazole synthase 1.63e-09 4.66e-03 NA NA
5. P B8J9L8 Orotidine 5'-phosphate decarboxylase 2.22e-08 8.13e-05 NA NA
5. P Q3Z6G4 N-(5'-phosphoribosyl)anthranilate isomerase 1.38e-09 2.01e-08 NA NA
5. P Q5PD06 Orotidine 5'-phosphate decarboxylase 3.55e-08 2.21e-02 NA NA
5. P A4SF78 N-(5'-phosphoribosyl)anthranilate isomerase 2.35e-10 3.73e-18 NA NA
5. P A1KB60 Thiamine-phosphate synthase 1.13e-08 1.95e-03 NA NA
5. P Q74D58 Orotidine 5'-phosphate decarboxylase 2.66e-08 2.93e-04 NA NA
5. P B7L492 Tryptophan synthase alpha chain 3.13e-03 4.48e-04 NA NA
5. P A6UP16 N-(5'-phosphoribosyl)anthranilate isomerase 7.92e-11 1.88e-20 NA NA
5. P Q2RGI8 Thiamine-phosphate synthase 4.15e-10 4.43e-03 NA NA
5. P Q8X6Y0 Thiamine-phosphate synthase 2.62e-09 2.83e-03 NA NA
5. P Q9KCA9 Tryptophan synthase alpha chain 1.62e-05 4.17e-04 NA NA
5. P B2IKV4 N-(5'-phosphoribosyl)anthranilate isomerase 3.56e-10 2.73e-16 NA NA
5. P Q4UWD4 N-(5'-phosphoribosyl)anthranilate isomerase 1.15e-09 1.43e-16 NA NA
5. P A4VW79 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.72e-08 1.11e-05 NA NA
5. P Q10WG3 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.03e-06 9.05e-04 NA NA
5. P Q9JVE0 Tryptophan synthase alpha chain 8.19e-08 2.36e-02 NA NA
5. P D0ZLR2 2-dehydro-3-deoxy-phosphogluconate aldolase 8.95e-10 5.27e-04 NA NA
5. P Q9UZQ5 Thiamine-phosphate synthase 2.66e-10 2.02e-02 NA NA
5. P A9MHD7 Thiamine-phosphate synthase 2.10e-09 1.40e-04 NA NA
5. P P0CZ74 3-dehydroquinate dehydratase 7.85e-08 2.36e-02 NA NA
5. P Q5KY94 3-dehydroquinate dehydratase 1.12e-09 1.05e-02 NA NA
5. P B3E693 Pyridoxine 5'-phosphate synthase 1.55e-09 3.55e-04 NA NA
5. P B2FNZ5 N-(5'-phosphoribosyl)anthranilate isomerase 5.51e-10 2.51e-15 NA NA
5. P Q1CR25 Pyridoxine 5'-phosphate synthase 4.12e-09 2.48e-02 NA NA
5. P Q7MXT6 Orotidine 5'-phosphate decarboxylase 1.57e-07 8.87e-03 NA NA
5. P Q9TLW8 Tryptophan synthase alpha chain 1.53e-07 5.03e-05 NA NA
5. P Q3IQ37 N-(5'-phosphoribosyl)anthranilate isomerase 1.10e-10 2.35e-15 NA NA
5. P Q8ER36 Orotidine 5'-phosphate decarboxylase 1.32e-08 1.17e-03 NA NA
5. P Q1CN71 Thiamine-phosphate synthase 2.09e-09 1.20e-02 NA NA
5. P B7M8V6 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.48e-10 1.77e-07 NA NA
5. P Q1CZH4 N-(5'-phosphoribosyl)anthranilate isomerase 8.90e-11 6.40e-16 NA NA
5. P Q3Z131 Orotidine 5'-phosphate decarboxylase 3.66e-08 2.13e-02 NA NA
5. P Q8NXX1 3-hexulose-6-phosphate synthase 2.97e-12 7.86e-07 NA NA
5. P A6Q2C1 Orotidine 5'-phosphate decarboxylase 8.78e-08 9.48e-03 NA NA
5. P Q5HMD0 Thiamine-phosphate synthase 2.10e-05 1.39e-05 NA NA
5. P C4ZTX6 Orotidine 5'-phosphate decarboxylase 5.62e-08 2.25e-02 NA NA
5. P B4TGJ6 3-dehydroquinate dehydratase 4.84e-09 1.81e-03 NA NA
5. P A1RUV7 Triosephosphate isomerase 6.17e-09 5.96e-05 NA NA
5. P A0QQK7 Thiamine-phosphate synthase 1.09e-08 1.59e-05 NA NA
5. P C5A786 3-dehydroquinate dehydratase 8.98e-07 8.74e-04 NA NA
5. P Q2NHA5 Orotidine 5'-phosphate decarboxylase 3.90e-09 8.06e-05 NA NA
5. P A4G4G3 Tryptophan synthase alpha chain 1.20e-07 1.19e-03 NA NA
5. P A5V9W7 Tryptophan synthase alpha chain 4.36e-08 6.08e-05 NA NA
5. P Q9UXX2 Triosephosphate isomerase 1.43e-08 1.30e-06 NA NA
5. P Q2LQ82 Orotidine 5'-phosphate decarboxylase 2.69e-08 6.70e-04 NA NA
5. P B6JKW5 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.04e-05 3.63e-02 NA NA
5. P B9MN52 Thiamine-phosphate synthase 7.71e-10 2.36e-04 NA NA
5. P A5FJJ1 Thiamine-phosphate synthase 8.51e-09 5.78e-06 NA NA
5. P B1ZT49 Tryptophan synthase alpha chain 2.89e-08 1.22e-05 NA NA
5. P Q4L7X3 Thiamine-phosphate synthase 2.96e-05 4.88e-06 NA NA
5. P B7MVG9 3-dehydroquinate dehydratase 3.83e-09 2.60e-02 NA NA
5. P C6C1D3 N-(5'-phosphoribosyl)anthranilate isomerase 4.78e-09 3.58e-17 NA NA
5. P Q9ZJV0 Tryptophan synthase alpha chain 3.77e-05 1.12e-04 NA NA
5. P Q03NS1 Thiamine-phosphate synthase 1.00e-07 4.98e-06 NA NA
5. P Q6M1A9 Geranylgeranylglyceryl phosphate synthase 2.86e-07 2.01e-02 NA NA
5. P O26652 Geranylgeranylglyceryl phosphate synthase 3.87e-08 1.63e-02 NA NA
5. P A8FMU3 Pyridoxine 5'-phosphate synthase 1.19e-08 2.21e-04 NA NA
5. P C1CG41 Tryptophan synthase alpha chain 6.63e-08 1.65e-05 NA NA
5. P A6LU95 N-(5'-phosphoribosyl)anthranilate isomerase 1.70e-09 3.55e-06 NA NA
5. P B2HZE8 Orotidine 5'-phosphate decarboxylase 2.31e-08 1.15e-03 NA NA
5. P Q66AK5 Tryptophan synthase alpha chain 5.75e-05 2.90e-04 NA NA
5. P Q319F9 Orotidine 5'-phosphate decarboxylase 1.33e-08 1.41e-02 NA NA
5. P Q8XKQ8 Thiamine-phosphate synthase 1.41e-04 4.84e-05 NA NA
5. P Q8ZTX5 Geranylgeranylglyceryl phosphate synthase 7.91e-08 1.22e-03 NA NA
5. P Q2W020 N-(5'-phosphoribosyl)anthranilate isomerase 1.01e-09 1.19e-21 NA NA
5. P Q0TA75 Thiazole synthase 1.63e-04 7.15e-03 NA NA
5. P Q74AH7 N-(5'-phosphoribosyl)anthranilate isomerase 2.05e-09 1.68e-18 NA NA
5. P A6U3H7 Thiamine-phosphate synthase 3.23e-08 6.66e-07 NA NA
5. P Q5HPG9 Tryptophan synthase alpha chain 3.97e-08 7.91e-05 NA NA
5. P C1L005 3-dehydroquinate dehydratase 5.19e-09 1.59e-02 NA NA
5. P B3ED41 Thiamine-phosphate synthase 2.79e-10 5.29e-03 NA NA
5. P Q6GEY4 Thiamine-phosphate synthase 7.23e-08 1.26e-06 NA NA
5. P Q03CB2 Thiamine-phosphate synthase 1.08e-09 6.31e-03 NA NA
5. P B3E754 N-(5'-phosphoribosyl)anthranilate isomerase 3.23e-10 2.07e-18 NA NA
5. P A9BBV1 Orotidine 5'-phosphate decarboxylase 1.16e-08 1.66e-03 NA NA
5. P A8G084 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.43e-08 4.32e-02 NA NA
5. P P17218 N-(5'-phosphoribosyl)anthranilate isomerase 9.22e-10 3.41e-14 NA NA
5. P A8Z245 Tryptophan synthase alpha chain 2.90e-08 5.40e-06 NA NA
5. P B6JCP3 Tryptophan synthase alpha chain 1.78e-07 1.07e-02 NA NA
5. P C0ZCE4 N-(5'-phosphoribosyl)anthranilate isomerase 2.00e-11 3.93e-16 NA NA
5. P B1IT10 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.00e-09 7.36e-08 NA NA
5. P Q4JCD8 Triosephosphate isomerase 1.64e-08 4.21e-04 NA NA
5. P Q931N1 Heptaprenylglyceryl phosphate synthase 2.44e-08 3.51e-05 NA NA
5. P Q9KF39 Heptaprenylglyceryl phosphate synthase 1.28e-07 6.25e-05 NA NA
5. P Q7N485 Tryptophan synthase alpha chain 2.07e-03 2.25e-04 NA NA
5. P Q44843 Orotidine 5'-phosphate decarboxylase (Fragment) 3.73e-09 8.59e-04 NA NA
5. P B5Z8S2 Tryptophan synthase alpha chain 2.63e-05 1.47e-04 NA NA
5. P Q931E6 3-methyl-2-oxobutanoate hydroxymethyltransferase 8.68e-06 2.36e-03 NA NA
5. P B8EA59 Thiazole synthase 6.85e-06 1.94e-02 NA NA
5. P B7UPE5 Thiazole synthase 5.23e-05 4.58e-03 NA NA
5. P Q3JQ80 Pyridoxine 5'-phosphate synthase 4.92e-10 5.91e-04 NA NA
5. P B7N2J2 Thiazole synthase 1.65e-04 7.15e-03 NA NA
5. P B7M0T5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.91e-06 1.69e-04 NA NA
5. P Q04XX5 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.75e-06 2.21e-02 NA NA
5. P B7JBM8 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.77e-06 9.32e-03 NA NA
5. P Q8PRX4 N-(5'-phosphoribosyl)anthranilate isomerase 2 1.25e-11 7.58e-15 NA NA
5. P Q59654 Orotidine 5'-phosphate decarboxylase 4.19e-08 3.62e-03 NA NA
5. P Q03HR3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.86e-08 2.11e-04 NA NA
5. P Q1JIP7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.14e-08 3.21e-06 NA NA
5. P A7X435 Heptaprenylglyceryl phosphate synthase 2.49e-08 3.51e-05 NA NA
5. P Q6HLU3 Tryptophan synthase alpha chain 1.74e-08 3.25e-05 NA NA
5. P Q7NTL2 Orotidine 5'-phosphate decarboxylase 1.24e-08 7.58e-03 NA NA
5. P Q1GK79 N-(5'-phosphoribosyl)anthranilate isomerase 5.54e-10 8.45e-18 NA NA
5. P Q5JHL2 Uncharacterized protein TK2179 7.85e-12 7.69e-05 NA NA
5. P Q81HQ5 Thiazole synthase 4.50e-09 2.70e-02 NA NA
5. P B1LAU5 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.72e-06 3.81e-02 NA NA
5. P Q5LND3 Orotidine 5'-phosphate decarboxylase 6.22e-09 1.95e-03 NA NA
5. P Q3V7P0 Pyridoxine 5'-phosphate synthase 2.29e-10 1.40e-09 NA NA
5. P Q3B5P7 Pyridoxine 5'-phosphate synthase 1.93e-09 2.46e-07 NA NA
5. P B7H7H5 Thiamine-phosphate synthase 3.31e-06 1.84e-03 NA NA
5. P Q4QKF6 Tryptophan synthase alpha chain 1.50e-04 2.46e-03 NA NA
5. P B7IM77 Tryptophan synthase alpha chain 1.92e-08 6.37e-05 NA NA
5. P A3N350 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.10e-06 5.47e-03 NA NA
5. P A3MUU3 Geranylgeranylglyceryl phosphate synthase 3.09e-08 1.79e-03 NA NA
5. P Q5F9X5 N-(5'-phosphoribosyl)anthranilate isomerase 1.95e-09 1.12e-14 NA NA
5. P B5QYE8 Thiamine-phosphate synthase 1.81e-09 1.91e-02 NA NA
5. P Q5LBZ2 Tryptophan synthase alpha chain 8.55e-08 7.09e-03 NA NA
5. P Q7VWW0 Pyridoxine 5'-phosphate synthase 3.71e-10 3.62e-06 NA NA
5. P A0JYP1 Thiamine-phosphate synthase 3.61e-08 3.81e-04 NA NA
5. P Q8YNQ6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.89e-09 3.30e-02 NA NA
5. P P20167 N-(5'-phosphoribosyl)anthranilate isomerase 8.53e-13 5.34e-16 NA NA
5. P P65657 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.49e-08 1.54e-03 NA NA
5. P A3CTK2 Geranylgeranylglyceryl phosphate synthase 4.03e-08 3.33e-04 NA NA
5. P A6QID4 Heptaprenylglyceryl phosphate synthase 4.18e-08 7.62e-05 NA NA
5. P A4SEP8 Thiamine-phosphate synthase 3.55e-10 2.13e-02 NA NA
5. P B8G5G4 Tryptophan synthase alpha chain 1.71e-07 1.52e-03 NA NA
5. P Q9KCB1 N-(5'-phosphoribosyl)anthranilate isomerase 4.16e-11 1.69e-16 NA NA
5. P B9JZC0 Orotidine 5'-phosphate decarboxylase 2.10e-09 5.90e-03 NA NA
5. P A9AAU4 N-(5'-phosphoribosyl)anthranilate isomerase 6.56e-11 2.15e-19 NA NA
5. P Q3J8N5 Orotidine 5'-phosphate decarboxylase 2.00e-08 1.66e-03 NA NA
5. P Q2KY06 Orotidine 5'-phosphate decarboxylase 3.80e-07 9.02e-03 NA NA
5. P B5XL15 Orotidine 5'-phosphate decarboxylase 2.40e-08 1.05e-02 NA NA
5. P Q49UF2 Thiazole synthase 1.27e-06 2.95e-03 NA NA
5. P A4WAY2 Orotidine 5'-phosphate decarboxylase 1.39e-07 3.10e-03 NA NA
5. P A9M072 Thiazole synthase 1.36e-05 5.96e-05 NA NA
5. P Q4A094 Putative N-acetylmannosamine-6-phosphate 2-epimerase 7.88e-08 2.04e-03 NA NA
5. P Q92NT6 Pyridoxine 5'-phosphate synthase 2.27e-08 1.94e-06 NA NA
5. P Q1RC84 Orotidine 5'-phosphate decarboxylase 5.65e-08 3.27e-02 NA NA
5. P C4ZTV3 Tryptophan synthase alpha chain 5.16e-07 3.74e-03 NA NA
5. P A0LXW0 Pyridoxine 5'-phosphate synthase 3.75e-09 1.54e-08 NA NA
5. P Q0K8N6 Pyridoxine 5'-phosphate synthase 3.35e-10 4.07e-03 NA NA
5. P Q66FP6 Thiamine-phosphate synthase 1.12e-09 8.17e-03 NA NA
5. P Q500R5 Tryptophan synthase alpha chain 1.59e-07 3.46e-02 NA NA
5. P Q6GJZ8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.51e-08 4.32e-05 NA NA
5. P B0U1D6 Orotidine 5'-phosphate decarboxylase 1.26e-09 2.17e-03 NA NA
5. P B7N473 Tryptophan synthase alpha chain 4.15e-03 2.13e-03 NA NA
5. P C3P0L4 Thiazole synthase 4.06e-09 6.15e-03 NA NA
5. P Q9I5G5 Pyridoxine 5'-phosphate synthase 2.47e-10 1.25e-07 NA NA
5. P B2URE7 Pyridoxine 5'-phosphate synthase 6.93e-10 7.70e-07 NA NA
5. P A5VT61 Tryptophan synthase alpha chain 3.72e-07 1.25e-02 NA NA
5. P Q59649 N-(5'-phosphoribosyl)anthranilate isomerase 8.29e-10 4.50e-20 NA NA
5. P Q3YUF2 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.04e-09 7.36e-08 NA NA
5. P C1KVS6 N-(5'-phosphoribosyl)anthranilate isomerase 8.56e-09 1.08e-14 NA NA
5. P Q73BQ6 Tryptophan synthase alpha chain 1.73e-08 1.37e-05 NA NA
5. P Q9V1H8 3-dehydroquinate dehydratase 6.21e-07 4.89e-05 NA NA
5. P Q1JDM7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.25e-08 1.10e-06 NA NA
5. P Q2IYP6 Thiazole synthase 2.57e-05 2.13e-03 NA NA
5. P Q6NKI6 Thiazole synthase 2.49e-04 3.85e-04 NA NA
5. P Q8ESU5 Tryptophan synthase alpha chain 1.63e-07 4.90e-04 NA NA
5. P A8FMD4 Thiamine-phosphate synthase 2.63e-09 2.09e-03 NA NA
5. P Q15X88 2-dehydro-3-deoxy-phosphogluconate aldolase 1.38e-08 8.51e-03 NA NA
5. P B7J9K4 Pyridoxine 5'-phosphate synthase 3.58e-10 2.37e-06 NA NA
5. P A6VWY4 N-(5'-phosphoribosyl)anthranilate isomerase 5.98e-10 4.39e-12 NA NA
5. P B7VGU8 Tryptophan synthase alpha chain 4.75e-05 2.64e-03 NA NA
5. P B5ZAF6 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.32e-05 2.32e-02 NA NA
5. P P0DC81 Orotidine 5'-phosphate decarboxylase 2.84e-08 1.06e-02 NA NA
5. P A5D4K4 Thiamine-phosphate synthase 4.62e-10 8.18e-06 NA NA
5. P A6TGQ0 Thiamine-phosphate synthase 2.43e-09 4.95e-04 NA NA
5. P Q39SQ9 N-(5'-phosphoribosyl)anthranilate isomerase 3.96e-09 2.42e-19 NA NA
5. P Q6NDN7 N-(5'-phosphoribosyl)anthranilate isomerase 1.42e-10 1.65e-21 NA NA
5. P A9VFL4 Thiazole synthase 1.19e-06 1.72e-02 NA NA
5. P A0AJ79 Tryptophan synthase alpha chain 5.49e-08 6.18e-04 NA NA
5. P B7NGD0 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.02e-09 2.44e-07 NA NA
5. P Q9ZM56 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.17e-05 2.23e-02 NA NA
5. P B5E7M4 N-(5'-phosphoribosyl)anthranilate isomerase 8.05e-10 9.19e-17 NA NA
5. P Q31ZV3 Tryptophan synthase alpha chain 4.85e-07 8.30e-03 NA NA
5. P Q3ATB8 Pyridoxine 5'-phosphate synthase 1.28e-09 3.02e-08 NA NA
5. P Q7WF72 Thiamine-phosphate synthase 4.80e-09 2.92e-03 NA NA
5. P B0R338 3-dehydroquinate dehydratase 5.21e-04 1.75e-02 NA NA
5. P A1TW93 Orotidine 5'-phosphate decarboxylase 2.24e-07 6.63e-03 NA NA
5. P Q2W010 Tryptophan synthase alpha chain 4.21e-08 6.43e-05 NA NA
5. P Q2RNS7 Orotidine 5'-phosphate decarboxylase 4.06e-08 3.50e-03 NA NA
5. P Q3SPS2 Thiazole synthase 7.92e-06 3.54e-02 NA NA
5. P A2RKU2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.08e-06 7.76e-05 NA NA
5. P Q2FFI9 Heptaprenylglyceryl phosphate synthase 4.00e-08 1.09e-04 NA NA
5. P B7HDF2 Thiazole synthase 1.15e-06 3.05e-02 NA NA
5. P B0BBV9 N-(5'-phosphoribosyl)anthranilate isomerase 2.79e-08 4.98e-15 NA NA
5. P Q97EF4 N-(5'-phosphoribosyl)anthranilate isomerase 2.22e-10 3.79e-15 NA NA
5. P Q136W2 Pyridoxine 5'-phosphate synthase 5.77e-10 1.50e-04 NA NA
5. P B5EHA6 Pyridoxine 5'-phosphate synthase 5.97e-10 3.71e-08 NA NA
5. P O26232 Orotidine 5'-phosphate decarboxylase 1.71e-09 7.72e-04 NA NA
5. P B7LS20 Tryptophan synthase alpha chain 4.11e-03 6.20e-03 NA NA
5. P A5E8J8 Orotidine 5'-phosphate decarboxylase 5.31e-09 6.35e-04 NA NA
5. P Q7WKG8 N-(5'-phosphoribosyl)anthranilate isomerase 1.17e-10 4.27e-16 NA NA
5. P Q48L25 N-(5'-phosphoribosyl)anthranilate isomerase 5.77e-10 2.18e-19 NA NA
5. P A7MQQ2 Thiazole synthase 6.50e-05 3.27e-03 NA NA
5. P A0QHG8 Tryptophan synthase alpha chain 4.22e-08 4.32e-03 NA NA
5. P P52997 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.28e-06 1.56e-03 NA NA
5. P B0SUK3 Thiamine-phosphate synthase 1.26e-09 3.71e-05 NA NA
5. P Q6B8L2 Tryptophan synthase alpha chain 7.87e-08 2.11e-05 NA NA
5. P Q8DNM7 N-(5'-phosphoribosyl)anthranilate isomerase 9.78e-10 2.22e-15 NA NA
5. P Q7W3U2 Thiamine-phosphate synthase 2.96e-06 5.29e-03 NA NA
5. P Q254T1 Tryptophan synthase alpha chain 5.71e-05 4.99e-03 NA NA
5. P B4TJK9 Tryptophan synthase alpha chain 5.14e-07 5.71e-04 NA NA
5. P Q11KK8 N-(5'-phosphoribosyl)anthranilate isomerase 3.96e-10 1.18e-15 NA NA
5. P Q3V7M2 Pyridoxine 5'-phosphate synthase 5.30e-10 8.51e-04 NA NA
5. P A4IJY4 Heptaprenylglyceryl phosphate synthase 4.90e-08 1.68e-04 NA NA
5. P Q043A6 Orotidine 5'-phosphate decarboxylase 3.82e-08 3.38e-03 NA NA
5. P A4G2V0 Orotidine 5'-phosphate decarboxylase 2.50e-07 1.74e-02 NA NA
5. P Q98CN6 Tryptophan synthase alpha chain 1.59e-07 8.17e-03 NA NA
5. P Q01NI7 N-(5'-phosphoribosyl)anthranilate isomerase 2.63e-08 2.58e-18 NA NA
5. P B1KV12 Thiamine-phosphate synthase 2.24e-09 4.53e-05 NA NA
5. P A2SHS3 Tryptophan synthase alpha chain 8.04e-08 1.36e-02 NA NA
5. P Q9L6B4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.05e-06 4.00e-03 NA NA
5. P Q5FNS8 Orotidine 5'-phosphate decarboxylase 1.57e-08 5.33e-03 NA NA
5. P B4U701 3-dehydroquinate dehydratase 6.50e-05 9.63e-04 NA NA
5. P A7Z615 Tryptophan synthase alpha chain 3.27e-05 4.94e-05 NA NA
5. P Q99SY1 Heptaprenylglyceryl phosphate synthase 2.28e-08 2.32e-05 NA NA
5. P Q0VPJ0 Tryptophan synthase alpha chain 6.22e-08 5.38e-03 NA NA
5. P A5FZ94 N-(5'-phosphoribosyl)anthranilate isomerase 1.07e-08 1.77e-13 NA NA
5. P Q9PN59 Pyridoxine 5'-phosphate synthase 5.92e-09 2.20e-03 NA NA
5. P Q3B533 N-(5'-phosphoribosyl)anthranilate isomerase 8.05e-11 3.39e-13 NA NA
5. P Q2N9N2 N-(5'-phosphoribosyl)anthranilate isomerase 3.93e-10 9.06e-16 NA NA
5. P B0BYP7 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.73e-06 6.74e-03 NA NA
5. P Q7VGA8 Tryptophan synthase alpha chain 2.25e-05 7.05e-06 NA NA
5. P C3LAV9 N-(5'-phosphoribosyl)anthranilate isomerase 2.67e-09 2.58e-14 NA NA
5. P B2USM4 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.35e-05 4.93e-02 NA NA
5. P B0U6K5 N-(5'-phosphoribosyl)anthranilate isomerase 1.23e-09 2.42e-19 NA NA
5. P C4ZYF5 3-dehydroquinate dehydratase 3.98e-09 1.65e-02 NA NA
5. P B2V790 Orotidine 5'-phosphate decarboxylase 4.11e-09 1.03e-03 NA NA
5. P A6GWR9 Thiamine-phosphate synthase 5.50e-08 2.04e-04 NA NA
5. P B2GBV5 Thiamine-phosphate synthase 1.01e-08 4.06e-04 NA NA
5. P A4SKT0 Tryptophan synthase alpha chain 2.66e-07 3.15e-02 NA NA
5. P Q7N4C1 Orotidine 5'-phosphate decarboxylase 1.87e-08 9.02e-03 NA NA
5. P Q5L912 Pyridoxine 5'-phosphate synthase 3.89e-09 6.58e-06 NA NA
5. P B8ZKM6 3-dehydroquinate dehydratase 1.97e-05 4.51e-03 NA NA
5. P Q0TA72 Thiamine-phosphate synthase 1.77e-09 2.62e-03 NA NA
5. P Q2YXZ6 Tryptophan synthase alpha chain 3.32e-08 8.10e-06 NA NA
5. P O68906 Tryptophan synthase alpha chain 5.85e-08 3.30e-02 NA NA
5. P Q3JCB9 N-(5'-phosphoribosyl)anthranilate isomerase 7.85e-10 7.45e-14 NA NA
5. P A7FI34 Tryptophan synthase alpha chain 5.96e-05 2.90e-04 NA NA
5. P A8AXM8 Orotidine 5'-phosphate decarboxylase 4.45e-08 1.89e-03 NA NA
5. P B3QFS7 Thiazole synthase 7.09e-06 8.65e-03 NA NA
5. P B2TWI0 Thiamine-phosphate synthase 3.72e-09 2.48e-03 NA NA
5. P Q83RM1 Orotidine 5'-phosphate decarboxylase 4.70e-08 3.15e-02 NA NA
5. P P58639 Orotidine 5'-phosphate decarboxylase 6.90e-09 9.63e-03 NA NA
5. P B5ES07 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.81e-06 9.32e-03 NA NA
5. P C6BV77 Pyridoxine 5'-phosphate synthase 8.16e-10 1.57e-04 NA NA
5. P A7IA09 Thiamine-phosphate synthase 1.41e-09 4.47e-03 NA NA
5. P B8J160 Tryptophan synthase alpha chain 2.09e-03 2.36e-02 NA NA
5. P C3LAV7 Tryptophan synthase alpha chain 2.40e-08 1.80e-05 NA NA
5. P Q4L680 Tryptophan synthase alpha chain 3.06e-08 1.35e-05 NA NA
5. P B4S3G9 Pyridoxine 5'-phosphate synthase 1.37e-09 1.11e-05 NA NA
5. P A9MPY6 Tryptophan synthase alpha chain 3.92e-07 1.02e-03 NA NA
5. P A7ZUK5 Thiazole synthase 5.73e-05 7.64e-03 NA NA
5. P P31204 Tryptophan synthase alpha chain 1.61e-06 1.59e-02 NA NA
5. P Q9RQ33 Tryptophan synthase alpha chain 4.63e-03 2.40e-04 NA NA
5. P Q6F9Z3 Orotidine 5'-phosphate decarboxylase 2.18e-08 1.34e-03 NA NA
5. P Q7V6Q5 Pyridoxine 5'-phosphate synthase 7.14e-10 8.10e-06 NA NA
5. P C5CQB2 Orotidine 5'-phosphate decarboxylase 1.96e-07 2.13e-02 NA NA
5. P B0KJV8 Thiamine-phosphate synthase 5.56e-06 9.19e-05 NA NA
5. P Q3A6R4 Orotidine 5'-phosphate decarboxylase 1.33e-08 7.65e-04 NA NA
5. P B2U984 Pyridoxine 5'-phosphate synthase 5.06e-10 3.59e-03 NA NA
5. P P43812 Orotidine 5'-phosphate decarboxylase 6.97e-08 4.29e-03 NA NA
5. P P58263 Thiazole synthase 5.35e-05 4.95e-03 NA NA
5. P B0R642 Orotidine 5'-phosphate decarboxylase 1.85e-07 1.50e-02 NA NA
5. P A6Q3Y6 Pyridoxine 5'-phosphate synthase 6.07e-10 1.14e-03 NA NA
5. P Q7N869 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.75e-08 4.67e-02 NA NA
5. P B7VBQ7 N-(5'-phosphoribosyl)anthranilate isomerase 8.05e-10 1.49e-19 NA NA
5. P Q07UH0 Tryptophan synthase alpha chain 1.50e-07 1.42e-02 NA NA
5. P Q9ZBL5 Thiamine-phosphate synthase 1.71e-08 1.69e-04 NA NA
5. P Q8ZAQ1 Thiamine-phosphate synthase 1.26e-09 1.20e-02 NA NA
5. P Q3YYV2 Pyridoxine 5'-phosphate synthase 1.69e-10 7.97e-11 NA NA
5. P B0TDZ7 Orotidine 5'-phosphate decarboxylase 7.51e-09 2.68e-03 NA NA
5. P Q3V7G1 Pyridoxine 5'-phosphate synthase 2.93e-10 1.92e-06 NA NA
5. P Q31JD2 Thiazole synthase 1.24e-05 3.81e-02 NA NA
5. P B9M5M0 N-(5'-phosphoribosyl)anthranilate isomerase 9.28e-10 1.66e-20 NA NA
5. P P42389 Tryptophan synthase alpha chain 4.48e-05 4.07e-03 NA NA
5. P O74110 Orotidine 5'-phosphate decarboxylase 2.07e-10 2.02e-04 NA NA
5. P Q3JCY8 Pyridoxine 5'-phosphate synthase 1.98e-10 1.29e-06 NA NA
5. P A1ANJ2 N-(5'-phosphoribosyl)anthranilate isomerase 8.93e-10 4.78e-18 NA NA
5. P Q2LUE0 Tryptophan synthase alpha chain 2.44e-08 7.00e-04 NA NA
5. P Q9ABW5 Orotidine 5'-phosphate decarboxylase 2.43e-08 1.71e-02 NA NA
5. P A2S138 Tryptophan synthase alpha chain 1.15e-07 1.30e-03 NA NA
5. P Q7UM39 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.71e-06 1.96e-02 NA NA
5. P P12289 N-(5'-phosphoribosyl)anthranilate isomerase 7.02e-10 4.83e-19 NA NA
5. P B3QPB1 Tryptophan synthase alpha chain 2.08e-05 3.94e-03 NA NA
5. P O74067 Triosephosphate isomerase 5.76e-08 1.06e-06 NA NA
5. P Q6DAM4 Thiazole synthase 5.54e-05 1.09e-02 NA NA
5. P Q12X87 Orotidine 5'-phosphate decarboxylase 1.54e-09 3.84e-08 NA NA
5. P Q83PB9 Thiamine-phosphate synthase 2.51e-09 2.48e-03 NA NA
5. P B1YJ15 Heptaprenylglyceryl phosphate synthase 6.06e-08 4.29e-03 NA NA
5. P B3W783 Thiamine-phosphate synthase 8.67e-10 2.98e-04 NA NA
5. P Q5V3P6 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.91e-06 4.93e-02 NA NA
5. P Q21CB8 N-(5'-phosphoribosyl)anthranilate isomerase 1.44e-10 2.27e-16 NA NA
5. P Q9CMM1 Orotidine 5'-phosphate decarboxylase 5.80e-08 9.90e-05 NA NA
5. P O34790 Heptaprenylglyceryl phosphate synthase 3.53e-08 2.49e-04 NA NA
5. P B2SEK8 Tryptophan synthase alpha chain 2.26e-07 4.71e-02 NA NA
5. P P57854 Tryptophan synthase alpha chain 1.62e-04 6.64e-04 NA NA
5. P Q9RML6 Pyridoxine 5'-phosphate synthase 4.14e-10 2.44e-06 NA NA
5. P Q8YI24 Pyridoxine 5'-phosphate synthase 1.99e-08 1.88e-06 NA NA
5. P B7V9E0 Thiamine-phosphate synthase 4.28e-06 1.41e-06 NA NA
5. P Q6D5T3 Orotidine 5'-phosphate decarboxylase 3.12e-08 9.09e-03 NA NA
5. P Q126M0 Tryptophan synthase alpha chain 2.50e-07 1.28e-02 NA NA
5. P B2U6Z0 N-(5'-phosphoribosyl)anthranilate isomerase 4.13e-10 2.37e-11 NA NA
5. P Q328K1 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.80e-10 1.53e-07 NA NA
5. P B0SBH6 Pyridoxine 5'-phosphate synthase 3.63e-06 7.70e-07 NA NA
5. P A4QH48 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.79e-08 8.37e-03 NA NA
5. P B7KSK7 Tryptophan synthase alpha chain 1.20e-07 2.06e-02 NA NA
5. P Q21IS8 Orotidine 5'-phosphate decarboxylase 1.05e-08 4.32e-04 NA NA
5. P A5CVK4 Tryptophan synthase alpha chain 9.83e-08 4.56e-02 NA NA
5. P Q1CJ29 Tryptophan synthase alpha chain 5.81e-05 3.64e-04 NA NA
5. P Q3ALB9 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.39e-06 1.53e-03 NA NA
5. P A3CV22 Triosephosphate isomerase 8.95e-08 3.02e-02 NA NA
5. P Q0BP46 Tryptophan synthase alpha chain 2.07e-07 4.93e-02 NA NA
5. P B3PFN8 N-(5'-phosphoribosyl)anthranilate isomerase 5.82e-10 2.99e-19 NA NA
5. P A5EPQ3 Thiazole synthase 8.27e-06 5.16e-03 NA NA
5. P Q8NVH5 Thiamine-phosphate synthase 3.37e-08 1.01e-06 NA NA
5. P P19867 Tryptophan synthase alpha chain 7.74e-08 4.39e-02 NA NA
5. P B5YFH2 Orotidine 5'-phosphate decarboxylase 1.36e-08 6.80e-03 NA NA
5. P B9MDL9 Tryptophan synthase alpha chain 1.67e-07 1.74e-03 NA NA
5. P Q9CFW9 Orotidine 5'-phosphate decarboxylase 1.61e-07 9.71e-03 NA NA
5. P A9A8T4 Geranylgeranylglyceryl phosphate synthase 2.49e-07 2.95e-02 NA NA
5. P Q8THB0 Triosephosphate isomerase 1.30e-07 4.77e-04 NA NA
5. P A9N0K2 Thiazole synthase 4.52e-05 1.11e-02 NA NA
5. P Q9PHB0 Orotidine 5'-phosphate decarboxylase 1.03e-09 6.41e-03 NA NA
5. P B7MLV7 Orotidine 5'-phosphate decarboxylase 5.68e-08 3.27e-02 NA NA
5. P Q5P083 Pyridoxine 5'-phosphate synthase 2.09e-10 1.75e-07 NA NA
5. P Q92RN8 Probable 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 5.40e-09 4.44e-07 NA NA
5. P P0A795 Pyridoxine 5'-phosphate synthase 2.32e-10 9.78e-11 NA NA
5. P C1CQX8 3-dehydroquinate dehydratase 2.07e-05 2.57e-03 NA NA
5. P B9E0D7 3-dehydroquinate dehydratase 4.06e-09 2.20e-03 NA NA
5. P Q2FJU6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.09e-08 4.32e-05 NA NA
5. P Q8D8J6 Orotidine 5'-phosphate decarboxylase 1.65e-07 1.10e-04 NA NA
5. P Q1QA56 Orotidine 5'-phosphate decarboxylase 1.38e-07 4.47e-03 NA NA
5. P Q3IY00 Orotidine 5'-phosphate decarboxylase 3.17e-08 1.01e-03 NA NA
5. P Q1ICS3 N-(5'-phosphoribosyl)anthranilate isomerase 7.26e-10 6.69e-20 NA NA
5. P A6U1J5 Tryptophan synthase alpha chain 2.39e-08 4.29e-06 NA NA
5. P A7ZZM0 Orotidine 5'-phosphate decarboxylase 3.84e-08 2.13e-02 NA NA
5. P Q2YWF9 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.27e-06 1.44e-03 NA NA
5. P Q92SN8 Orotidine 5'-phosphate decarboxylase 2.35e-09 5.38e-03 NA NA
5. P Q6G827 Heptaprenylglyceryl phosphate synthase 3.98e-08 7.62e-05 NA NA
5. P A0QQL0 Thiazole synthase 6.80e-05 3.30e-02 NA NA
5. P Q65M66 3-dehydroquinate dehydratase 1.44e-09 1.15e-02 NA NA
5. P P0A955 KHG/KDPG aldolase 8.23e-09 4.15e-02 NA NA
5. P A1VF83 Orotidine 5'-phosphate decarboxylase 1.11e-08 4.95e-03 NA NA
5. P A8FAP9 Heptaprenylglyceryl phosphate synthase 1.66e-08 3.14e-06 NA NA
5. P P39364 Putative sgc region protein SgcQ 1.79e-11 3.22e-05 NA NA
5. P A7ZL78 Tryptophan synthase alpha chain 4.04e-03 9.30e-04 NA NA
5. P B8HPH2 Tryptophan synthase alpha chain 7.85e-08 1.57e-03 NA NA
5. P B7IY02 Thiazole synthase 4.27e-09 3.05e-02 NA NA
5. P Q98CN8 N-(5'-phosphoribosyl)anthranilate isomerase 2.85e-10 3.51e-16 NA NA
5. P Q98DD5 Orotidine 5'-phosphate decarboxylase 7.01e-09 1.50e-02 NA NA
5. P P58638 Orotidine 5'-phosphate decarboxylase 2.89e-09 1.30e-03 NA NA
5. P Q7A774 3-hexulose-6-phosphate synthase 2.98e-12 2.22e-07 NA NA
5. P P65519 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.26e-08 2.58e-04 NA NA
5. P Q5HTM5 Pyridoxine 5'-phosphate synthase 1.24e-08 1.77e-03 NA NA
5. P Q2SU89 Thiazole synthase 8.85e-05 1.96e-04 NA NA
5. P A1U0X4 N-(5'-phosphoribosyl)anthranilate isomerase 5.00e-10 2.75e-20 NA NA
5. P B8FJ89 Pyridoxine 5'-phosphate synthase 4.71e-10 5.53e-05 NA NA
5. P Q47EF4 Pyridoxine 5'-phosphate synthase 2.50e-10 1.85e-07 NA NA
5. P P59441 Putative N-acetylmannosamine-6-phosphate 2-epimerase 7.99e-08 5.97e-04 NA NA
5. P P59457 Tryptophan synthase alpha chain 2.77e-07 8.94e-06 NA NA
5. P B5Y6I1 Thiamine-phosphate synthase 7.94e-09 2.71e-03 NA NA
5. P Q9RGS5 Thiamine-phosphate synthase 2.12e-08 2.21e-05 NA NA
5. P B7V800 Orotidine 5'-phosphate decarboxylase 4.10e-08 3.62e-03 NA NA
5. P A9N159 3-dehydroquinate dehydratase 4.20e-09 1.81e-03 NA NA
5. P B7MT10 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.60e-10 1.77e-07 NA NA
5. P Q92EW5 Thiamine-phosphate synthase 2.17e-08 2.33e-04 NA NA
5. P Q97RS5 Thiamine-phosphate synthase 1 2.75e-08 2.19e-05 NA NA
5. P Q48EV6 Pyridoxine 5'-phosphate synthase 2.65e-10 2.15e-03 NA NA
5. P C1KW59 Heptaprenylglyceryl phosphate synthase 5.12e-08 1.54e-07 NA NA
5. P Q7TV48 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.80e-06 3.13e-03 NA NA
5. P Q02PS6 N-(5'-phosphoribosyl)anthranilate isomerase 8.62e-10 6.29e-20 NA NA
5. P Q5FJB3 Orotidine 5'-phosphate decarboxylase 4.44e-08 6.91e-03 NA NA
5. P Q8D2J1 Orotidine 5'-phosphate decarboxylase 1.38e-08 5.03e-03 NA NA
5. P Q2KE83 N-(5'-phosphoribosyl)anthranilate isomerase 7.05e-10 6.50e-18 NA NA
5. P Q3SH83 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.53e-08 4.21e-03 NA NA
5. P A6TVU7 Thiazole synthase 7.84e-10 8.03e-03 NA NA
5. P Q2GJT4 Pyridoxine 5'-phosphate synthase 2.27e-09 2.25e-05 NA NA
5. P Q87VY6 Thiamine-phosphate synthase 8.02e-06 1.74e-02 NA NA
5. P B2U0H4 Orotidine 5'-phosphate decarboxylase 5.21e-08 9.25e-03 NA NA
5. P B3EK52 Thiazole synthase 5.26e-06 4.04e-03 NA NA
5. P A4WKQ6 N-(5'-phosphoribosyl)anthranilate isomerase 5.34e-10 5.67e-17 NA NA
5. P Q6AF66 Tryptophan synthase alpha chain 7.00e-08 2.98e-04 NA NA
5. P B1IEG6 Thiamine-phosphate synthase 2.39e-09 6.25e-05 NA NA
5. P Q0I131 Thiamine-phosphate synthase 1.13e-04 4.04e-05 NA NA
5. P Q2KXM4 Pyridoxine 5'-phosphate synthase 2.26e-10 6.13e-07 NA NA
5. P P50857 N-(5'-phosphoribosyl)anthranilate isomerase 2.80e-09 2.85e-16 NA NA
5. P A7WXZ6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.18e-08 2.88e-04 NA NA
5. P Q9JWI4 Thiazole synthase 1.02e-05 2.51e-04 NA NA
5. P Q9LBW4 3-hexulose-6-phosphate synthase 9.71e-10 5.75e-03 NA NA
5. P Q5N322 N-(5'-phosphoribosyl)anthranilate isomerase 1.16e-10 3.48e-17 NA NA
5. P C0Z4C0 Heptaprenylglyceryl phosphate synthase 1.15e-07 8.68e-05 NA NA
5. P Q6GCF3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.40e-08 2.41e-05 NA NA
5. P Q8ZY14 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.39e-05 2.73e-02 NA NA
5. P Q9CG48 Thiamine-phosphate synthase 2.82e-08 9.10e-05 NA NA
5. P Q9V1G7 N-(5'-phosphoribosyl)anthranilate isomerase 1.10e-10 8.93e-21 NA NA
5. P A3CNV9 3-dehydroquinate dehydratase 1.68e-05 2.51e-05 NA NA
5. P Q4ZNA1 Thiamine-phosphate synthase 7.95e-06 1.51e-02 NA NA
5. P Q9EYV3 Orotidine 5'-phosphate decarboxylase 2.43e-09 1.21e-03 NA NA
5. P A6WZX2 Pyridoxine 5'-phosphate synthase 3.70e-06 1.62e-05 NA NA
5. P Q12UK2 Triosephosphate isomerase 1.20e-07 4.25e-04 NA NA
5. P A2BSN1 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.62e-06 8.03e-03 NA NA
5. P Q5V4J7 Triosephosphate isomerase 4.00e-07 3.97e-05 NA NA
5. P Q02YU5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.38e-06 4.69e-04 NA NA
5. P Q1RCA7 Tryptophan synthase alpha chain 9.18e-04 4.07e-03 NA NA
5. P Q5M558 3-dehydroquinate dehydratase 1.66e-05 2.42e-03 NA NA
5. P A4VNJ1 Tryptophan synthase alpha chain 1.56e-07 4.66e-03 NA NA
5. P C4XSN4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.56e-09 3.84e-02 NA NA
5. P Q8FP55 Thiamine-phosphate synthase 3.44e-08 2.43e-05 NA NA
5. P B5F4M3 Tryptophan synthase alpha chain 4.42e-07 5.71e-04 NA NA
5. P Q2RM79 3-methyl-2-oxobutanoate hydroxymethyltransferase 5.55e-06 4.86e-02 NA NA
5. P P34793 Tryptophan synthase alpha chain 1.08e-07 1.21e-02 NA NA
5. P Q73EM5 Heptaprenylglyceryl phosphate synthase 6.69e-08 2.68e-02 NA NA
5. P Q2JTW6 Orotidine 5'-phosphate decarboxylase 5.05e-09 2.39e-05 NA NA
5. P B7N497 Orotidine 5'-phosphate decarboxylase 5.08e-08 3.43e-02 NA NA
5. P P0CZ75 3-dehydroquinate dehydratase 7.43e-08 2.36e-02 NA NA
5. P B3QMD7 Thiazole synthase 6.24e-06 1.38e-02 NA NA
5. P Q49XH9 Tryptophan synthase alpha chain 3.17e-08 2.30e-06 NA NA
5. P B8HKL1 Pyridoxine 5'-phosphate synthase 1.52e-09 4.49e-05 NA NA
5. P P65521 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 2.00e-08 3.54e-05 NA NA
5. P B8H623 Pyridoxine 5'-phosphate synthase 8.56e-10 1.42e-04 NA NA
5. P Q740P2 Tryptophan synthase alpha chain 5.49e-08 2.93e-02 NA NA
5. P A7X4S8 Thiamine-phosphate synthase 3.29e-08 6.66e-07 NA NA
5. P Q57AE9 N-(5'-phosphoribosyl)anthranilate isomerase 5.97e-10 2.33e-18 NA NA
5. P A7ZMF8 3-dehydroquinate dehydratase 3.91e-09 8.17e-03 NA NA
5. P Q30QK7 Orotidine 5'-phosphate decarboxylase 7.38e-08 2.16e-02 NA NA
5. P B4SDS5 Pyridoxine 5'-phosphate synthase 1.28e-09 1.26e-08 NA NA
5. P C5B9K6 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.84e-08 2.56e-02 NA NA
5. P Q31R79 N-(5'-phosphoribosyl)anthranilate isomerase 1.25e-10 2.65e-17 NA NA
5. P B7MLK1 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.01e-09 1.77e-07 NA NA
5. P A7GZP8 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.68e-05 1.28e-02 NA NA
5. P Q2Y7R3 N-(5'-phosphoribosyl)anthranilate isomerase 8.65e-10 1.04e-16 NA NA
5. P A2RF05 Orotidine 5'-phosphate decarboxylase 2.61e-08 5.52e-03 NA NA
5. P B0R333 Tryptophan synthase alpha chain 3.18e-08 3.13e-03 NA NA
5. P Q8TLP6 N-(5'-phosphoribosyl)anthranilate isomerase 1.49e-11 6.13e-19 NA NA
5. P B5F3B2 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.26e-09 2.27e-08 NA NA
5. P B8GLE3 Thiamine-phosphate synthase 1.64e-08 1.40e-04 NA NA
5. P B2FU58 Orotidine 5'-phosphate decarboxylase 4.27e-10 2.23e-04 NA NA
5. P A4IQ81 Tryptophan synthase alpha chain 5.41e-08 2.17e-03 NA NA
5. P Q214J9 Pyridoxine 5'-phosphate synthase 3.24e-10 1.54e-04 NA NA
5. P Q8Y3N4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.16e-06 1.02e-03 NA NA
5. P Q9UX10 Orotidine 5'-phosphate decarboxylase 1.10e-08 1.78e-06 NA NA
5. P Q5NPZ5 N-(5'-phosphoribosyl)anthranilate isomerase 1.43e-10 7.67e-19 NA NA
5. P Q98KL6 Pyridoxine 5'-phosphate synthase 1.80e-08 8.37e-05 NA NA
5. P A9MWR3 Tryptophan synthase alpha chain 4.25e-07 5.71e-04 NA NA
5. P Q8FB78 Thiamine-phosphate synthase 2.83e-09 4.70e-03 NA NA
5. P Q9PIF3 N-(5'-phosphoribosyl)anthranilate isomerase 1.97e-09 1.76e-16 NA NA
5. P Q8XXX9 N-(5'-phosphoribosyl)anthranilate isomerase 4.41e-10 6.06e-13 NA NA
5. P C5D6J1 Thiazole synthase 2.37e-09 3.97e-03 NA NA
5. P P77888 Orotidine 5'-phosphate decarboxylase 1.00e-07 2.55e-03 NA NA
5. P B7MBY5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.07e-06 1.69e-04 NA NA
5. P B7UR66 Tryptophan synthase alpha chain 4.20e-03 3.71e-03 NA NA
5. P Q5XDY5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.15e-08 2.19e-06 NA NA
5. P Q9P9M3 Orotidine 5'-phosphate decarboxylase 1.66e-07 1.50e-02 NA NA
5. P C1ELF1 Tryptophan synthase alpha chain 1.65e-08 1.79e-05 NA NA
5. P A0LJ55 Tryptophan synthase alpha chain 1.90e-05 3.59e-03 NA NA
5. P Q7M878 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.14e-05 4.86e-02 NA NA
5. P Q1G991 Orotidine 5'-phosphate decarboxylase 7.38e-08 6.76e-04 NA NA
5. P P58262 Thiazole synthase 2.99e-10 2.98e-02 NA NA
5. P B5YGR4 Pyridoxine 5'-phosphate synthase 2.73e-10 8.21e-05 NA NA
5. P Q0TIB0 Tryptophan synthase alpha chain 5.78e-07 7.21e-03 NA NA
5. P Q8TLP4 Tryptophan synthase alpha chain 8.24e-08 8.80e-03 NA NA
5. P Q5SKG9 Thiamine-phosphate synthase 9.95e-09 7.55e-05 NA NA
5. P P00929 Tryptophan synthase alpha chain 1.50e-04 5.04e-04 NA NA
5. P Q723F8 3-dehydroquinate dehydratase 4.37e-09 9.55e-04 NA NA
5. P Q5YNP9 Thiamine-phosphate synthase 1.61e-08 2.28e-05 NA NA
5. P Q2RIT8 N-(5'-phosphoribosyl)anthranilate isomerase 4.14e-10 7.70e-12 NA NA
5. P B7NTU3 3-dehydroquinate dehydratase 4.04e-09 1.42e-02 NA NA
5. P Q8PV88 Orotidine 5'-phosphate decarboxylase 3.08e-10 4.40e-04 NA NA
5. P Q0SMK9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 8.67e-07 4.56e-04 NA NA
5. P Q0VSP5 Thiamine-phosphate synthase 1.96e-06 8.93e-05 NA NA
5. P Q8FZT6 Pyridoxine 5'-phosphate synthase 2.04e-08 1.25e-06 NA NA
5. P A1BE95 Pyridoxine 5'-phosphate synthase 9.27e-10 6.47e-08 NA NA
5. P C0QR82 Thiamine-phosphate synthase 3.49e-09 1.08e-06 NA NA
5. P Q0STA1 Thiamine-phosphate synthase 1.34e-04 2.65e-04 NA NA
5. P Q3BMA4 Orotidine 5'-phosphate decarboxylase 6.47e-10 4.18e-03 NA NA
5. P Q8KU93 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.67e-06 8.42e-06 NA NA
5. P Q02XM4 3-dehydroquinate dehydratase 8.62e-08 1.53e-04 NA NA
5. P Q9KVS4 Thiazole synthase 5.05e-05 7.15e-03 NA NA
5. P Q92TD0 N-(5'-phosphoribosyl)anthranilate isomerase 3.77e-10 3.44e-15 NA NA
5. P Q2NVR2 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.79e-08 3.72e-02 NA NA
5. P B6INN5 Thiamine-phosphate synthase 2.83e-08 1.41e-04 NA NA
5. P Q7NML1 N-(5'-phosphoribosyl)anthranilate isomerase 1.96e-10 5.34e-16 NA NA
5. P B5Z2K2 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.09e-09 7.36e-08 NA NA
5. P Q1MRK9 Orotidine 5'-phosphate decarboxylase 6.98e-09 2.36e-03 NA NA
5. P B2HPZ9 Thiamine-phosphate synthase 9.47e-09 1.02e-04 NA NA
5. P Q28K56 Orotidine 5'-phosphate decarboxylase 5.84e-08 5.36e-04 NA NA
5. P A1SYZ6 Orotidine 5'-phosphate decarboxylase 1.13e-07 1.93e-04 NA NA
5. P Q5E624 Tryptophan synthase alpha chain 5.36e-05 6.91e-03 NA NA
5. P A3QER0 Thiazole synthase 4.85e-05 4.09e-02 NA NA
5. P Q87XG4 Pyridoxine 5'-phosphate synthase 2.75e-10 1.74e-03 NA NA
5. P B5YKL4 N-(5'-phosphoribosyl)anthranilate isomerase 1.33e-09 7.86e-17 NA NA
5. P A1KSV1 N-(5'-phosphoribosyl)anthranilate isomerase 1.88e-09 1.91e-15 NA NA
5. P B9DP52 N-(5'-phosphoribosyl)anthranilate isomerase 4.05e-11 4.36e-20 NA NA
5. P A3PEG2 Orotidine 5'-phosphate decarboxylase 1.33e-08 1.79e-03 NA NA
5. P Q8X7B5 Tryptophan synthase alpha chain 7.60e-05 3.08e-03 NA NA
5. P Q9K9W2 Orotidine 5'-phosphate decarboxylase 7.62e-08 1.33e-03 NA NA
5. P Q2RT91 Pyridoxine 5'-phosphate synthase 1.25e-10 3.33e-10 NA NA
5. P Q9X4E8 Tryptophan synthase alpha chain 1.43e-07 3.10e-03 NA NA
5. P A9M9U0 Tryptophan synthase alpha chain 2.58e-07 1.46e-02 NA NA
5. P B5YSV0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.13e-06 2.88e-04 NA NA
5. P B9KMG7 Tryptophan synthase alpha chain 2.36e-05 2.87e-03 NA NA
5. P A1RXV6 Geranylgeranylglyceryl phosphate synthase 3.19e-08 2.46e-03 NA NA
5. P B9DIJ5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.06e-06 2.02e-02 NA NA
5. P Q8DLN9 Tryptophan synthase alpha chain 9.91e-04 1.16e-02 NA NA
5. P A1AGB7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.86e-06 1.69e-04 NA NA
5. P B8ZU92 Thiazole synthase 1.59e-05 3.46e-02 NA NA
5. P Q0W4B8 3-dehydroquinate dehydratase 1.26e-07 5.40e-06 NA NA
5. P Q2FDR0 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.33e-06 1.54e-03 NA NA
5. P B9LAE4 Pyridoxine 5'-phosphate synthase 1.76e-09 4.80e-05 NA NA
5. P A1RVT3 N-(5'-phosphoribosyl)anthranilate isomerase 1.05e-09 3.57e-18 NA NA
5. P Q8DC73 Pyridoxine 5'-phosphate synthase 1.39e-10 8.43e-09 NA NA
5. P Q9PDK5 N-(5'-phosphoribosyl)anthranilate isomerase 9.32e-10 9.20e-20 NA NA
5. P A9M342 N-(5'-phosphoribosyl)anthranilate isomerase 1.65e-09 6.27e-15 NA NA
5. P A6QDV0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.40e-08 4.32e-05 NA NA
5. P Q15T09 Orotidine 5'-phosphate decarboxylase 7.03e-08 6.82e-04 NA NA
5. P A4FX32 Thiamine-phosphate synthase 6.65e-10 2.71e-05 NA NA
5. P B3QQ93 Pyridoxine 5'-phosphate synthase 1.74e-09 2.18e-03 NA NA
5. P Q8KZ93 Tryptophan synthase alpha chain 2.68e-05 4.32e-03 NA NA
5. P Q4V0R7 Pyridoxine 5'-phosphate synthase 5.20e-09 1.20e-08 NA NA
5. P B0T692 N-(5'-phosphoribosyl)anthranilate isomerase 4.23e-10 1.01e-15 NA NA
5. P Q24XQ0 Thiamine-phosphate synthase 3.48e-09 7.41e-05 NA NA
5. P A0L0R2 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.47e-08 2.95e-02 NA NA
5. P Q319H9 3-methyl-2-oxobutanoate hydroxymethyltransferase 5.38e-06 1.92e-03 NA NA
5. P Q1I4H6 Thiamine-phosphate synthase 6.06e-06 3.24e-04 NA NA
5. P Q5R146 Thiazole synthase 5.73e-06 3.84e-02 NA NA
5. P B8E2K1 Orotidine 5'-phosphate decarboxylase 1.59e-08 2.06e-03 NA NA
5. P C3PKY7 Tryptophan synthase alpha chain 1.27e-07 6.47e-03 NA NA
5. P B8J162 N-(5'-phosphoribosyl)anthranilate isomerase 3.19e-09 2.88e-15 NA NA
5. P A8FIR6 Thiamine-phosphate synthase 2.34e-06 5.76e-04 NA NA
5. P Q8DKM1 Pyridoxine 5'-phosphate synthase 2.02e-09 4.80e-05 NA NA
5. P Q757J9 N-(5'-phosphoribosyl)anthranilate isomerase 7.38e-11 6.42e-11 NA NA
5. P Q0SY07 Thiamine-phosphate synthase 3.52e-09 2.48e-03 NA NA
5. P B1IQ63 3-dehydroquinate dehydratase 4.48e-09 3.05e-02 NA NA
5. P B5FQK8 Thiamine-phosphate synthase 1.65e-09 1.91e-02 NA NA
5. P A8HQ40 N-(5'-phosphoribosyl)anthranilate isomerase 4.06e-10 7.43e-17 NA NA
5. P Q5GXR3 N-(5'-phosphoribosyl)anthranilate isomerase 1.31e-09 5.55e-15 NA NA
5. P Q492D2 Pyridoxine 5'-phosphate synthase 2.71e-10 1.64e-10 NA NA
5. P C1DCM3 Thiamine-phosphate synthase 3.15e-08 4.60e-04 NA NA
5. P Q3MEN8 Orotidine 5'-phosphate decarboxylase 8.48e-09 7.83e-03 NA NA
5. P A8G7G9 Thiazole synthase 1.04e-05 1.87e-02 NA NA
5. P Q65TE9 Tryptophan synthase alpha chain 2.28e-07 3.87e-02 NA NA
5. P C4Z135 Tryptophan synthase alpha chain 8.36e-04 7.64e-03 NA NA
5. P B1XNB2 N-(5'-phosphoribosyl)anthranilate isomerase 1.74e-10 5.62e-18 NA NA
5. P A6SUR1 Thiamine-phosphate synthase 3.61e-08 3.39e-04 NA NA
5. P O58878 Thiamine-phosphate synthase 3.74e-10 2.06e-03 NA NA
5. P B2K3W1 Tryptophan synthase alpha chain 5.93e-05 2.90e-04 NA NA
5. P Q39UG0 Pyridoxine 5'-phosphate synthase 1.13e-09 7.53e-09 NA NA
5. P Q0ATJ7 N-(5'-phosphoribosyl)anthranilate isomerase 3.82e-10 7.15e-16 NA NA
5. P A7GKI9 Heptaprenylglyceryl phosphate synthase 4.35e-08 7.79e-04 NA NA
5. P B2J448 Pyridoxine 5'-phosphate synthase 1.08e-09 7.78e-07 NA NA
5. P B5XJP1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.26e-08 2.70e-06 NA NA
5. P Q6HP96 Heptaprenylglyceryl phosphate synthase 5.50e-08 1.16e-02 NA NA
5. P P63592 3-dehydroquinate dehydratase 7.19e-08 2.36e-02 NA NA
5. P Q8KD79 Thiamine-phosphate synthase 6.96e-09 1.26e-02 NA NA
5. P Q5WFJ5 Orotidine 5'-phosphate decarboxylase 3.86e-08 1.84e-03 NA NA
5. P B4UGH8 Orotidine 5'-phosphate decarboxylase 1.90e-08 3.31e-05 NA NA
5. P P46212 Pyridoxine 5'-phosphate synthase (Fragment) 5.20e-09 1.47e-05 NA NA
5. P Q97VM8 Triosephosphate isomerase 1.56e-08 3.07e-07 NA NA
5. P Q119B9 Orotidine 5'-phosphate decarboxylase 5.66e-09 1.56e-03 NA NA
5. P Q8E092 Thiamine-phosphate synthase 7.38e-09 1.44e-05 NA NA
5. P Q10XS2 N-(5'-phosphoribosyl)anthranilate isomerase 4.10e-10 1.43e-16 NA NA
5. P A3MBU6 Tryptophan synthase alpha chain 9.85e-08 1.30e-03 NA NA
5. P Q64XW6 Orotidine 5'-phosphate decarboxylase 1.39e-07 2.13e-04 NA NA
5. P A9M9U3 N-(5'-phosphoribosyl)anthranilate isomerase 5.92e-10 2.33e-18 NA NA
5. P A5WDP0 Thiamine-phosphate synthase 4.15e-08 5.90e-03 NA NA
5. P B9LZK2 Orotidine 5'-phosphate decarboxylase 2.34e-08 4.82e-03 NA NA
5. P A6VXY2 Thiazole synthase 1.35e-04 1.52e-04 NA NA
5. P A6Q1S6 N-(5'-phosphoribosyl)anthranilate isomerase 2.34e-08 1.67e-16 NA NA
5. P Q5N1J0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.59e-06 1.43e-02 NA NA
5. P A6M1W6 Thiamine-phosphate synthase 2.90e-09 7.94e-06 NA NA
5. P A6VAK3 Pyridoxine 5'-phosphate synthase 2.70e-10 4.37e-08 NA NA
5. P A6QGS5 Tryptophan synthase alpha chain 3.15e-08 5.40e-06 NA NA
5. P Q2S2A8 Thiamine-phosphate synthase 1.14e-09 1.17e-02 NA NA
5. P B9K6Z3 N-(5'-phosphoribosyl)anthranilate isomerase 7.18e-09 5.05e-19 NA NA
5. P B2U764 Thiazole synthase 6.02e-05 1.33e-03 NA NA
5. P B3EKM6 N-(5'-phosphoribosyl)anthranilate isomerase 6.63e-11 7.74e-18 NA NA
5. P Q9K0D4 Tryptophan synthase alpha chain 1.03e-07 7.45e-03 NA NA
5. P A6VHZ5 Geranylgeranylglyceryl phosphate synthase 2.42e-07 1.25e-02 NA NA
5. P A0RB65 Tryptophan synthase alpha chain 1.53e-08 1.79e-05 NA NA
5. P Q8Z169 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.31e-09 5.44e-08 NA NA
5. P Q3JMY2 Thiazole synthase 9.15e-05 2.07e-04 NA NA
5. P Q8CRT8 Heptaprenylglyceryl phosphate synthase 2.95e-08 1.76e-04 NA NA
5. P A7Z259 Heptaprenylglyceryl phosphate synthase 5.69e-08 3.00e-03 NA NA
5. P Q6LVX7 Thiazole synthase 5.14e-05 4.99e-03 NA NA
5. P Q1AU93 N-(5'-phosphoribosyl)anthranilate isomerase 1.00e-09 1.68e-20 NA NA
5. P A0L8S5 Pyridoxine 5'-phosphate synthase 3.76e-10 6.26e-07 NA NA
5. P A1APM0 Orotidine 5'-phosphate decarboxylase 8.12e-09 4.18e-03 NA NA
5. P P00912 N-(5'-phosphoribosyl)anthranilate isomerase 1.96e-08 3.85e-17 NA NA
5. P Q8ZCP4 Pyridoxine 5'-phosphate synthase 2.24e-10 5.65e-10 NA NA
5. P Q9CGC2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.41e-06 2.68e-04 NA NA
5. P Q1LTG7 Orotidine 5'-phosphate decarboxylase 1.20e-07 7.21e-03 NA NA
5. P Q9X251 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.60e-06 3.69e-02 NA NA
5. P A9VRG1 Heptaprenylglyceryl phosphate synthase 5.65e-08 2.51e-05 NA NA
5. P B4S6H5 Tryptophan synthase alpha chain 1.76e-05 4.82e-02 NA NA
5. P A6UW24 N-(5'-phosphoribosyl)anthranilate isomerase 7.04e-11 9.99e-22 NA NA
5. P Q1R5V9 Thiamine-phosphate synthase 2.77e-09 3.38e-03 NA NA
5. P Q4L3P8 3-hexulose-6-phosphate synthase 5.70e-12 1.65e-07 NA NA
5. P Q9HX40 Thiamine-phosphate synthase 5.12e-06 5.73e-06 NA NA
5. P Q8P5R7 Thiamine-phosphate synthase 7.35e-08 1.84e-03 NA NA
5. P Q5PB36 Orotidine 5'-phosphate decarboxylase 2.42e-08 4.95e-04 NA NA
5. P A6GWS0 Thiazole synthase 8.59e-06 3.27e-03 NA NA
5. P Q3AR47 Thiazole synthase 6.31e-06 2.02e-03 NA NA
5. P C1DQS7 Pyridoxine 5'-phosphate synthase 2.74e-10 1.94e-06 NA NA
5. P Q3IP34 Thiamine-phosphate synthase 1.22e-09 3.62e-03 NA NA
5. P Q3AHU2 Orotidine 5'-phosphate decarboxylase 3.69e-08 1.36e-02 NA NA
5. P Q8GEI4 Thiazole synthase 9.45e-06 2.87e-03 NA NA
5. P Q9YBR1 Triosephosphate isomerase 8.71e-08 8.58e-03 NA NA
5. P B0CJK6 Tryptophan synthase alpha chain 2.27e-07 2.90e-02 NA NA
5. P A9BAZ9 Pyridoxine 5'-phosphate synthase 4.61e-10 1.59e-04 NA NA
5. P Q4K5I7 Thiamine-phosphate synthase 5.87e-06 2.07e-04 NA NA
5. P Q2JPT2 N-(5'-phosphoribosyl)anthranilate isomerase 4.63e-10 2.38e-14 NA NA
5. P Q2P9L0 Pyridoxine 5'-phosphate synthase 3.95e-09 4.53e-07 NA NA
5. P Q8CR20 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.88e-08 1.67e-02 NA NA
5. P Q58923 Triosephosphate isomerase 2.84e-08 2.15e-05 NA NA
5. P B6I9X4 Tryptophan synthase alpha chain 2.81e-03 4.62e-03 NA NA
5. P Q1JHJ2 3-dehydroquinate dehydratase 7.36e-08 2.36e-02 NA NA
5. P Q834E3 Orotidine 5'-phosphate decarboxylase 1.54e-07 2.02e-02 NA NA
5. P Q979V6 N-(5'-phosphoribosyl)anthranilate isomerase 6.28e-09 1.04e-13 NA NA
5. P P58264 Thiazole synthase 3.73e-05 3.31e-05 NA NA
5. P Q5KXV2 Tryptophan synthase alpha chain 8.53e-08 3.41e-02 NA NA
5. P Q6GJ99 3-hexulose-6-phosphate synthase 3.00e-12 7.86e-07 NA NA
5. P B7GWQ5 Tryptophan synthase alpha chain 3.13e-08 1.72e-02 NA NA
5. P A8A0N9 3-dehydroquinate dehydratase 4.21e-09 3.05e-02 NA NA
5. P Q9JXF5 Thiazole synthase 1.62e-05 2.55e-03 NA NA
5. P Q5L0U0 Orotidine 5'-phosphate decarboxylase 1.54e-07 1.27e-02 NA NA
5. P B3QMF2 N-(5'-phosphoribosyl)anthranilate isomerase 7.60e-11 6.67e-16 NA NA
5. P P00885 2-dehydro-3-deoxy-phosphogluconate aldolase 1.16e-08 1.70e-03 NA NA
5. P P08244 Orotidine 5'-phosphate decarboxylase 4.85e-08 2.25e-02 NA NA
5. P B4T6X2 Tryptophan synthase alpha chain 4.63e-07 5.71e-04 NA NA
5. P Q46K45 Pyridoxine 5'-phosphate synthase 6.06e-10 4.62e-07 NA NA
5. P Q02SE4 Thiamine-phosphate synthase 7.40e-06 4.16e-06 NA NA
5. P Q5M351 Tryptophan synthase alpha chain 2.07e-05 6.47e-03 NA NA
5. P Q7W923 N-(5'-phosphoribosyl)anthranilate isomerase 1.21e-10 3.32e-16 NA NA
5. P Q6LYI7 N-(5'-phosphoribosyl)anthranilate isomerase 8.60e-11 1.79e-20 NA NA
5. P Q3V891 Pyridoxine 5'-phosphate synthase 1.14e-09 3.84e-06 NA NA
5. P Q3BRL1 N-(5'-phosphoribosyl)anthranilate isomerase 1.21e-09 9.31e-16 NA NA
5. P B1LQL6 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.94e-10 7.36e-08 NA NA
5. P Q7W9J7 Pyridoxine 5'-phosphate synthase 4.21e-10 3.62e-06 NA NA
5. P A6LU97 Tryptophan synthase alpha chain 5.64e-08 3.71e-05 NA NA
5. P Q7N1X8 Pyridoxine 5'-phosphate synthase 1.93e-10 2.57e-09 NA NA
5. P B9JG42 N-(5'-phosphoribosyl)anthranilate isomerase 1.51e-10 6.35e-15 NA NA
5. P Q57NT2 Tryptophan synthase alpha chain 2.85e-03 8.51e-04 NA NA
5. P A1ABN0 3-dehydroquinate dehydratase 3.77e-09 2.60e-02 NA NA
5. P B6YR34 Tryptophan synthase alpha chain 1.71e-07 6.20e-03 NA NA
5. P Q3SH53 Pyridoxine 5'-phosphate synthase 2.25e-10 4.63e-10 NA NA
5. P O84331 N-(5'-phosphoribosyl)anthranilate isomerase 2.98e-08 2.45e-15 NA NA
5. P A1AAN0 Tryptophan synthase alpha chain 4.17e-03 4.07e-03 NA NA
5. P Q2FYR5 N-(5'-phosphoribosyl)anthranilate isomerase 2.69e-11 1.12e-19 NA NA
5. P C0RE25 Pyridoxine 5'-phosphate synthase 2.40e-08 1.88e-06 NA NA
5. P Q9ZJ29 Pyridoxine 5'-phosphate synthase 4.51e-09 2.14e-02 NA NA
5. P P66983 Tryptophan synthase alpha chain 2.62e-08 4.29e-06 NA NA
5. P C1ELE9 N-(5'-phosphoribosyl)anthranilate isomerase 1.73e-09 1.59e-14 NA NA
5. P O27120 Triosephosphate isomerase 8.63e-08 2.26e-03 NA NA
5. P A6UP14 Tryptophan synthase alpha chain 1.92e-08 8.68e-06 NA NA
5. P A9NC23 Orotidine 5'-phosphate decarboxylase 2.24e-08 3.18e-03 NA NA
5. P B2U6Y7 Tryptophan synthase alpha chain 1.07e-07 1.95e-03 NA NA
5. P A2BY35 Orotidine 5'-phosphate decarboxylase 3.79e-08 4.00e-03 NA NA
5. P P58641 Orotidine 5'-phosphate decarboxylase 1.25e-07 3.07e-02 NA NA
5. P B7NFT1 Thiazole synthase 5.87e-05 4.07e-03 NA NA
5. P Q6LPV5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.66e-06 8.74e-04 NA NA
5. P Q57CC2 Pyridoxine 5'-phosphate synthase 2.17e-08 1.88e-06 NA NA
5. P A6V0D3 Thiamine-phosphate synthase 5.21e-06 1.46e-05 NA NA
5. P Q978V5 Triosephosphate isomerase 1.07e-07 6.86e-03 NA NA
5. P B3DVI6 Orotidine 5'-phosphate decarboxylase 1.43e-08 9.90e-05 NA NA
5. P A6LC86 Pyridoxine 5'-phosphate synthase 3.06e-09 2.36e-07 NA NA
5. P B3E5K9 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.05e-05 1.56e-02 NA NA
5. P Q4QNC6 Thiamine-phosphate synthase 3.13e-08 6.64e-06 NA NA
5. P Q04H28 Orotidine 5'-phosphate decarboxylase 1.30e-08 1.49e-02 NA NA
5. P A1VY70 Tryptophan synthase alpha chain 5.71e-07 6.74e-03 NA NA
5. P Q30S57 Pyridoxine 5'-phosphate synthase 2.24e-09 1.03e-05 NA NA
5. P A6VPE0 Tryptophan synthase alpha chain 2.00e-07 3.38e-03 NA NA
5. P Q2A5V4 Tryptophan synthase alpha chain 1.95e-07 4.93e-02 NA NA
5. P A8IGE6 Thiamine-phosphate synthase 1.44e-08 1.57e-04 NA NA
5. P Q8YEZ2 Thiazole synthase 6.48e-05 3.68e-04 NA NA
5. P Q3V7G6 Pyridoxine 5'-phosphate synthase 6.13e-10 1.95e-09 NA NA
5. P A3PEE4 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.55e-06 1.67e-03 NA NA
5. P B5R6P3 Orotidine 5'-phosphate decarboxylase 6.48e-08 1.51e-02 NA NA
5. P Q3J5W4 Pyridoxine 5'-phosphate synthase 2.56e-10 1.56e-10 NA NA
5. P Q0TQ02 Thiazole synthase 1.07e-09 7.39e-03 NA NA
5. P B6J1D4 Orotidine 5'-phosphate decarboxylase 2.26e-08 3.18e-03 NA NA
5. P Q46JD8 Orotidine 5'-phosphate decarboxylase 5.42e-08 3.15e-04 NA NA
5. P P66918 Thiamine-phosphate synthase 6.90e-08 6.66e-07 NA NA
5. P Q8TUZ9 (5-formylfuran-3-yl)methyl phosphate synthase 2.89e-14 2.17e-14 NA NA
5. P A3PPV2 N-(5'-phosphoribosyl)anthranilate isomerase 2.17e-09 2.54e-17 NA NA
5. P Q11Q55 3-methyl-2-oxobutanoate hydroxymethyltransferase 5.17e-06 2.07e-03 NA NA
5. P B4T3E7 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.34e-09 2.27e-08 NA NA
5. P Q8UCD2 Thiazole synthase 3.68e-05 3.75e-02 NA NA
5. P B7GKQ8 Thiamine-phosphate synthase 9.17e-10 3.64e-04 NA NA
5. P Q6NEB7 3-methyl-2-oxobutanoate hydroxymethyltransferase 8.19e-06 1.19e-02 NA NA
5. P A6QIT5 Thiamine-phosphate synthase 4.73e-08 6.66e-07 NA NA
5. P B1I7S6 Tryptophan synthase alpha chain 5.53e-08 1.10e-05 NA NA
5. P B5BID8 Orotidine 5'-phosphate decarboxylase 3.47e-08 2.21e-02 NA NA
5. P A8H562 Thiazole synthase 5.15e-05 4.43e-03 NA NA
5. P B0BSI0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.49e-06 2.95e-03 NA NA
5. P Q4FRL9 Orotidine 5'-phosphate decarboxylase 1.21e-07 2.58e-04 NA NA
5. P Q5FNS2 Pyridoxine 5'-phosphate synthase 2.73e-09 8.21e-05 NA NA
5. P Q16C60 Thiazole synthase 8.04e-06 4.21e-03 NA NA
5. P Q1IX16 Thiamine-phosphate synthase 8.35e-09 3.50e-03 NA NA
5. P Q1MMI1 Orotidine 5'-phosphate decarboxylase 1.85e-09 7.59e-04 NA NA
5. P Q88DP1 Thiamine-phosphate synthase 5.73e-06 8.68e-05 NA NA
5. P A0AJL3 Heptaprenylglyceryl phosphate synthase 5.32e-08 2.44e-04 NA NA
5. P B2V7Q4 N-(5'-phosphoribosyl)anthranilate isomerase 2.45e-10 4.11e-14 NA NA
5. P A0R904 Heptaprenylglyceryl phosphate synthase 5.78e-08 1.16e-02 NA NA
5. P A9IUY4 Pyridoxine 5'-phosphate synthase 2.83e-10 2.29e-09 NA NA
5. P Q7MAP8 Pyridoxine 5'-phosphate synthase 2.64e-09 1.36e-05 NA NA
5. P Q2FJ70 3-hexulose-6-phosphate synthase 3.05e-12 2.82e-07 NA NA
5. P Q2YVA8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.44e-08 7.69e-05 NA NA
5. P Q3IDK9 Pyridoxine 5'-phosphate synthase 2.45e-10 3.37e-06 NA NA
5. P A8ESJ1 Pyridoxine 5'-phosphate synthase 2.30e-09 1.21e-06 NA NA
5. P Q81UX4 Thiazole synthase 2.67e-09 6.15e-03 NA NA
5. P Q58499 (5-formylfuran-3-yl)methyl phosphate synthase 6.31e-14 6.57e-11 NA NA
5. P Q31W92 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.90e-06 1.69e-04 NA NA
5. P Q8DLT3 Orotidine 5'-phosphate decarboxylase 2.46e-08 1.56e-02 NA NA
5. P A1WSF0 Tryptophan synthase alpha chain 3.99e-04 9.56e-03 NA NA
5. P B5FG54 Orotidine 5'-phosphate decarboxylase 3.50e-08 3.30e-04 NA NA
5. P Q8XDI7 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.01e-09 7.36e-08 NA NA
5. P Q7VBK3 Pyridoxine 5'-phosphate synthase 3.81e-10 1.40e-05 NA NA
5. P A9NDN6 Tryptophan synthase alpha chain 4.74e-07 1.82e-02 NA NA
5. P Q83PC0 Thiazole synthase 5.42e-05 2.60e-02 NA NA
5. P A1K607 Pyridoxine 5'-phosphate synthase 2.57e-10 2.24e-09 NA NA
5. P Q4FN35 Thiamine-phosphate synthase 1.49e-08 1.24e-04 NA NA
5. P P16923 N-(5'-phosphoribosyl)anthranilate isomerase 6.85e-11 1.68e-14 NA NA
5. P Q5XCT7 3-dehydroquinate dehydratase 7.48e-08 2.36e-02 NA NA
5. P B7NVQ5 Orotidine 5'-phosphate decarboxylase 5.69e-08 3.43e-02 NA NA
5. P A3M8N2 Tryptophan synthase alpha chain 2.14e-08 1.72e-02 NA NA
5. P P58643 Orotidine 5'-phosphate decarboxylase 5.09e-08 7.15e-03 NA NA
5. P Q6FEE6 Tryptophan synthase alpha chain 2.58e-08 3.90e-02 NA NA
5. P Q03GM4 Thiamine-phosphate synthase 6.53e-08 8.02e-06 NA NA
5. P Q2IGK0 Orotidine 5'-phosphate decarboxylase 2.02e-08 1.80e-05 NA NA
5. P A9KDC5 3-dehydroquinate dehydratase 6.50e-09 4.60e-04 NA NA
5. P A8G5H7 Pyridoxine 5'-phosphate synthase 1.13e-09 5.90e-11 NA NA
5. P B1L6Q8 Geranylgeranylglyceryl phosphate synthase 2.42e-07 6.19e-05 NA NA
5. P A3CS45 Thiamine-phosphate synthase 3.22e-10 7.26e-04 NA NA
5. P A7FPT0 Thiamine-phosphate synthase 5.40e-09 8.06e-05 NA NA
5. P A8A790 Thiazole synthase 4.37e-05 7.77e-03 NA NA
5. P A8YZE2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.37e-08 4.32e-05 NA NA
5. P Q02YJ4 Orotidine 5'-phosphate decarboxylase 1.27e-07 9.80e-03 NA NA
5. P A4YZQ4 Thiazole synthase 5.10e-05 4.78e-03 NA NA
5. P Q9YGB5 Indole-3-glycerol phosphate synthase 7.91e-09 2.64e-02 NA NA
5. P Q81ZG3 Heptaprenylglyceryl phosphate synthase 6.06e-08 1.78e-02 NA NA
5. P P0A761 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.83e-06 1.69e-04 NA NA
5. P B2V959 Thiazole synthase 1.11e-05 2.98e-02 NA NA
5. P A6QAX8 Pyridoxine 5'-phosphate synthase 4.19e-09 5.16e-03 NA NA
5. P B0UKV2 Tryptophan synthase alpha chain 8.97e-08 6.80e-03 NA NA
5. P Q3M672 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.67e-06 1.27e-04 NA NA
5. P Q5NLS8 Pyridoxine 5'-phosphate synthase 1.82e-10 9.38e-04 NA NA
5. P Q8F495 N-(5'-phosphoribosyl)anthranilate isomerase 5.52e-09 6.04e-19 NA NA
5. P Q6G677 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.08e-08 1.54e-03 NA NA
5. P Q0BXD3 Thiamine-phosphate synthase 4.35e-09 4.25e-06 NA NA
5. P A2BIS8 Geranylgeranylglyceryl phosphate synthase 1.67e-07 1.59e-02 NA NA
5. P A5UJQ8 3-dehydroquinate dehydratase 4.58e-08 3.32e-03 NA NA
5. P Q3ABS4 Tryptophan synthase alpha chain 7.38e-06 2.58e-02 NA NA
5. P Q63JM0 Tryptophan synthase alpha chain 1.04e-07 6.91e-03 NA NA
5. P A9IRJ9 N-(5'-phosphoribosyl)anthranilate isomerase 1.21e-10 2.41e-15 NA NA
5. P C3PH66 Thiazole synthase 2.30e-04 3.85e-04 NA NA
5. P B4RJU3 N-(5'-phosphoribosyl)anthranilate isomerase 1.79e-09 9.54e-15 NA NA
5. P B4SRN9 Orotidine 5'-phosphate decarboxylase 3.86e-10 2.80e-04 NA NA
5. P Q7VF28 Thiazole synthase 6.85e-05 7.86e-04 NA NA
5. P Q7V0Y7 Pyridoxine 5'-phosphate synthase 1.84e-09 3.52e-08 NA NA
5. P A6URI9 Geranylgeranylglyceryl phosphate synthase 2.24e-07 1.15e-04 NA NA
5. P B1XV46 Tryptophan synthase alpha chain 1.69e-05 1.43e-04 NA NA
5. P Q1WTX2 Orotidine 5'-phosphate decarboxylase 7.85e-08 1.26e-03 NA NA
5. P Q87F88 Pyridoxine 5'-phosphate synthase 2.08e-09 1.01e-06 NA NA
5. P C3P3U1 Tryptophan synthase alpha chain 1.86e-08 1.80e-05 NA NA
5. P Q72EU7 Tryptophan synthase alpha chain 2.63e-03 5.20e-03 NA NA
5. P B0VN04 Orotidine 5'-phosphate decarboxylase 2.54e-08 5.04e-04 NA NA
5. P Q83P27 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.00e-09 7.36e-08 NA NA
5. P A4IKR6 Thiazole synthase 3.30e-09 5.97e-04 NA NA
5. P Q28V29 Pyridoxine 5'-phosphate synthase 7.24e-10 1.24e-06 NA NA
5. P Q8XK02 Thiazole synthase 1.13e-09 2.70e-02 NA NA
5. P B1K366 Tryptophan synthase alpha chain 7.99e-08 3.41e-02 NA NA
5. P C0QMA1 Tryptophan synthase alpha chain 2.40e-07 3.68e-03 NA NA
5. P Q8Y6Q7 Tryptophan synthase alpha chain 8.90e-08 7.45e-04 NA NA
5. P Q3KF16 N-(5'-phosphoribosyl)anthranilate isomerase 3.58e-09 1.42e-20 NA NA
5. P Q97Q95 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 7.23e-08 3.41e-03 NA NA
5. P B1IUQ4 Thiamine-phosphate synthase 2.01e-09 6.52e-03 NA NA
5. P Q8NKN9 Triosephosphate isomerase 1.47e-08 1.69e-04 NA NA
5. P Q73BQ8 N-(5'-phosphoribosyl)anthranilate isomerase 1.55e-09 1.66e-15 NA NA
5. P B5Z9L2 Pyridoxine 5'-phosphate synthase 4.31e-09 1.91e-02 NA NA
5. P Q3A5V4 Pyridoxine 5'-phosphate synthase 1.15e-09 7.79e-09 NA NA
5. P Q6A911 Orotidine 5'-phosphate decarboxylase 6.66e-09 7.65e-04 NA NA
5. P P39594 Thiamine-phosphate synthase 2.15e-09 1.60e-04 NA NA
5. P Q970X0 Orotidine 5'-phosphate decarboxylase 3.35e-09 1.65e-04 NA NA
5. P Q8DPF0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 2.40e-08 2.51e-05 NA NA
5. P A6KWL1 Orotidine 5'-phosphate decarboxylase 1.36e-07 4.02e-04 NA NA
5. P Q99W39 3-hexulose-6-phosphate synthase 2.75e-12 2.22e-07 NA NA
5. P C1CEW6 3-dehydroquinate dehydratase 2.01e-05 3.35e-03 NA NA
5. P Q8YWS8 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.92e-06 6.82e-04 NA NA
5. P A6V3L5 Orotidine 5'-phosphate decarboxylase 6.66e-08 2.48e-02 NA NA
5. P C1KVS4 Tryptophan synthase alpha chain 6.95e-08 6.58e-04 NA NA
5. P Q8KEZ7 Tryptophan synthase alpha chain 2.04e-05 1.64e-03 NA NA
5. P Q8U088 Indole-3-glycerol phosphate synthase 3.97e-09 6.20e-03 NA NA
5. P P67003 N-(5'-phosphoribosyl)anthranilate isomerase 5.78e-10 2.33e-18 NA NA
5. P Q82TD8 Orotidine 5'-phosphate decarboxylase 1.01e-08 2.48e-03 NA NA
5. P B2TQ57 3-dehydroquinate dehydratase 2.40e-09 4.53e-02 NA NA
5. P Q1QS32 N-(5'-phosphoribosyl)anthranilate isomerase 2.15e-10 1.15e-12 NA NA
5. P P0CB52 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.55e-08 1.16e-05 NA NA
5. P P65518 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.17e-08 2.58e-04 NA NA
5. P B7JN72 Thiamine-phosphate synthase 3.07e-06 1.68e-03 NA NA
5. P Q72LM0 3-methyl-2-oxobutanoate hydroxymethyltransferase 7.18e-06 4.21e-03 NA NA
5. P A5UXG2 Tryptophan synthase alpha chain 3.50e-05 1.18e-02 NA NA
5. P B7MIX6 Thiazole synthase 1.81e-04 6.47e-03 NA NA
5. P B2SVN9 N-(5'-phosphoribosyl)anthranilate isomerase 1.22e-09 5.55e-15 NA NA
5. P Q4FLS6 Pyridoxine 5'-phosphate synthase 6.62e-09 1.31e-05 NA NA
5. P B1LA13 N-(5'-phosphoribosyl)anthranilate isomerase 3.55e-09 1.56e-20 NA NA
5. P P67004 N-(5'-phosphoribosyl)anthranilate isomerase 6.23e-10 2.33e-18 NA NA
5. P A9KFA7 Pyridoxine 5'-phosphate synthase 6.52e-10 2.45e-08 NA NA
5. P C3LPQ7 Thiazole synthase 1.13e-04 7.15e-03 NA NA
5. P Q0TQV4 Thiamine-phosphate synthase 1.38e-04 3.16e-05 NA NA
5. P Q7NWC0 Pyridoxine 5'-phosphate synthase 1.51e-10 4.21e-10 NA NA
5. P P50924 Orotidine 5'-phosphate decarboxylase 1.34e-07 7.09e-03 NA NA
5. P A1VRR8 Tryptophan synthase alpha chain 3.31e-07 2.09e-02 NA NA
5. P Q5HCV3 3-methyl-2-oxobutanoate hydroxymethyltransferase 7.81e-06 9.63e-04 NA NA
5. P A9VJW1 N-(5'-phosphoribosyl)anthranilate isomerase 5.02e-09 9.44e-16 NA NA
5. P Q82AG5 Thiazole synthase 1.70e-05 2.07e-02 NA NA
5. P A4YHV8 3-dehydroquinate dehydratase 8.47e-04 5.91e-04 NA NA
5. P B0CA72 N-(5'-phosphoribosyl)anthranilate isomerase 4.43e-10 1.81e-18 NA NA
5. P A9A6C3 Orotidine 5'-phosphate decarboxylase 3.74e-09 5.69e-05 NA NA
5. P Q8PRF1 Pyridoxine 5'-phosphate synthase 5.63e-09 2.95e-08 NA NA
5. P B7HH02 Tryptophan synthase alpha chain 1.38e-08 2.01e-05 NA NA
5. P Q824E9 Thiamine-phosphate synthase 8.16e-09 6.47e-04 NA NA
5. P Q74IA4 Deoxyribose-phosphate aldolase 1.57e-09 1.03e-02 NA NA
5. P A9AAG9 Thiamine-phosphate synthase 5.02e-10 2.63e-05 NA NA
5. P A7GAL0 Thiamine-phosphate synthase 5.71e-09 6.81e-05 NA NA
5. P A6VPK5 Orotidine 5'-phosphate decarboxylase 3.00e-08 4.13e-04 NA NA
5. P P57930 Thiamine-phosphate synthase 2.20e-07 1.70e-03 NA NA
5. P A4G0J0 Geranylgeranylglyceryl phosphate synthase 2.34e-07 3.66e-02 NA NA
5. P A9IRH0 Thiazole synthase 7.19e-06 1.85e-03 NA NA
5. P B5EBV0 N-(5'-phosphoribosyl)anthranilate isomerase 1.13e-09 1.49e-19 NA NA
5. P B5RAU8 3-dehydroquinate dehydratase 4.67e-09 1.81e-03 NA NA
5. P B6JNB7 Tryptophan synthase alpha chain 3.19e-05 2.23e-05 NA NA
5. P A3CLM2 Tryptophan synthase alpha chain 5.58e-08 1.99e-05 NA NA
5. P Q81IP4 Heptaprenylglyceryl phosphate synthase 7.28e-08 3.55e-04 NA NA
5. P Q2YQW4 N-(5'-phosphoribosyl)anthranilate isomerase 5.45e-10 2.33e-18 NA NA
5. P A5E8A5 N-(5'-phosphoribosyl)anthranilate isomerase 9.80e-11 9.34e-20 NA NA
5. P A4YWD1 Pyridoxine 5'-phosphate synthase 4.97e-10 4.12e-05 NA NA
5. P Q3V7F6 Pyridoxine 5'-phosphate synthase 3.02e-10 1.84e-06 NA NA
5. P O29844 Geranylgeranylglyceryl phosphate synthase 1.02e-07 8.07e-04 NA NA
5. P Q32GT0 Tryptophan synthase alpha chain 4.18e-03 2.57e-03 NA NA
5. P A8A7U2 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.04e-09 7.36e-08 NA NA
5. P Q48QG7 Tryptophan synthase alpha chain 2.09e-07 1.09e-02 NA NA
5. P Q5HEA8 Thiamine-phosphate synthase 4.60e-08 6.66e-07 NA NA
5. P Q87N49 Orotidine 5'-phosphate decarboxylase 5.47e-08 9.62e-05 NA NA
5. P A8FKD8 Tryptophan synthase alpha chain 4.32e-07 7.77e-03 NA NA
5. P P0A957 KHG/KDPG aldolase 9.78e-09 4.15e-02 NA NA
5. P C1CMD4 N-(5'-phosphoribosyl)anthranilate isomerase 8.08e-10 9.19e-17 NA NA
5. P Q5V1N9 Geranylgeranylglyceryl phosphate synthase 6.89e-09 1.14e-03 NA NA
5. P Q7VRR1 Pyridoxine 5'-phosphate synthase 5.00e-10 2.65e-07 NA NA
5. P A9R995 Tryptophan synthase alpha chain 3.36e-03 8.22e-04 NA NA
5. P Q65I34 N-(5'-phosphoribosyl)anthranilate isomerase 5.51e-12 3.95e-18 NA NA
5. P A5UJF1 Geranylgeranylglyceryl phosphate synthase 9.60e-09 3.15e-02 NA NA
5. P B2S8J9 Thiazole synthase 3.63e-05 6.02e-04 NA NA
5. P Q5HWB8 Tryptophan synthase alpha chain 3.79e-07 7.77e-03 NA NA
5. P B4T6V0 Orotidine 5'-phosphate decarboxylase 3.88e-08 1.78e-02 NA NA
5. P Q4KEZ9 N-(5'-phosphoribosyl)anthranilate isomerase 6.05e-10 1.18e-20 NA NA
5. P B0SJ25 Pyridoxine 5'-phosphate synthase 4.54e-09 7.70e-07 NA NA
5. P B8FA39 N-(5'-phosphoribosyl)anthranilate isomerase 9.24e-10 8.22e-15 NA NA
5. P A8MJ87 3-dehydroquinate dehydratase 1.11e-08 6.35e-04 NA NA
5. P A9N512 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.27e-09 2.27e-08 NA NA
5. P A0L3M6 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.67e-06 4.95e-03 NA NA
5. P Q2RK39 Orotidine 5'-phosphate decarboxylase 2.79e-08 3.46e-02 NA NA
5. P A8FM94 Thiazole synthase 4.10e-07 2.34e-02 NA NA
5. P Q3IQC4 Tryptophan synthase alpha chain 6.01e-08 7.70e-03 NA NA
5. P B1WRP7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.48e-09 4.90e-02 NA NA
5. P A6TGP7 Thiazole synthase 5.85e-05 3.38e-02 NA NA
5. P Q5HN28 Heptaprenylglyceryl phosphate synthase 2.79e-08 1.76e-04 NA NA
5. P Q2YP58 Thiazole synthase 3.49e-05 6.02e-04 NA NA
5. P A4XNC8 Tryptophan synthase alpha chain 1.15e-07 4.51e-03 NA NA
5. P Q8Z4K6 Pyridoxine 5'-phosphate synthase 3.90e-10 3.46e-11 NA NA
5. P A2BSQ0 Orotidine 5'-phosphate decarboxylase 1.82e-08 9.88e-03 NA NA
5. P A0LYL6 Orotidine 5'-phosphate decarboxylase 2.39e-07 4.10e-04 NA NA
5. P A5UA71 Thiamine-phosphate synthase 2.86e-08 6.64e-06 NA NA
5. P B8DFG3 Heptaprenylglyceryl phosphate synthase 7.29e-08 3.60e-07 NA NA
5. P A7ZLA2 Orotidine 5'-phosphate decarboxylase 4.92e-08 2.70e-02 NA NA
5. P B7MAQ3 3-dehydroquinate dehydratase 3.79e-09 2.60e-02 NA NA
5. P Q44604 Tryptophan synthase alpha chain 4.65e-03 7.27e-05 NA NA
5. P Q8D613 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.86e-06 1.24e-02 NA NA
5. P A4WPE1 Tryptophan synthase alpha chain 2.71e-05 4.43e-03 NA NA
5. P Q393Y2 Tryptophan synthase alpha chain 7.24e-08 1.31e-02 NA NA
5. P Q8DNM9 Tryptophan synthase alpha chain 6.50e-08 1.46e-05 NA NA
5. P P46535 Orotidine 5'-phosphate decarboxylase 1.48e-07 1.98e-02 NA NA
5. P B8DET0 Thiamine-phosphate synthase 1.87e-08 1.49e-04 NA NA
5. P Q31U04 Thiamine-phosphate synthase 1.93e-09 2.07e-03 NA NA
5. P A7NKL7 Tryptophan synthase alpha chain 3.72e-05 1.01e-03 NA NA
5. P Q97EF6 Tryptophan synthase alpha chain 2.25e-05 4.12e-02 NA NA
5. P Q21MI9 Thiamine-phosphate synthase 1.02e-05 1.31e-04 NA NA
5. P Q39I70 Pyridoxine 5'-phosphate synthase 4.60e-10 6.32e-06 NA NA
5. P Q3JCP9 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.96e-08 1.42e-02 NA NA
5. P O68429 Tryptophan synthase alpha chain 7.83e-04 2.06e-03 NA NA
5. P Q5PJ63 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.23e-09 2.27e-08 NA NA
5. P A6U311 Heptaprenylglyceryl phosphate synthase 3.59e-08 2.32e-05 NA NA
5. P Q87DS0 N-(5'-phosphoribosyl)anthranilate isomerase 1.16e-09 5.69e-19 NA NA
5. P B6IVY6 N-(5'-phosphoribosyl)anthranilate isomerase 1.55e-09 5.73e-16 NA NA
5. P P07601 Tryptophan synthase alpha chain 2.82e-05 7.70e-03 NA NA
5. P B2UW09 Orotidine 5'-phosphate decarboxylase 6.42e-08 2.01e-02 NA NA
5. P B6J3T7 3-dehydroquinate dehydratase 6.00e-09 4.60e-04 NA NA
5. P Q97CC6 Deoxyribose-phosphate aldolase 4.76e-07 8.37e-03 NA NA
5. P Q2S1Z2 Tryptophan synthase alpha chain 1.05e-05 4.49e-05 NA NA
5. P Q8DDL8 Thiazole synthase 2.37e-04 3.33e-02 NA NA
5. P A5ULP4 Thiamine-phosphate synthase 1.04e-09 1.48e-03 NA NA
5. P B9K819 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.82e-06 3.10e-02 NA NA
5. P Q2LUD8 N-(5'-phosphoribosyl)anthranilate isomerase 2.83e-09 1.19e-11 NA NA
5. P A9HE84 Tryptophan synthase alpha chain 1.90e-08 8.22e-04 NA NA
5. P B8E358 Thiamine-phosphate synthase 2.87e-10 3.25e-05 NA NA
5. P O28205 Thiamine-phosphate synthase 3.39e-09 2.23e-02 NA NA
5. P Q7M877 Tryptophan synthase alpha chain 2.05e-08 4.73e-04 NA NA
5. P Q5P5M2 Orotidine 5'-phosphate decarboxylase 4.25e-07 3.00e-02 NA NA
5. P Q3V8C9 Pyridoxine 5'-phosphate synthase 1.11e-09 6.11e-11 NA NA
5. P Q8ESZ3 Thiamine-phosphate synthase 6.46e-08 1.20e-05 NA NA
5. P B4SQV5 N-(5'-phosphoribosyl)anthranilate isomerase 6.02e-10 2.51e-15 NA NA
5. P Q9HSB9 Tryptophan synthase alpha chain 2.88e-08 3.13e-03 NA NA
5. P Q0AGX6 N-(5'-phosphoribosyl)anthranilate isomerase 3.92e-10 1.15e-17 NA NA
5. P Q8NWU1 Tryptophan synthase alpha chain 3.22e-08 5.40e-06 NA NA
5. P Q3V8A2 Pyridoxine 5'-phosphate synthase 2.93e-10 2.71e-03 NA NA
5. P B1WNQ1 Tryptophan synthase alpha chain 3.70e-08 3.07e-02 NA NA
5. P B5EQL6 Pyridoxine 5'-phosphate synthase 3.54e-10 2.37e-06 NA NA
5. P Q2J2G3 N-(5'-phosphoribosyl)anthranilate isomerase 2.09e-10 1.08e-14 NA NA
5. P Q5HU23 Thiamine-phosphate synthase 3.40e-09 6.18e-04 NA NA
5. P B2U2J7 3-dehydroquinate dehydratase 4.15e-09 2.19e-02 NA NA
5. P B9L788 Orotidine 5'-phosphate decarboxylase 2.87e-08 2.23e-02 NA NA
5. P B3R1Z6 Pyridoxine 5'-phosphate synthase 3.59e-10 1.22e-03 NA NA
5. P Q87YI1 N-(5'-phosphoribosyl)anthranilate isomerase 5.13e-10 2.09e-20 NA NA
5. P Q8EH78 Pyridoxine 5'-phosphate synthase 2.58e-10 5.62e-08 NA NA
5. P B9K6Z6 Tryptophan synthase alpha chain 2.18e-05 1.05e-02 NA NA
5. P A1B8L1 N-(5'-phosphoribosyl)anthranilate isomerase 1.26e-09 1.55e-17 NA NA
5. P Q1MRJ6 Thiamine-phosphate synthase 5.16e-10 2.24e-03 NA NA
5. P Q5H6B9 Orotidine 5'-phosphate decarboxylase 6.02e-10 4.21e-03 NA NA
5. P Q0T5D6 Tryptophan synthase alpha chain 4.41e-03 3.13e-03 NA NA
5. P B7GFU9 Heptaprenylglyceryl phosphate synthase 4.86e-08 6.14e-05 NA NA
5. P B7H4U6 Heptaprenylglyceryl phosphate synthase 5.98e-08 4.10e-04 NA NA
5. P A0PP30 Tryptophan synthase alpha chain 4.53e-08 1.87e-02 NA NA
5. P P26941 N-(5'-phosphoribosyl)anthranilate isomerase 8.46e-10 5.01e-20 NA NA
5. P Q92AP8 Heptaprenylglyceryl phosphate synthase 7.32e-08 2.28e-05 NA NA
5. P Q8Z080 Pyridoxine 5'-phosphate synthase 9.96e-10 4.53e-07 NA NA
5. P P62002 Triosephosphate isomerase 1.72e-08 2.06e-06 NA NA
5. P Q2S0U5 Pyridoxine 5'-phosphate synthase 9.17e-10 6.89e-10 NA NA
5. P Q8YE59 Tryptophan synthase alpha chain 2.46e-07 3.65e-03 NA NA
5. P B2S6L0 Pyridoxine 5'-phosphate synthase 1.87e-08 1.88e-06 NA NA
5. P A2SHS5 N-(5'-phosphoribosyl)anthranilate isomerase 3.33e-10 4.55e-19 NA NA
5. P Q88LW2 Orotidine 5'-phosphate decarboxylase 4.76e-08 5.25e-03 NA NA
5. P A0RA08 Thiazole synthase 2.32e-09 5.12e-03 NA NA
5. P Q6GFF1 Heptaprenylglyceryl phosphate synthase 2.39e-08 1.84e-05 NA NA
5. P A9B6M7 Tryptophan synthase alpha chain 3.69e-08 2.57e-03 NA NA
5. P B5E7M2 Tryptophan synthase alpha chain 5.37e-08 1.44e-05 NA NA
5. P B0SE83 Thiamine-phosphate synthase 1.37e-08 8.22e-04 NA NA
5. P B5Z089 Thiamine-phosphate synthase 3.57e-09 2.83e-03 NA NA
5. P Q93JX5 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.55e-06 2.95e-03 NA NA
5. P B1XBK9 Tryptophan synthase alpha chain 2.81e-03 3.74e-03 NA NA
5. P A1TYG6 Thiamine-phosphate synthase 2.82e-06 2.36e-04 NA NA
5. P Q3V7S0 Pyridoxine 5'-phosphate synthase 6.42e-10 1.77e-04 NA NA
5. P Q2FH65 N-(5'-phosphoribosyl)anthranilate isomerase 2.69e-11 1.12e-19 NA NA
5. P Q5LV87 Tryptophan synthase alpha chain 1.54e-07 3.41e-05 NA NA
5. P C5D2V7 3-dehydroquinate dehydratase 1.85e-09 1.09e-03 NA NA
5. P P25971 Orotidine 5'-phosphate decarboxylase 5.74e-08 6.05e-03 NA NA
5. P Q48KP5 Orotidine 5'-phosphate decarboxylase 4.90e-08 3.02e-03 NA NA
5. P Q0IB11 Pyridoxine 5'-phosphate synthase 8.30e-10 2.11e-05 NA NA
5. P P0A877 Tryptophan synthase alpha chain 4.12e-03 3.74e-03 NA NA
5. P Q8Y6Q5 N-(5'-phosphoribosyl)anthranilate isomerase 6.42e-09 2.73e-15 NA NA
5. P Q5R109 Pyridoxine 5'-phosphate synthase 4.40e-10 4.72e-08 NA NA
5. P Q8ZLQ7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 2.82e-06 1.96e-02 NA NA
5. P B7M0P9 3-dehydroquinate dehydratase 3.74e-09 2.44e-02 NA NA
5. P Q31HH3 Tryptophan synthase alpha chain 6.20e-09 6.58e-04 NA NA
5. P Q1CRX0 Tryptophan synthase alpha chain 3.31e-05 3.54e-05 NA NA
5. P A4TJ68 Tryptophan synthase alpha chain 5.83e-05 3.64e-04 NA NA
5. P B8GXJ5 Orotidine 5'-phosphate decarboxylase 2.37e-08 1.71e-02 NA NA
5. P A4F727 Thiamine-phosphate synthase 3.67e-08 3.10e-04 NA NA
5. P B3QJH1 Pyridoxine 5'-phosphate synthase 4.60e-10 4.34e-07 NA NA
5. P C3L541 Heptaprenylglyceryl phosphate synthase 5.72e-08 1.78e-02 NA NA
5. P Q57893 N-(5'-phosphoribosyl)anthranilate isomerase 2.73e-11 9.03e-19 NA NA
5. P Q8FF18 Pyridoxine 5'-phosphate synthase 1.70e-10 1.27e-10 NA NA
5. P Q67PJ5 N-(5'-phosphoribosyl)anthranilate isomerase 1.30e-10 7.70e-09 NA NA
5. P Q8CQ69 3-hexulose-6-phosphate synthase 4.92e-12 3.34e-06 NA NA
5. P B9KCG6 Pyridoxine 5'-phosphate synthase 1.93e-08 1.10e-03 NA NA
5. P Q3K8H1 Orotidine 5'-phosphate decarboxylase 5.08e-08 1.10e-02 NA NA
5. P Q5P6J5 Thiamine-phosphate synthase 7.00e-09 8.29e-05 NA NA
5. P Q3YSI5 Pyridoxine 5'-phosphate synthase 4.18e-10 3.33e-12 NA NA
5. P Q7URN0 Tryptophan synthase alpha chain 4.81e-08 5.03e-03 NA NA
5. P Q8X9G9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.98e-06 2.88e-04 NA NA
5. P Q5WKM9 3-dehydroquinate dehydratase 1.96e-09 9.97e-04 NA NA
5. P Q8KEH1 N-(5'-phosphoribosyl)anthranilate isomerase 8.57e-11 9.16e-15 NA NA
5. P Q2KUS6 Thiamine-phosphate synthase 5.64e-09 2.59e-03 NA NA
5. P C7PEQ0 Geranylgeranylglyceryl phosphate synthase 1.96e-07 5.51e-04 NA NA
5. P Q7US84 Thiazole synthase 4.13e-05 1.61e-02 NA NA
5. P A9KCT0 Orotidine 5'-phosphate decarboxylase 1.91e-08 3.18e-03 NA NA
5. P B4TFD0 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.27e-09 2.27e-08 NA NA
5. P A6TYA2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.40e-08 2.88e-04 NA NA
5. P Q8PH45 Thiamine-phosphate synthase 2.30e-08 1.17e-03 NA NA
5. P C6DGZ4 Tryptophan synthase alpha chain 4.07e-07 1.00e-02 NA NA
5. P Q5JDY1 Geranylgeranylglyceryl phosphate synthase 1.06e-07 2.59e-03 NA NA
5. P Q39VY5 Orotidine 5'-phosphate decarboxylase 3.38e-08 6.82e-04 NA NA
5. P B0JNJ4 N-(5'-phosphoribosyl)anthranilate isomerase 1.03e-09 3.20e-17 NA NA
5. P B9DP27 Tryptophan synthase alpha chain 7.58e-08 1.46e-08 NA NA
5. P A2C4A1 Orotidine 5'-phosphate decarboxylase 5.27e-08 1.31e-04 NA NA
5. P B0TS89 Thiazole synthase 5.82e-05 3.74e-03 NA NA
5. P P67006 N-(5'-phosphoribosyl)anthranilate isomerase 3.00e-11 1.12e-19 NA NA
5. P B8I3J4 Thiamine-phosphate synthase 1.30e-09 4.98e-05 NA NA
5. P B2I9J1 N-(5'-phosphoribosyl)anthranilate isomerase 1.18e-09 5.69e-19 NA NA
5. P Q040Z7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.70e-08 5.13e-05 NA NA
5. P P63590 3-dehydroquinate dehydratase 1.11e-05 2.36e-02 NA NA
5. P Q48U10 Orotidine 5'-phosphate decarboxylase 2.87e-08 1.06e-02 NA NA
5. P Q5HJ50 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.46e-08 4.32e-05 NA NA
5. P Q6L2N4 Geranylgeranylglyceryl phosphate synthase 1.62e-07 6.94e-04 NA NA
5. P A2C5C9 Thiazole synthase 7.59e-06 4.46e-02 NA NA
5. P P65520 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 2.28e-08 3.54e-05 NA NA
5. P A4VPM6 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.46e-08 4.56e-02 NA NA
5. P A8G6C1 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.66e-06 2.85e-03 NA NA
5. P C1KWD1 Orotidine 5'-phosphate decarboxylase 1.28e-07 4.90e-02 NA NA
5. P Q7MHP1 Pyridoxine 5'-phosphate synthase 1.44e-10 8.43e-09 NA NA
5. P Q5HWC0 N-(5'-phosphoribosyl)anthranilate isomerase 1.96e-09 1.76e-16 NA NA
5. P Q8TUT9 Triosephosphate isomerase 3.83e-08 3.04e-05 NA NA
5. P A5GLI2 Pyridoxine 5'-phosphate synthase 6.70e-10 1.02e-04 NA NA
5. P Q4KHS8 Pyridoxine 5'-phosphate synthase 2.74e-10 4.17e-04 NA NA
5. P A0AZ71 Tryptophan synthase alpha chain 8.12e-08 3.41e-02 NA NA
5. P Q88WH9 Tryptophan synthase alpha chain 2.33e-07 1.91e-05 NA NA
5. P Q1D7A6 Thiazole synthase 1.22e-09 1.25e-03 NA NA
5. P Q8DYU4 3-dehydroquinate dehydratase 1.97e-05 2.87e-03 NA NA
5. P B7K7E4 Pyridoxine 5'-phosphate synthase 1.27e-09 2.12e-06 NA NA
5. P A8AW06 Tryptophan synthase alpha chain 5.98e-08 1.61e-06 NA NA
5. P A5G535 Pyridoxine 5'-phosphate synthase 1.06e-09 2.07e-08 NA NA
5. P Q39KA4 Thiazole synthase 8.23e-05 1.31e-03 NA NA
5. P A5EVH6 Orotidine 5'-phosphate decarboxylase 9.52e-08 8.90e-04 NA NA
5. P Q5WH87 Thiamine-phosphate synthase 3.51e-10 3.18e-03 NA NA
5. P Q0AIZ1 Orotidine 5'-phosphate decarboxylase 9.15e-09 8.94e-03 NA NA
5. P Q9YGB1 N-(5'-phosphoribosyl)anthranilate isomerase 8.56e-11 3.35e-21 NA NA
5. P Q71YI4 Orotidine 5'-phosphate decarboxylase 1.26e-07 4.90e-02 NA NA
5. P P30137 Thiamine-phosphate synthase 3.52e-09 6.52e-03 NA NA
5. P A1WY07 N-(5'-phosphoribosyl)anthranilate isomerase 7.96e-10 3.64e-15 NA NA
5. P Q3SK77 Orotidine 5'-phosphate decarboxylase 9.06e-09 2.60e-04 NA NA
5. P Q8NVT0 Heptaprenylglyceryl phosphate synthase 3.68e-08 7.62e-05 NA NA
5. P B8ZU95 Thiamine-phosphate synthase 2.65e-08 1.69e-04 NA NA
5. P B7GEY2 Thiazole synthase 4.83e-09 8.82e-04 NA NA
5. P B2G7Q4 Thiamine-phosphate synthase 3.48e-08 2.39e-05 NA NA
5. P Q5JFV1 3-dehydroquinate dehydratase 6.62e-07 1.21e-03 NA NA
5. P C1C967 N-(5'-phosphoribosyl)anthranilate isomerase 8.67e-10 4.52e-16 NA NA
5. P Q3V7J3 Pyridoxine 5'-phosphate synthase 2.35e-10 3.21e-11 NA NA
5. P Q0AXG7 Orotidine 5'-phosphate decarboxylase 3.20e-08 1.20e-04 NA NA
5. P Q0BQJ0 Tryptophan synthase alpha chain 3.03e-08 3.55e-04 NA NA
5. P A4XYV5 Thiamine-phosphate synthase 5.83e-06 1.33e-03 NA NA
5. P A1UID0 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.33e-06 2.90e-02 NA NA
5. P Q2G8S8 Tryptophan synthase alpha chain 4.59e-08 2.34e-02 NA NA
5. P A5INE5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.47e-08 1.81e-02 NA NA
5. P B8IPG1 Thiazole synthase 5.29e-06 2.07e-02 NA NA
5. P B1ICH8 3-dehydroquinate dehydratase 1.92e-05 3.35e-03 NA NA
5. P C5BDB6 Tryptophan synthase alpha chain 7.60e-04 3.52e-02 NA NA
5. P Q7U7S1 Pyridoxine 5'-phosphate synthase 9.19e-07 8.36e-07 NA NA
5. P Q48907 3-hexulose-6-phosphate synthase 6.50e-12 2.44e-04 NA NA
5. P O67502 Tryptophan synthase alpha chain 4.90e-08 2.23e-02 NA NA
5. P Q46DY6 Triosephosphate isomerase 1.10e-07 6.37e-05 NA NA
5. P P0A878 Tryptophan synthase alpha chain 3.18e-03 3.74e-03 NA NA
5. P Q92TC8 Tryptophan synthase alpha chain 3.78e-05 9.80e-03 NA NA
5. P Q3SRG9 Orotidine 5'-phosphate decarboxylase 4.98e-09 2.36e-03 NA NA
5. P B5YA97 Thiamine-phosphate synthase 2.54e-10 1.57e-03 NA NA
5. P B6JPA4 Orotidine 5'-phosphate decarboxylase 6.52e-08 6.52e-03 NA NA
5. P B0RR82 N-(5'-phosphoribosyl)anthranilate isomerase 1.17e-09 1.43e-16 NA NA
5. P A8FUV3 Thiazole synthase 4.54e-05 1.81e-03 NA NA
5. P Q64TA1 Thiamine-phosphate synthase 1.15e-08 1.03e-04 NA NA
5. P Q5V145 3-dehydroquinate dehydratase 3.96e-04 5.61e-03 NA NA
5. P A5TZE0 Thiamine-phosphate synthase 1.95e-08 3.11e-06 NA NA
5. P Q97BE8 Thiamine-phosphate synthase 1.16e-08 3.94e-03 NA NA
5. P B4RCL1 Tryptophan synthase alpha chain 2.99e-08 2.92e-03 NA NA
5. P A7N7S3 Thiamine-phosphate synthase 1.88e-04 6.31e-05 NA NA
5. P A7I4T5 N-(5'-phosphoribosyl)anthranilate isomerase 5.99e-11 5.28e-19 NA NA
5. P A2SSN5 Triosephosphate isomerase 1.01e-07 7.45e-03 NA NA
5. P A5N7N9 N-(5'-phosphoribosyl)anthranilate isomerase 9.72e-10 2.18e-13 NA NA
5. P Q32BB6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.03e-06 7.55e-05 NA NA
5. P Q5HEL6 Heptaprenylglyceryl phosphate synthase 3.87e-08 7.62e-05 NA NA
5. P C1CG43 N-(5'-phosphoribosyl)anthranilate isomerase 7.77e-10 4.52e-16 NA NA
5. P Q47R98 3-methyl-2-oxobutanoate hydroxymethyltransferase 8.12e-06 3.32e-03 NA NA
5. P A8ZWP0 Orotidine 5'-phosphate decarboxylase 2.47e-09 5.66e-04 NA NA
5. P A5UBN7 Orotidine 5'-phosphate decarboxylase 5.64e-08 1.71e-03 NA NA
5. P B4RYN8 3-methyl-2-oxobutanoate hydroxymethyltransferase 8.75e-09 2.44e-02 NA NA
5. P Q6LYI9 Tryptophan synthase alpha chain 1.70e-08 2.43e-05 NA NA
5. P O68816 Tryptophan synthase alpha chain 3.41e-08 9.09e-03 NA NA
5. P Q3JDH3 Thiamine-phosphate synthase 1.42e-04 1.87e-03 NA NA
5. P Q92AH6 Orotidine 5'-phosphate decarboxylase 1.69e-07 4.09e-02 NA NA
5. P B3E1T2 Orotidine 5'-phosphate decarboxylase 9.86e-09 2.13e-02 NA NA
5. P Q3M9L4 Pyridoxine 5'-phosphate synthase 1.20e-09 7.52e-08 NA NA
5. P B3ELU3 Pyridoxine 5'-phosphate synthase 5.08e-10 9.81e-05 NA NA
5. P Q8YA44 Thiamine-phosphate synthase 2.23e-08 2.78e-04 NA NA
5. P C3LFA6 Thiazole synthase 2.08e-09 6.15e-03 NA NA
5. P A8A793 Thiamine-phosphate synthase 2.76e-09 2.20e-03 NA NA
5. P Q5WK54 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.48e-08 9.32e-03 NA NA
5. P Q7MGM7 Thiazole synthase 2.47e-04 3.33e-02 NA NA
5. P Q24SK5 N-(5'-phosphoribosyl)anthranilate isomerase 3.86e-09 8.62e-07 NA NA
5. P A9AMA5 Tryptophan synthase alpha chain 1.10e-07 5.61e-03 NA NA
5. P C3PBN9 Heptaprenylglyceryl phosphate synthase 5.75e-08 1.78e-02 NA NA
5. P A5UYU9 N-(5'-phosphoribosyl)anthranilate isomerase 2.11e-09 2.62e-18 NA NA
5. P Q30U33 Thiazole synthase 1.27e-05 6.76e-04 NA NA
5. P B1MBV2 Tryptophan synthase alpha chain 4.57e-08 5.08e-04 NA NA
5. P Q8RI59 Thiamine-phosphate synthase 6.80e-09 2.55e-05 NA NA
5. P A2BRT6 Pyridoxine 5'-phosphate synthase 1.14e-09 2.96e-10 NA NA
5. P B0U2A9 Pyridoxine 5'-phosphate synthase 3.18e-09 1.63e-07 NA NA
5. P Q53726 Heptaprenylglyceryl phosphate synthase 4.24e-08 7.62e-05 NA NA
5. P B8ZN58 Tryptophan synthase alpha chain 5.12e-08 1.10e-05 NA NA
5. P Q5FRN3 Tryptophan synthase alpha chain 3.84e-08 2.64e-02 NA NA
5. P Q47WP8 Pyridoxine 5'-phosphate synthase 2.80e-10 1.74e-08 NA NA
5. P Q3IGA7 Orotidine 5'-phosphate decarboxylase 8.45e-08 2.42e-04 NA NA
5. P A7I3Y5 Pyridoxine 5'-phosphate synthase 8.04e-09 2.52e-06 NA NA
5. P Q9HQS4 Triosephosphate isomerase 3.45e-07 2.95e-05 NA NA
5. P Q31XS3 Pyridoxine 5'-phosphate synthase 1.64e-10 1.21e-10 NA NA
5. P P58640 Orotidine 5'-phosphate decarboxylase 5.02e-08 3.43e-02 NA NA
5. P A9BHQ4 N-(5'-phosphoribosyl)anthranilate isomerase 3.40e-10 2.10e-18 NA NA
5. P B8DPF1 Pyridoxine 5'-phosphate synthase 6.02e-10 4.25e-04 NA NA
5. P B1XY47 N-(5'-phosphoribosyl)anthranilate isomerase 8.40e-10 5.87e-14 NA NA
5. P B4EYU2 Thiamine-phosphate synthase 8.50e-10 8.74e-04 NA NA
5. P Q47AF2 Orotidine 5'-phosphate decarboxylase 4.93e-07 4.35e-02 NA NA
5. P Q31TC7 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.05e-09 7.36e-08 NA NA
5. P Q5HIA5 3-hexulose-6-phosphate synthase 3.02e-12 2.22e-07 NA NA
5. P O67520 Orotidine 5'-phosphate decarboxylase 2.08e-09 3.65e-03 NA NA
5. P Q7VAP8 Orotidine 5'-phosphate decarboxylase 6.48e-08 1.13e-03 NA NA
5. P C5A615 Geranylgeranylglyceryl phosphate synthase 8.56e-08 1.61e-02 NA NA
5. P C6C1D1 Tryptophan synthase alpha chain 1.45e-03 7.55e-05 NA NA
5. P O29333 Orotidine 5'-phosphate decarboxylase 1.92e-09 5.71e-03 NA NA
5. P Q8UJB1 N-(5'-phosphoribosyl)anthranilate isomerase 3.23e-10 1.04e-13 NA NA
5. P Q2NET5 Geranylgeranylglyceryl phosphate synthase 8.24e-08 1.36e-03 NA NA
5. P A5FJ95 Pyridoxine 5'-phosphate synthase 3.15e-09 3.69e-06 NA NA
5. P B1Z1P1 Tryptophan synthase alpha chain 9.69e-08 1.28e-02 NA NA
5. P B3QTV1 Pyridoxine 5'-phosphate synthase 1.71e-09 1.14e-08 NA NA
5. P B1ZSC4 Orotidine 5'-phosphate decarboxylase 3.12e-08 2.56e-02 NA NA
5. P A7H522 Tryptophan synthase alpha chain 5.06e-07 7.21e-03 NA NA
5. P O22765 Tryptophan synthase alpha chain 3.35e-08 2.88e-04 NA NA
5. P Q10Y87 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.36e-09 1.87e-02 NA NA
5. P Q049E0 Orotidine 5'-phosphate decarboxylase 6.52e-08 6.76e-04 NA NA
5. P A0T0L1 Thiazole synthase 8.73e-06 1.49e-02 NA NA
5. P B2TY68 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.11e-09 3.88e-08 NA NA
5. P B6I1U1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.11e-06 1.69e-04 NA NA
5. P Q49WT7 3-hexulose-6-phosphate synthase 1 3.91e-12 1.58e-06 NA NA
5. P Q8FXY6 Tryptophan synthase alpha chain 1.92e-07 1.46e-02 NA NA
5. P Q72DM8 Orotidine 5'-phosphate decarboxylase 1.18e-08 4.95e-03 NA NA
5. P P58687 3-dehydroquinate dehydratase 4.69e-09 3.74e-03 NA NA
5. P P24670 3-dehydroquinate dehydratase 4.50e-09 3.43e-02 NA NA
5. P Q3V7J9 Pyridoxine 5'-phosphate synthase 1.29e-10 7.28e-08 NA NA
5. P P65523 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.07e-08 1.86e-06 NA NA
5. P Q9Y8T6 N-(5'-phosphoribosyl)anthranilate isomerase 4.93e-10 4.69e-19 NA NA
5. P A4VQX9 Thiamine-phosphate synthase 5.92e-06 1.02e-04 NA NA
5. P Q0T067 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.88e-06 1.73e-04 NA NA
5. P Q3B4B1 Thiamine-phosphate synthase 1.65e-09 6.74e-03 NA NA
5. P Q65SI1 Orotidine 5'-phosphate decarboxylase 1.41e-08 8.97e-04 NA NA
5. P Q1GXW1 Thiamine-phosphate synthase 9.89e-09 9.20e-06 NA NA
5. P A4W5B3 Thiazole synthase 5.34e-05 7.39e-03 NA NA
5. P Q2FM63 Thiamine-phosphate synthase 1.64e-09 6.52e-03 NA NA
5. P C4XIJ2 Thiamine-phosphate synthase 2.70e-08 1.93e-02 NA NA
5. P Q7V0D8 Orotidine 5'-phosphate decarboxylase 2.93e-08 2.88e-04 NA NA
5. P B7I0F3 Tryptophan synthase alpha chain 2.86e-08 5.91e-05 NA NA
5. P Q8U2H5 Uncharacterized protein PF0860 1.04e-11 1.10e-03 NA NA
5. P B5BIC0 Tryptophan synthase alpha chain 4.49e-07 1.86e-04 NA NA
5. P P39304 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.68e-10 1.77e-07 NA NA
5. P P13997 N-(5'-phosphoribosyl)anthranilate isomerase 4.56e-10 5.96e-18 NA NA
5. P B3ENW0 Tryptophan synthase alpha chain 2.15e-05 2.15e-03 NA NA
5. P Q6LZM2 Orotidine 5'-phosphate decarboxylase 5.26e-09 9.71e-04 NA NA
5. P B2AGF6 Thiazole synthase 2.24e-05 6.62e-05 NA NA
5. P B7JES9 N-(5'-phosphoribosyl)anthranilate isomerase 2.26e-09 2.95e-14 NA NA
5. P Q890C0 Thiamine-phosphate synthase 1.09e-08 5.66e-04 NA NA
5. P Q2JPF1 Orotidine 5'-phosphate decarboxylase 4.44e-09 2.42e-03 NA NA
5. P Q71YQ8 Heptaprenylglyceryl phosphate synthase 5.67e-08 3.24e-07 NA NA
5. P B0CHH2 Pyridoxine 5'-phosphate synthase 4.61e-06 1.25e-06 NA NA
5. P Q97CA8 3-dehydroquinate dehydratase 6.22e-05 8.51e-04 NA NA
5. P B2KEC4 Pyridoxine 5'-phosphate synthase 4.17e-09 1.93e-04 NA NA
5. P A0KWK2 Thiazole synthase 4.92e-06 3.62e-03 NA NA
5. P P16608 Tryptophan synthase alpha chain 3.32e-07 4.63e-02 NA NA
5. P Q1J729 Orotidine 5'-phosphate decarboxylase 2.54e-08 5.52e-03 NA NA
5. P Q4ZVW1 N-(5'-phosphoribosyl)anthranilate isomerase 5.60e-10 7.67e-19 NA NA
5. P A1UAB4 Thiamine-phosphate synthase 4.06e-09 1.92e-06 NA NA
5. P Q3KM33 N-(5'-phosphoribosyl)anthranilate isomerase 1.70e-08 4.34e-15 NA NA
5. P Q660M6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 8.75e-07 3.12e-04 NA NA
5. P B9M5K2 Pyridoxine 5'-phosphate synthase 6.83e-10 1.61e-08 NA NA
5. P B1XY49 Tryptophan synthase alpha chain 8.01e-08 5.12e-03 NA NA
5. P Q2W019 Orotidine 5'-phosphate decarboxylase 4.38e-08 2.38e-03 NA NA
5. P Q0TCP3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.06e-06 1.69e-04 NA NA
5. P Q0AA48 Orotidine 5'-phosphate decarboxylase 1.35e-08 3.92e-04 NA NA
5. P Q9RQV9 Pyridoxine 5'-phosphate synthase 4.84e-10 8.76e-06 NA NA
5. P Q31GC7 Orotidine 5'-phosphate decarboxylase 4.55e-08 2.92e-03 NA NA
5. P B7LCQ5 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.04e-09 7.36e-08 NA NA
5. P B2UY65 Thiamine-phosphate synthase 1.09e-09 1.66e-06 NA NA
5. P Q01NZ1 Thiazole synthase 1.19e-09 2.58e-02 NA NA
5. P Q7TTU8 Tryptophan synthase alpha chain 8.94e-04 3.41e-03 NA NA
5. P A9AZD9 Thiamine-phosphate synthase 9.98e-10 1.90e-03 NA NA
5. P B5XYE8 Thiazole synthase 4.51e-05 2.34e-02 NA NA
5. P Q980I4 3-dehydroquinate dehydratase 3.48e-03 7.21e-03 NA NA
5. P B7I8K2 Tryptophan synthase alpha chain 1.51e-08 1.72e-02 NA NA
5. P B7J2K0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 8.88e-07 1.54e-04 NA NA
5. P B1IUQ7 Thiazole synthase 5.84e-05 5.25e-03 NA NA
5. P A9BAN4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.28e-08 3.96e-02 NA NA
5. P Q17ZN1 Pyridoxine 5'-phosphate synthase 4.26e-09 1.32e-03 NA NA
5. P Q01128 N-(5'-phosphoribosyl)anthranilate isomerase 6.05e-08 6.75e-08 NA NA
5. P A0B8J3 Geranylgeranylglyceryl phosphate synthase 5.83e-08 1.37e-02 NA NA
5. P Q3YUZ1 Thiamine-phosphate synthase 3.63e-09 3.53e-03 NA NA
5. P A3M508 Orotidine 5'-phosphate decarboxylase 2.54e-08 1.15e-03 NA NA
5. P A0LK96 Pyridoxine 5'-phosphate synthase 3.32e-10 1.19e-04 NA NA
5. P Q9L9I8 Thiamine-phosphate synthase 1.65e-09 1.42e-02 NA NA
5. P O67853 N-(5'-phosphoribosyl)anthranilate isomerase 8.05e-10 3.92e-19 NA NA
5. P A9A3Z1 Geranylgeranylglyceryl phosphate synthase 6.87e-08 9.02e-03 NA NA
5. P Q1JM65 Orotidine 5'-phosphate decarboxylase 2.88e-08 1.06e-02 NA NA
5. P B4EFK2 Tryptophan synthase alpha chain 7.73e-08 3.00e-02 NA NA
5. P A1WAT8 Tryptophan synthase alpha chain 1.50e-07 7.79e-04 NA NA
5. P Q2G8S2 Orotidine 5'-phosphate decarboxylase 2.24e-08 5.38e-03 NA NA
5. P Q8ESU3 N-(5'-phosphoribosyl)anthranilate isomerase 4.96e-10 4.02e-12 NA NA
5. P B5EAK6 Tryptophan synthase alpha chain 2.41e-08 8.21e-05 NA NA
5. P O30011 3-dehydroquinate dehydratase 3.20e-05 1.47e-04 NA NA
5. P Q2FQM4 Geranylgeranylglyceryl phosphate synthase 4.46e-08 1.86e-04 NA NA
5. P Q7NUD9 Tryptophan synthase alpha chain 5.52e-08 7.45e-03 NA NA
5. P A2BTP5 Thiazole synthase 1.03e-05 3.05e-02 NA NA
5. P Q8R7I7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.06e-06 1.38e-02 NA NA
5. P A4WLS7 Geranylgeranylglyceryl phosphate synthase 7.87e-08 1.79e-03 NA NA
5. P A6T006 Tryptophan synthase alpha chain 2.24e-05 4.66e-03 NA NA
5. P B3QS44 N-(5'-phosphoribosyl)anthranilate isomerase 3.18e-10 6.80e-15 NA NA
5. P A3CK30 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.61e-08 9.39e-06 NA NA
5. P Q7VY68 N-(5'-phosphoribosyl)anthranilate isomerase 1.26e-10 2.58e-15 NA NA
5. P Q8E4F2 3-dehydroquinate dehydratase 1.97e-05 2.87e-03 NA NA
5. P Q7N964 Thiamine-phosphate synthase 7.99e-10 6.43e-05 NA NA
5. P C1EYJ3 Thiazole synthase 1.86e-09 8.37e-03 NA NA
5. P Q5HG48 N-(5'-phosphoribosyl)anthranilate isomerase 1.61e-11 1.12e-19 NA NA
5. P B8DHB5 Tryptophan synthase alpha chain 9.39e-08 6.58e-04 NA NA
5. P A6KXM3 Pyridoxine 5'-phosphate synthase 3.20e-09 9.75e-09 NA NA
5. P C1CL86 3-dehydroquinate dehydratase 1.99e-05 2.19e-02 NA NA
5. P A1AYV3 Tryptophan synthase alpha chain 1.72e-07 3.71e-05 NA NA
5. P Q2Y865 Pyridoxine 5'-phosphate synthase 2.52e-10 6.45e-07 NA NA
5. P B1I3Z6 N-(5'-phosphoribosyl)anthranilate isomerase 1.35e-09 3.08e-19 NA NA
5. P B9DMR9 Heptaprenylglyceryl phosphate synthase 8.76e-08 1.47e-05 NA NA
5. P B4SD44 N-(5'-phosphoribosyl)anthranilate isomerase 1.47e-10 1.90e-17 NA NA
5. P Q4FUL2 Tryptophan synthase alpha chain 6.84e-08 1.54e-02 NA NA
5. P P50908 Tryptophan synthase alpha chain 2.53e-05 1.11e-02 NA NA
5. P Q97CS3 Orotidine 5'-phosphate decarboxylase 1.25e-10 7.34e-05 NA NA
5. P Q051T8 N-(5'-phosphoribosyl)anthranilate isomerase 1.20e-08 1.01e-15 NA NA
5. P O74025 Triosephosphate isomerase 8.09e-08 1.95e-05 NA NA
5. P Q31FF5 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.06e-08 2.59e-03 NA NA
5. P A5VKA1 Thiamine-phosphate synthase 3.90e-08 2.39e-05 NA NA
5. P Q5M0M2 3-dehydroquinate dehydratase 1.40e-05 2.42e-03 NA NA
5. P Q602R3 Thiamine-phosphate synthase 6.15e-09 6.93e-05 NA NA
5. P O28965 Triosephosphate isomerase 1.02e-07 1.52e-04 NA NA
5. P Q13EQ3 N-(5'-phosphoribosyl)anthranilate isomerase 1.45e-10 1.07e-19 NA NA
5. P A8A533 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.87e-06 1.73e-04 NA NA
5. P Q5L2C0 Thiazole synthase 2.28e-09 2.55e-03 NA NA
5. P Q1C7P3 Tryptophan synthase alpha chain 7.20e-05 3.64e-04 NA NA
5. P B3QNM2 Thiamine-phosphate synthase 6.80e-09 1.03e-04 NA NA
5. P Q28LB1 Tryptophan synthase alpha chain 3.22e-05 4.44e-04 NA NA
5. P B3GZ03 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.11e-06 5.47e-03 NA NA
5. P Q46LX8 Tryptophan synthase alpha chain 2.20e-07 4.42e-02 NA NA
5. P B8FVH4 N-(5'-phosphoribosyl)anthranilate isomerase 3.44e-09 2.03e-05 NA NA
5. P Q7P1R3 Thiamine-phosphate synthase 7.91e-06 3.13e-05 NA NA
5. P A5F4E2 Thiazole synthase 1.47e-04 7.15e-03 NA NA
5. P B8ZRC1 Tryptophan synthase alpha chain 3.75e-08 1.16e-02 NA NA
5. P A5IU73 Heptaprenylglyceryl phosphate synthase 3.88e-08 2.32e-05 NA NA
5. P A9N831 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.63e-06 3.44e-03 NA NA
5. P P56155 Orotidine 5'-phosphate decarboxylase 5.27e-08 1.21e-02 NA NA
5. P Q5XQP9 N-(5'-phosphoribosyl)anthranilate isomerase 1.61e-08 6.53e-15 NA NA
5. P B1LH07 Orotidine 5'-phosphate decarboxylase 5.74e-08 3.43e-02 NA NA
5. P C4XGU0 Pyridoxine 5'-phosphate synthase 6.61e-10 7.72e-04 NA NA
5. P Q9S2N4 Thiazole synthase 1.85e-05 1.63e-02 NA NA
5. P Q72KL8 Thiamine-phosphate synthase 8.12e-09 7.55e-05 NA NA
5. P B8DZP8 Tryptophan synthase alpha chain 3.98e-07 6.30e-04 NA NA
5. P B7H3K6 Orotidine 5'-phosphate decarboxylase 2.44e-08 4.02e-04 NA NA
5. P Q9PH84 Pyridoxine 5'-phosphate synthase 2.42e-09 1.86e-05 NA NA
5. P B0KUJ6 Orotidine 5'-phosphate decarboxylase 4.35e-08 5.66e-03 NA NA
5. P A7N9D1 Tryptophan synthase alpha chain 3.56e-05 4.93e-02 NA NA
5. P A5IUN7 Thiamine-phosphate synthase 4.36e-08 6.66e-07 NA NA
5. P Q6G7L9 Thiamine-phosphate synthase 4.80e-08 1.01e-06 NA NA
5. P A6UEI0 N-(5'-phosphoribosyl)anthranilate isomerase 3.20e-10 6.81e-11 NA NA
5. P B0K2U0 N-(5'-phosphoribosyl)anthranilate isomerase 1.06e-09 9.45e-19 NA NA
5. P Q0SX89 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.01e-09 7.36e-08 NA NA
5. P A4FXH5 N-(5'-phosphoribosyl)anthranilate isomerase 4.95e-11 1.41e-21 NA NA
5. P A7MJ80 Thiamine-phosphate synthase 2.71e-09 2.92e-03 NA NA
5. P B5F7J7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.91e-06 1.35e-02 NA NA
5. P C1DQD4 N-(5'-phosphoribosyl)anthranilate isomerase 7.82e-10 4.72e-21 NA NA
5. P Q3SRB0 Pyridoxine 5'-phosphate synthase 8.62e-10 3.73e-06 NA NA
5. P B0CJK9 N-(5'-phosphoribosyl)anthranilate isomerase 5.54e-10 2.33e-18 NA NA
5. P B2U1W1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.92e-06 1.69e-04 NA NA
5. P A0LTT7 Tryptophan synthase alpha chain 4.76e-08 2.78e-03 NA NA
5. P A4VKF4 N-(5'-phosphoribosyl)anthranilate isomerase 4.71e-10 9.77e-18 NA NA
5. P P0A794 Pyridoxine 5'-phosphate synthase 2.22e-10 9.78e-11 NA NA
5. P Q82WI3 N-(5'-phosphoribosyl)anthranilate isomerase 1.09e-09 2.80e-15 NA NA
5. P Q3K0D3 3-dehydroquinate dehydratase 1.73e-05 2.87e-03 NA NA
5. P Q3Z247 3-dehydroquinate dehydratase 4.04e-09 3.43e-02 NA NA
5. P Q0T9J7 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.79e-10 1.77e-07 NA NA
5. P Q56320 N-(5'-phosphoribosyl)anthranilate isomerase 2.88e-09 5.83e-20 NA NA
5. P P58642 Orotidine 5'-phosphate decarboxylase 2.62e-07 1.43e-02 NA NA
5. P A9MNY8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.69e-06 2.16e-02 NA NA
5. P C6DK13 Orotidine 5'-phosphate decarboxylase 3.03e-08 4.86e-02 NA NA
5. P A0RB63 N-(5'-phosphoribosyl)anthranilate isomerase 2.69e-09 1.59e-14 NA NA
5. P Q9JZW6 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.14e-08 1.49e-02 NA NA
5. P A4IM36 Orotidine 5'-phosphate decarboxylase 7.45e-08 1.94e-02 NA NA
5. P B0B7P4 N-(5'-phosphoribosyl)anthranilate isomerase 3.02e-08 4.98e-15 NA NA
5. P Q3Z989 3-dehydroquinate dehydratase 1.65e-07 1.30e-02 NA NA
5. P B3CN77 Orotidine 5'-phosphate decarboxylase 7.75e-09 6.58e-04 NA NA
5. P B9J7M8 Orotidine 5'-phosphate decarboxylase 4.11e-09 1.52e-03 NA NA
5. P B6EJA2 Tryptophan synthase alpha chain 6.13e-05 3.90e-03 NA NA
5. P Q46906 Uncharacterized protein YgcP 4.03e-09 6.14e-06 NA NA
5. P A3DN81 Geranylgeranylglyceryl phosphate synthase 1.18e-07 3.62e-03 NA NA
5. P B6YWA8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.57e-07 8.94e-03 NA NA
5. P Q07PW9 Thiazole synthase 3.39e-05 8.87e-03 NA NA
5. P Q4FND0 Tryptophan synthase alpha chain 4.28e-08 8.06e-05 NA NA
5. P P0A762 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.22e-06 1.69e-04 NA NA
5. P Q6D4T9 Tryptophan synthase alpha chain 3.82e-07 3.78e-02 NA NA
5. P D2QS27 Geranylgeranylglyceryl phosphate synthase 4.09e-08 9.30e-04 NA NA
5. P Q8DVF2 Tryptophan synthase alpha chain 1.95e-05 1.75e-02 NA NA
5. P Q2Y5Q6 Thiamine-phosphate synthase 2.68e-09 2.26e-03 NA NA
5. P B1ZNA6 Pyridoxine 5'-phosphate synthase 8.40e-10 9.75e-09 NA NA
5. P Q8U1U1 Orotidine 5'-phosphate decarboxylase 2.52e-09 1.11e-07 NA NA
5. P B5QVU3 3-dehydroquinate dehydratase 4.28e-09 1.81e-03 NA NA
5. P Q73DB1 Thiazole synthase 2.01e-09 1.65e-02 NA NA
5. P Q723Y9 Thiamine-phosphate synthase 2.00e-08 9.62e-05 NA NA
5. P Q9KCY6 Thiazole synthase 2.32e-06 1.84e-02 NA NA
5. P Q57LD3 Pyridoxine 5'-phosphate synthase 2.14e-10 4.10e-11 NA NA
5. P P34816 Tryptophan synthase alpha chain 9.84e-04 7.90e-03 NA NA
5. P B8DHB3 N-(5'-phosphoribosyl)anthranilate isomerase 1.29e-08 1.72e-14 NA NA
5. P Q8UDU5 Pyridoxine 5'-phosphate synthase 4.48e-06 2.16e-06 NA NA
5. P Q92EG6 3-dehydroquinate dehydratase 5.36e-09 1.76e-02 NA NA
5. P A2RF79 3-dehydroquinate dehydratase 7.11e-08 2.36e-02 NA NA
5. P C1C7X8 3-dehydroquinate dehydratase 2.02e-05 2.57e-03 NA NA
5. P Q8D8B1 Tryptophan synthase alpha chain 4.94e-05 5.38e-03 NA NA
5. P Q11I86 Pyridoxine 5'-phosphate synthase 1.48e-08 6.39e-07 NA NA
5. P C3K568 Tryptophan synthase alpha chain 9.43e-04 3.94e-03 NA NA
5. P Q3AJ26 Pyridoxine 5'-phosphate synthase 7.50e-10 8.68e-05 NA NA
5. P B7NKT4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.02e-06 1.54e-04 NA NA
5. P P65517 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.43e-08 2.88e-04 NA NA
5. P Q5WX33 N-(5'-phosphoribosyl)anthranilate isomerase 9.06e-10 9.87e-17 NA NA
5. P Q8Z322 Thiazole synthase 5.50e-05 2.23e-02 NA NA
5. P A8M4E6 Thiamine-phosphate synthase 4.55e-08 3.18e-03 NA NA
5. P B7LUL2 Thiazole synthase 4.18e-05 1.02e-02 NA NA
5. P A7ZA58 Thiamine-phosphate synthase 3.07e-09 9.13e-04 NA NA
5. P P0DC69 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.11e-08 1.10e-06 NA NA
5. P A9L3J3 Thiazole synthase 6.34e-06 2.75e-02 NA NA
5. P Q2YU68 Heptaprenylglyceryl phosphate synthase 2.78e-08 7.56e-06 NA NA
5. P B7J4S8 Tryptophan synthase alpha chain 5.03e-08 1.24e-02 NA NA
5. P Q5F5C4 Thiazole synthase 1.27e-05 7.93e-04 NA NA
5. P B9L7B6 Thiazole synthase 4.80e-05 1.73e-03 NA NA
5. P Q8KX32 Tryptophan synthase alpha chain 4.52e-08 2.83e-04 NA NA
5. P P05194 3-dehydroquinate dehydratase 4.01e-09 1.65e-02 NA NA
5. P P50382 Tryptophan synthase alpha chain 1.30e-08 1.50e-11 NA NA
5. P Q9K0V9 Pyridoxine 5'-phosphate synthase 3.38e-10 9.67e-06 NA NA
5. P Q5V212 N-(5'-phosphoribosyl)anthranilate isomerase 4.52e-11 3.02e-17 NA NA
5. P Q7MAE8 Orotidine 5'-phosphate decarboxylase 6.49e-08 8.80e-03 NA NA
5. P Q5WJ32 Heptaprenylglyceryl phosphate synthase 1.96e-08 9.36e-05 NA NA
5. P A5IBR7 Orotidine 5'-phosphate decarboxylase 1.30e-07 1.97e-03 NA NA
5. P B2TQ13 Thiamine-phosphate synthase 1.08e-09 4.12e-05 NA NA
5. P Q1JCG7 3-dehydroquinate dehydratase 6.82e-08 2.36e-02 NA NA
5. P A7X235 N-(5'-phosphoribosyl)anthranilate isomerase 1.64e-11 1.12e-19 NA NA
5. P A9MHE0 Thiazole synthase 5.56e-05 2.40e-02 NA NA
5. P B5YZP0 Tryptophan synthase alpha chain 2.78e-03 3.08e-03 NA NA
5. P Q5HWH3 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.22e-08 4.18e-02 NA NA
5. P Q4LA35 3-methyl-2-oxobutanoate hydroxymethyltransferase 7.25e-06 3.66e-02 NA NA
5. P B7HT70 Thiamine-phosphate synthase 3.11e-06 9.63e-04 NA NA
5. P A7ZSB6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.85e-06 4.17e-04 NA NA
5. P P44988 Probable 3-keto-L-gulonate-6-phosphate decarboxylase 4.66e-09 1.20e-05 NA NA
5. P B7N529 3-dehydroquinate dehydratase 3.74e-09 4.12e-02 NA NA
5. P Q21XM2 Pyridoxine 5'-phosphate synthase 3.27e-09 3.38e-09 NA NA
5. P Q2SJD2 N-(5'-phosphoribosyl)anthranilate isomerase 7.17e-10 6.63e-13 NA NA
5. P Q5N324 Tryptophan synthase alpha chain 8.74e-08 6.31e-03 NA NA
5. P Q5WGS2 N-(5'-phosphoribosyl)anthranilate isomerase 4.53e-12 1.75e-14 NA NA
5. P P49570 Thiazole synthase 7.28e-06 4.67e-02 NA NA
5. P B4SEN7 Tryptophan synthase alpha chain 1.81e-05 7.13e-04 NA NA
5. P O13504 N-(5'-phosphoribosyl)anthranilate isomerase 7.14e-09 6.60e-18 NA NA
5. P Q9RY28 N-(5'-phosphoribosyl)anthranilate isomerase 7.01e-09 5.05e-16 NA NA
5. P Q04IY8 N-(5'-phosphoribosyl)anthranilate isomerase 9.26e-10 2.22e-15 NA NA
5. P Q98AZ6 Thiazole synthase 9.29e-06 4.47e-03 NA NA
5. P B8F667 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.05e-06 1.24e-04 NA NA
5. P A7NS83 N-(5'-phosphoribosyl)anthranilate isomerase 3.07e-09 3.86e-20 NA NA
5. P Q0HUX4 Thiazole synthase 4.36e-06 1.34e-02 NA NA
5. P Q8PT98 N-(5'-phosphoribosyl)anthranilate isomerase 1 8.15e-12 3.09e-15 NA NA
5. P B9J2L5 Thiamine-phosphate synthase 3.30e-06 9.63e-04 NA NA
5. P Q13EQ1 Tryptophan synthase alpha chain 1.30e-07 1.00e-02 NA NA
5. P Q81Z95 Thiamine-phosphate synthase 2.58e-06 2.00e-03 NA NA
5. P Q8EEI4 Orotidine 5'-phosphate decarboxylase 1.10e-07 3.21e-03 NA NA
5. P Q97P33 Tryptophan synthase alpha chain 5.82e-08 8.18e-06 NA NA
5. P Q7WH63 Pyridoxine 5'-phosphate synthase 4.09e-10 3.62e-06 NA NA
5. P Q16AJ0 Pyridoxine 5'-phosphate synthase 3.18e-10 3.50e-12 NA NA
5. P Q02V45 Tryptophan synthase alpha chain 2.97e-05 2.27e-04 NA NA
5. P C3JZS5 N-(5'-phosphoribosyl)anthranilate isomerase 6.72e-10 3.86e-21 NA NA
5. P Q8PJ26 N-(5'-phosphoribosyl)anthranilate isomerase 1.16e-09 1.15e-15 NA NA
5. P Q87LP2 Pyridoxine 5'-phosphate synthase 1.67e-10 3.14e-10 NA NA
5. P Q4QJV1 Orotidine 5'-phosphate decarboxylase 5.84e-08 2.85e-03 NA NA
5. P Q604P4 Tryptophan synthase alpha chain 4.17e-08 1.84e-05 NA NA
5. P Q8Y372 Thiazole synthase 5.86e-05 5.85e-05 NA NA
5. P A2CB80 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.98e-06 5.20e-03 NA NA
5. P A3Q1U4 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.09e-06 2.90e-02 NA NA
5. P Q0VPI8 N-(5'-phosphoribosyl)anthranilate isomerase 8.99e-10 3.73e-18 NA NA
5. P P71350 Thiamine-phosphate synthase 3.44e-08 1.39e-05 NA NA
5. P Q1B6P5 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.08e-06 2.90e-02 NA NA
5. P P9WG74 Thiamine-phosphate synthase 1.99e-08 3.11e-06 NA NA
5. P A1W0M1 Pyridoxine 5'-phosphate synthase 5.99e-09 1.21e-05 NA NA
5. P B7IM75 N-(5'-phosphoribosyl)anthranilate isomerase 1.58e-09 4.39e-14 NA NA
5. P A8M4E3 Thiazole synthase 7.40e-05 5.66e-03 NA NA
5. P B5EIT8 Orotidine 5'-phosphate decarboxylase 2.14e-08 1.79e-02 NA NA
5. P Q9S3U4 N-(5'-phosphoribosyl)anthranilate isomerase 8.18e-11 4.10e-19 NA NA
5. P B0UL68 Orotidine 5'-phosphate decarboxylase 2.21e-08 4.47e-03 NA NA
5. P A4TS25 Thiamine-phosphate synthase 1.84e-09 1.20e-02 NA NA
5. P B5FJ82 3-dehydroquinate dehydratase 4.68e-09 1.81e-03 NA NA
5. P Q8TXZ9 N-(5'-phosphoribosyl)anthranilate isomerase 3.74e-11 2.31e-15 NA NA
5. P Q9RN77 3-dehydroquinate dehydratase 5.18e-09 1.81e-03 NA NA
5. P B7UR89 Orotidine 5'-phosphate decarboxylase 5.58e-08 4.93e-02 NA NA
5. P Q2G157 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.46e-08 4.32e-05 NA NA
5. P B1JKS3 Tryptophan synthase alpha chain 3.56e-03 1.74e-04 NA NA
5. P Q5PNM0 Tryptophan synthase alpha chain 2.99e-03 1.86e-04 NA NA
5. P A9N909 3-dehydroquinate dehydratase 6.03e-09 4.60e-04 NA NA
5. P A3PMM5 Tryptophan synthase alpha chain 1.45e-07 3.10e-03 NA NA
5. P Q8FHW0 Tryptophan synthase alpha chain 5.12e-07 3.02e-03 NA NA
5. P Q60180 Tryptophan synthase alpha chain 5.22e-04 1.30e-02 NA NA
5. P Q5X5E0 Orotidine 5'-phosphate decarboxylase 1.09e-07 1.74e-03 NA NA
5. P A3PGF5 Pyridoxine 5'-phosphate synthase 1.47e-06 1.56e-10 NA NA
5. P A5FPL3 Tryptophan synthase alpha chain 7.51e-08 3.84e-06 NA NA
5. P A5G5A2 Orotidine 5'-phosphate decarboxylase 9.05e-09 8.29e-04 NA NA
5. P A3NM66 Tryptophan synthase alpha chain 1.24e-07 1.30e-03 NA NA
5. P Q2YS94 3-hexulose-6-phosphate synthase 2.96e-12 8.10e-07 NA NA
5. P Q04JX0 3-dehydroquinate dehydratase 2.04e-05 2.57e-03 NA NA
5. P A5IW24 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.49e-08 1.54e-03 NA NA
5. P B8F472 Orotidine 5'-phosphate decarboxylase 5.91e-08 5.46e-04 NA NA
5. P Q9JXF7 Thiamine-phosphate synthase 1.23e-09 1.42e-04 NA NA
5. P A0LTD0 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.82e-06 4.90e-02 NA NA
5. P B2UV41 Tryptophan synthase alpha chain 1.89e-06 2.48e-05 NA NA
5. P A5G7P4 Thiazole synthase 1.13e-09 2.54e-02 NA NA
5. P A5VNE4 Thiazole synthase 2.78e-05 7.13e-04 NA NA
5. P Q71Z39 N-(5'-phosphoribosyl)anthranilate isomerase 9.05e-09 3.11e-14 NA NA
5. P B1J1Y7 Thiamine-phosphate synthase 6.78e-06 4.80e-05 NA NA
5. P Q6HLU5 N-(5'-phosphoribosyl)anthranilate isomerase 2.11e-09 2.58e-14 NA NA
5. P B6I2A1 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.26e-10 1.77e-07 NA NA
5. P C3K6Z0 Pyridoxine 5'-phosphate synthase 2.69e-10 3.82e-05 NA NA
5. P Q47R19 Orotidine 5'-phosphate decarboxylase 1.53e-09 8.10e-03 NA NA
5. P B8GPL4 Pyridoxine 5'-phosphate synthase 1.54e-10 6.14e-06 NA NA
5. P A5HYZ3 Thiamine-phosphate synthase 2.27e-09 8.06e-05 NA NA
5. P Q9KPB5 Pyridoxine 5'-phosphate synthase 1.27e-10 1.66e-08 NA NA
5. P A7Z2G6 3-dehydroquinate dehydratase 1.41e-09 1.52e-03 NA NA
5. P O67417 Pyridoxine 5'-phosphate synthase 2.42e-09 1.97e-07 NA NA
5. P A7X6X7 3-methyl-2-oxobutanoate hydroxymethyltransferase 8.92e-06 2.36e-03 NA NA
5. P P0A956 KHG/KDPG aldolase 8.70e-09 4.15e-02 NA NA
5. P B6J7I2 Tryptophan synthase alpha chain 3.10e-07 2.79e-02 NA NA
5. P B6JP91 Pyridoxine 5'-phosphate synthase 3.28e-09 2.70e-02 NA NA
5. P Q57GJ6 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.28e-09 2.27e-08 NA NA
5. P B1LH32 Tryptophan synthase alpha chain 2.59e-03 1.81e-02 NA NA
5. P A8AXZ6 3-dehydroquinate dehydratase 1.50e-05 3.71e-04 NA NA
5. P Q92B80 N-(5'-phosphoribosyl)anthranilate isomerase 6.17e-09 7.58e-15 NA NA
5. P B8HWP9 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.84e-06 1.37e-02 NA NA
5. P A5W6Y0 N-(5'-phosphoribosyl)anthranilate isomerase 7.76e-10 5.87e-18 NA NA
5. P B1XXP1 Orotidine 5'-phosphate decarboxylase 2.96e-07 1.11e-02 NA NA
5. P A4X9N0 Tryptophan synthase alpha chain 2.95e-08 1.44e-02 NA NA
5. P Q8TXM0 Geranylgeranylglyceryl phosphate synthase 1.16e-07 2.66e-03 NA NA
5. P Q4JVZ1 Thiamine-phosphate synthase 6.76e-08 1.75e-05 NA NA
5. P A1WY05 Tryptophan synthase alpha chain 3.50e-08 3.34e-05 NA NA
5. P Q5N1T9 Orotidine 5'-phosphate decarboxylase 1.84e-08 1.59e-02 NA NA
5. P Q01NI9 Tryptophan synthase alpha chain 1.29e-07 1.19e-03 NA NA
5. P A7H2Z6 Thiazole synthase 4.06e-07 3.66e-02 NA NA
5. P P30300 Glycerol uptake operon antiterminator regulatory protein 4.22e-09 5.13e-05 NA NA
5. P A1WUI3 Orotidine 5'-phosphate decarboxylase 2.53e-08 1.28e-02 NA NA
5. P A6W6A2 Thiamine-phosphate synthase 8.60e-09 2.68e-05 NA NA
5. P Q5ZVL5 Orotidine 5'-phosphate decarboxylase 1.05e-07 1.47e-03 NA NA
5. P Q2N9N0 Tryptophan synthase alpha chain 5.61e-08 1.03e-04 NA NA
5. P Q3V814 Pyridoxine 5'-phosphate synthase 1.02e-06 6.58e-06 NA NA
5. P Q65US7 Thiamine-phosphate synthase 5.49e-07 4.11e-03 NA NA
5. P A9HI56 Thiazole synthase 8.56e-06 7.39e-04 NA NA
5. P A6V2W1 N-(5'-phosphoribosyl)anthranilate isomerase 4.03e-10 3.20e-21 NA NA
5. P Q02HS5 Pyridoxine 5'-phosphate synthase 2.59e-10 1.25e-07 NA NA
5. P B2SHJ1 Orotidine 5'-phosphate decarboxylase 6.02e-10 4.21e-03 NA NA
5. P Q5X5Q3 N-(5'-phosphoribosyl)anthranilate isomerase 5.68e-10 6.04e-18 NA NA
5. P Q3ZZN2 3-dehydroquinate dehydratase 8.66e-08 1.65e-04 NA NA
5. P A4G4G1 N-(5'-phosphoribosyl)anthranilate isomerase 3.42e-09 1.53e-23 NA NA
5. P Q10W95 Tryptophan synthase alpha chain 4.72e-08 7.33e-03 NA NA
5. P B0C977 Pyridoxine 5'-phosphate synthase 9.84e-10 8.02e-06 NA NA
5. P Q9K0C6 N-(5'-phosphoribosyl)anthranilate isomerase 2.01e-09 4.27e-14 NA NA
5. P Q32AG6 Thiamine-phosphate synthase 1.99e-09 3.94e-03 NA NA
5. P B4SCL0 Thiazole synthase 3.81e-05 1.39e-02 NA NA
5. P Q46IC6 Thiazole synthase 1.14e-05 2.66e-02 NA NA
5. P A8FKD6 N-(5'-phosphoribosyl)anthranilate isomerase 2.69e-09 8.00e-15 NA NA
5. P Q9KCY8 Thiamine-phosphate synthase 7.16e-10 8.17e-03 NA NA
5. P Q63FR5 Thiazole synthase 2.70e-09 5.12e-03 NA NA
5. P B1XBZ3 Thiazole synthase 5.22e-05 5.25e-03 NA NA
5. P B2IQJ5 3-dehydroquinate dehydratase 2.13e-05 2.57e-03 NA NA
5. P B7LA84 Thiazole synthase 5.89e-05 7.64e-03 NA NA
5. P Q0W628 N-(5'-phosphoribosyl)anthranilate isomerase 2.36e-12 1.04e-23 NA NA
5. P Q03LH6 3-dehydroquinate dehydratase 1.56e-05 9.46e-04 NA NA
5. P A7FNH7 Thiamine-phosphate synthase 1.18e-09 8.17e-03 NA NA
5. P A2C3H1 Pyridoxine 5'-phosphate synthase 6.28e-10 1.55e-05 NA NA
5. P B1XQ35 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.82e-06 5.56e-03 NA NA
5. P Q8UAS8 Thiamine-phosphate synthase 9.45e-09 3.07e-04 NA NA
5. P Q2KYM1 N-(5'-phosphoribosyl)anthranilate isomerase 6.02e-11 1.48e-13 NA NA
5. P A8Z2S0 Heptaprenylglyceryl phosphate synthase 3.89e-08 1.09e-04 NA NA
5. P Q9CC53 Tryptophan synthase alpha chain 5.86e-08 1.16e-02 NA NA
5. P A9KE95 Tryptophan synthase alpha chain 4.87e-07 1.82e-02 NA NA
5. P C4ZR73 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.69e-10 1.77e-07 NA NA
5. P A8G6D9 Orotidine 5'-phosphate decarboxylase 1.58e-08 5.04e-04 NA NA
5. P B3CLF3 Pyridoxine 5'-phosphate synthase 8.88e-09 1.77e-03 NA NA
5. P Q8PER4 Orotidine 5'-phosphate decarboxylase 5.02e-10 2.44e-03 NA NA
5. P Q186F8 Thiamine-phosphate synthase 1.47e-08 2.31e-04 NA NA
5. P Q96YZ9 Triosephosphate isomerase 2.26e-08 1.93e-07 NA NA
5. P Q32GE2 3-dehydroquinate dehydratase 4.11e-09 3.52e-02 NA NA
5. P A1UZ42 Tryptophan synthase alpha chain 1.19e-07 1.30e-03 NA NA
5. P A6UPE6 Thiamine-phosphate synthase 1.87e-09 1.66e-04 NA NA
5. P Q7MLX2 Orotidine 5'-phosphate decarboxylase 1.48e-07 2.17e-04 NA NA
5. P O68283 2-dehydro-3-deoxy-phosphogluconate aldolase 8.11e-09 3.71e-03 NA NA
5. P B7JVF9 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.46e-06 4.22e-02 NA NA
5. P C6DHS2 Thiazole synthase 5.56e-05 1.65e-02 NA NA
5. P Q47R33 Thiamine-phosphate synthase 1.24e-08 3.62e-06 NA NA
5. P Q28LA8 N-(5'-phosphoribosyl)anthranilate isomerase 3.04e-10 5.62e-18 NA NA
5. P A3N0A0 Orotidine 5'-phosphate decarboxylase 5.75e-08 1.45e-04 NA NA
5. P B7ML76 Tryptophan synthase alpha chain 4.05e-03 4.07e-03 NA NA
5. P Q6G9I8 N-(5'-phosphoribosyl)anthranilate isomerase 3.44e-11 1.12e-19 NA NA
5. P P74435 N-(5'-phosphoribosyl)anthranilate isomerase 1.44e-09 4.19e-18 NA NA
5. P C0QFH9 3-methyl-2-oxobutanoate hydroxymethyltransferase 5.02e-06 3.41e-03 NA NA
5. P A6UFC6 Orotidine 5'-phosphate decarboxylase 2.05e-09 1.52e-03 NA NA
5. P Q8ELF4 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.97e-06 1.28e-02 NA NA
5. P Q3Z108 Tryptophan synthase alpha chain 2.81e-03 1.90e-03 NA NA
5. P A4YJQ1 Orotidine 5'-phosphate decarboxylase 4.04e-09 9.27e-05 NA NA
5. P Q04IZ0 Tryptophan synthase alpha chain 6.30e-08 1.46e-05 NA NA
5. P O33772 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.73e-07 3.49e-02 NA NA
5. P Q8RG83 Orotidine 5'-phosphate decarboxylase 2.07e-08 1.59e-02 NA NA
5. P A0AJ81 N-(5'-phosphoribosyl)anthranilate isomerase 5.20e-09 8.96e-14 NA NA
5. P Q1ID82 Orotidine 5'-phosphate decarboxylase 4.75e-08 4.40e-03 NA NA
5. P A3PTW9 Thiamine-phosphate synthase 5.64e-09 3.77e-06 NA NA
5. P A5W9G9 Thiamine-phosphate synthase 5.85e-06 6.68e-05 NA NA
5. P B1LSQ8 Tryptophan synthase alpha chain 9.43e-08 2.18e-03 NA NA
5. P Q5YYN3 Tryptophan synthase alpha chain 6.85e-08 4.46e-02 NA NA
5. P Q3V870 Pyridoxine 5'-phosphate synthase 2.08e-10 3.05e-06 NA NA
5. P C0M8T8 3-dehydroquinate dehydratase 1.81e-05 4.97e-02 NA NA
5. P Q1I9K4 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 1.51e-05 4.97e-02 NA NA
5. P Q8FP52 Thiazole synthase 7.99e-05 1.02e-02 NA NA
5. P A8MCN3 Triosephosphate isomerase 2.62e-08 1.37e-04 NA NA
5. P Q9ZBL2 Thiazole synthase 2.04e-05 3.46e-02 NA NA
5. P Q3SWL7 N-(5'-phosphoribosyl)anthranilate isomerase 2.00e-10 9.70e-14 NA NA
5. P A6SVJ9 Orotidine 5'-phosphate decarboxylase 2.70e-07 3.87e-02 NA NA
5. P B2HYJ0 Tryptophan synthase alpha chain 1.94e-08 1.72e-02 NA NA
5. P Q5L3C1 Heptaprenylglyceryl phosphate synthase 3.79e-08 4.82e-03 NA NA
5. P Q5LH12 Orotidine 5'-phosphate decarboxylase 1.13e-07 3.24e-04 NA NA
5. P B3GX47 Tryptophan synthase alpha chain 2.23e-04 1.21e-03 NA NA
5. P B4TCT2 Thiamine-phosphate synthase 1.83e-09 2.51e-03 NA NA
5. P B4TUS2 3-dehydroquinate dehydratase 4.32e-09 1.81e-03 NA NA
5. P A6W097 Orotidine 5'-phosphate decarboxylase 5.76e-08 1.47e-03 NA NA
5. P B7LLX8 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 9.76e-10 7.86e-08 NA NA
5. P A6UX98 Tryptophan synthase alpha chain 3.18e-05 5.22e-04 NA NA
5. P A5FRZ6 3-dehydroquinate dehydratase 9.20e-08 1.65e-04 NA NA
5. P Q8Z7E0 Tryptophan synthase alpha chain 4.59e-07 5.71e-04 NA NA
5. P Q9UZ35 Orotidine 5'-phosphate decarboxylase 4.14e-09 6.06e-07 NA NA
5. P Q9HSB4 3-dehydroquinate dehydratase 4.60e-04 1.75e-02 NA NA
5. P Q6HN84 Thiazole synthase 1.58e-06 5.56e-03 NA NA
5. P B8G1S3 3-methyl-2-oxobutanoate hydroxymethyltransferase 5.24e-06 2.30e-02 NA NA
5. P B0R621 N-(5'-phosphoribosyl)anthranilate isomerase 4.19e-11 6.15e-12 NA NA
5. P B6EGV5 Thiazole synthase 5.47e-05 3.60e-02 NA NA
5. P B0VD17 Orotidine 5'-phosphate decarboxylase 2.39e-08 4.02e-04 NA NA
5. P Q7VLR5 Orotidine 5'-phosphate decarboxylase 5.84e-08 1.93e-04 NA NA
5. P Q5X4Z5 Thiazole synthase 3.55e-05 1.17e-03 NA NA
5. P Q3K3Z4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.35e-08 2.21e-04 NA NA
5. P Q3V7N3 Pyridoxine 5'-phosphate synthase 1.59e-10 2.00e-10 NA NA
5. P Q0B002 Tryptophan synthase alpha chain 1.79e-05 8.30e-03 NA NA
5. P P43759 Tryptophan synthase alpha chain 3.71e-07 3.16e-03 NA NA
5. P B8D7H4 Tryptophan synthase alpha chain 3.66e-05 2.65e-04 NA NA
5. P C0MGL4 3-dehydroquinate dehydratase 1.76e-05 4.12e-02 NA NA
5. P B5F565 Orotidine 5'-phosphate decarboxylase 3.50e-08 2.21e-02 NA NA
5. P Q466J5 Thiamine-phosphate synthase 3.83e-10 2.11e-04 NA NA
5. P A5GES5 N-(5'-phosphoribosyl)anthranilate isomerase 1.78e-09 1.08e-20 NA NA
5. P Q30ZQ6 Pyridoxine 5'-phosphate synthase 8.28e-10 1.74e-09 NA NA
5. P P07691 Orotidine 5'-phosphate decarboxylase 4.91e-08 1.15e-02 NA NA
5. P Q1JHB0 Orotidine 5'-phosphate decarboxylase 2.65e-08 5.52e-03 NA NA
5. P Q4KKP5 Tryptophan synthase alpha chain 9.41e-04 1.57e-03 NA NA
5. P Q9HLB6 Triosephosphate isomerase 3.27e-08 7.52e-04 NA NA
5. P Q51843 Pyridoxine 5'-phosphate synthase 3.15e-09 1.30e-07 NA NA
5. P C0R576 Pyridoxine 5'-phosphate synthase 9.14e-09 3.05e-06 NA NA
5. P B3GX82 Thiamine-phosphate synthase 7.86e-05 5.61e-03 NA NA
5. P Q3KHL6 Pyridoxine 5'-phosphate synthase 2.91e-10 2.95e-02 NA NA
5. P A4IVS5 Tryptophan synthase alpha chain 1.93e-07 4.09e-02 NA NA
5. P P0A958 KHG/KDPG aldolase 8.66e-09 4.15e-02 NA NA
5. P B1WY64 Pyridoxine 5'-phosphate synthase 1.40e-09 3.89e-05 NA NA
5. P Q5YZ95 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.87e-06 1.71e-02 NA NA
5. P Q3AVH3 Pyridoxine 5'-phosphate synthase 7.98e-10 1.42e-05 NA NA
5. P B4TT28 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 8.28e-10 2.27e-08 NA NA
5. P Q8ZK87 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.33e-09 2.27e-08 NA NA
5. P Q2FYR3 Tryptophan synthase alpha chain 3.20e-08 5.40e-06 NA NA
5. P Q8KFJ5 Pyridoxine 5'-phosphate synthase 1.94e-09 2.98e-05 NA NA
5. P Q6NEB5 Tryptophan synthase alpha chain 2.41e-07 8.14e-04 NA NA
5. P C0RFZ5 N-(5'-phosphoribosyl)anthranilate isomerase 5.80e-10 2.33e-18 NA NA
5. P A7I6L7 Geranylgeranylglyceryl phosphate synthase 5.98e-08 2.37e-05 NA NA
5. P Q7M9F6 Thiazole synthase 9.76e-06 1.06e-02 NA NA
5. P Q8ES84 Heptaprenylglyceryl phosphate synthase 3.31e-08 1.32e-04 NA NA
5. P Q74CG8 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.20e-06 1.81e-02 NA NA
5. P Q9HFW8 N-(5'-phosphoribosyl)anthranilate isomerase 2.44e-09 2.04e-18 NA NA
5. P B5XKU3 3-dehydroquinate dehydratase 7.29e-08 2.36e-02 NA NA
5. P Q63EC6 Tryptophan synthase alpha chain 2.56e-08 1.47e-05 NA NA
5. P Q8Y6C8 Heptaprenylglyceryl phosphate synthase 6.72e-08 4.21e-07 NA NA
5. P Q63EC8 N-(5'-phosphoribosyl)anthranilate isomerase 1.98e-09 3.84e-15 NA NA
5. P Q482F9 Orotidine 5'-phosphate decarboxylase 7.30e-08 1.09e-02 NA NA
5. P A4IN28 Thiamine-phosphate synthase 2.43e-09 1.42e-05 NA NA
5. P Q3AQC1 N-(5'-phosphoribosyl)anthranilate isomerase 1.56e-10 7.98e-17 NA NA
5. P B7NRS3 Thiazole synthase 7.34e-06 1.26e-02 NA NA
5. P Q1CT27 Thiamine-phosphate synthase 1.04e-08 5.95e-03 NA NA
5. P C3MB98 N-(5'-phosphoribosyl)anthranilate isomerase 6.05e-10 6.26e-11 NA NA
5. P Q7UYK5 Pyridoxine 5'-phosphate synthase 1.25e-10 2.20e-10 NA NA
5. P A9VWE9 Tryptophan synthase alpha chain 1.18e-07 1.13e-02 NA NA
5. P A7I8M6 3-dehydroquinate dehydratase 9.27e-08 1.68e-08 NA NA
5. P B5ZV69 N-(5'-phosphoribosyl)anthranilate isomerase 7.86e-10 1.69e-16 NA NA
5. P Q0W6K5 Geranylgeranylglyceryl phosphate synthase 8.70e-08 2.79e-06 NA NA
5. P Q254S9 N-(5'-phosphoribosyl)anthranilate isomerase 1.63e-08 8.11e-16 NA NA
5. P Q3AC06 Orotidine 5'-phosphate decarboxylase 1.15e-08 1.61e-03 NA NA
5. P Q31U06 Thiazole synthase 5.39e-05 7.77e-03 NA NA
5. P Q8PEG8 Pyridoxine 5'-phosphate synthase 5.51e-09 1.20e-08 NA NA
5. P Q8U0A7 3-dehydroquinate dehydratase 1.09e-06 2.02e-04 NA NA
5. P Q2YQM7 Pyridoxine 5'-phosphate synthase 2.21e-08 1.88e-06 NA NA
5. P Q1NZ26 Uncharacterized protein F13E9.13, mitochondrial 2.89e-11 2.34e-05 NA NA
5. P Q57PS8 3-dehydroquinate dehydratase 5.58e-09 2.59e-03 NA NA
5. P P9WG75 Thiamine-phosphate synthase 2.04e-08 3.11e-06 NA NA
5. P Q3SHL8 N-(5'-phosphoribosyl)anthranilate isomerase 6.80e-10 1.20e-18 NA NA
5. P A6VFT8 Tryptophan synthase alpha chain 1.86e-08 5.50e-06 NA NA
5. P B7NDK1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.08e-06 1.69e-04 NA NA
5. P Q6G480 Thiazole synthase 4.25e-06 1.76e-02 NA NA
5. P A6QC86 N-(5'-phosphoribosyl)anthranilate isomerase 5.51e-08 2.02e-15 NA NA
5. P B3GXH2 Orotidine 5'-phosphate decarboxylase 5.96e-08 1.45e-04 NA NA
5. P Q04RT3 N-(5'-phosphoribosyl)anthranilate isomerase 1.35e-08 1.01e-15 NA NA
5. P B7JRB1 Thiazole synthase 2.27e-09 6.15e-03 NA NA
5. P P43073 N-(5'-phosphoribosyl)anthranilate isomerase 1.07e-03 5.47e-15 NA NA
5. P Q9RCE7 Tryptophan synthase alpha chain 1.98e-06 8.34e-06 NA NA
5. P Q133T5 Thiazole synthase 2.62e-05 5.12e-03 NA NA
5. P B3PDW7 Orotidine 5'-phosphate decarboxylase 3.19e-07 7.64e-03 NA NA
5. P Q8A012 Orotidine 5'-phosphate decarboxylase 1.10e-07 3.64e-04 NA NA
5. P Q4ZPE4 Pyridoxine 5'-phosphate synthase 2.64e-10 4.69e-04 NA NA
5. P Q2S1Z4 N-(5'-phosphoribosyl)anthranilate isomerase 1.21e-09 5.15e-18 NA NA
5. P A2C476 3-methyl-2-oxobutanoate hydroxymethyltransferase 3.67e-06 7.39e-03 NA NA
5. P B0BP16 Orotidine 5'-phosphate decarboxylase 5.43e-08 1.45e-04 NA NA
5. P Q8P7R6 N-(5'-phosphoribosyl)anthranilate isomerase 1.16e-09 1.43e-16 NA NA
5. P C4XI54 Tryptophan synthase alpha chain 1.39e-03 2.19e-04 NA NA
5. P A7Z617 N-(5'-phosphoribosyl)anthranilate isomerase 5.15e-12 3.09e-12 NA NA
5. P A6TMN5 Thiamine-phosphate synthase 9.54e-10 6.74e-03 NA NA
5. P B4S715 N-(5'-phosphoribosyl)anthranilate isomerase 1.89e-10 1.02e-18 NA NA
5. P O27697 Tryptophan synthase alpha chain 7.76e-08 1.61e-03 NA NA
5. P A4YGQ6 Triosephosphate isomerase 2.47e-08 3.47e-05 NA NA
5. P A8AKT0 Thiamine-phosphate synthase 2.03e-09 2.15e-03 NA NA
5. P Q71Z41 Tryptophan synthase alpha chain 9.85e-08 6.58e-04 NA NA
5. P Q5JFU9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.88e-07 1.35e-02 NA NA
5. P P72776 Pyridoxine 5'-phosphate synthase 1.37e-09 1.86e-05 NA NA
5. P Q5ZVY5 N-(5'-phosphoribosyl)anthranilate isomerase 7.45e-10 2.82e-18 NA NA
5. P B5YD09 Tryptophan synthase alpha chain 2.38e-07 2.19e-02 NA NA
5. P Q2YUL2 Thiamine-phosphate synthase 6.77e-08 8.53e-07 NA NA
5. P A1VGB6 Tryptophan synthase alpha chain 6.87e-04 8.94e-03 NA NA
5. P A6TM77 Tryptophan synthase alpha chain 9.72e-08 3.69e-02 NA NA
5. P Q1JC81 Orotidine 5'-phosphate decarboxylase 2.90e-08 1.06e-02 NA NA
5. P A8MK92 Thiamine-phosphate synthase 5.38e-09 2.25e-04 NA NA
5. P A9M642 Pyridoxine 5'-phosphate synthase 2.20e-08 1.25e-06 NA NA
5. P A1BEZ1 N-(5'-phosphoribosyl)anthranilate isomerase 3.41e-10 3.73e-12 NA NA
5. P Q9UZN7 Geranylgeranylglyceryl phosphate synthase 1.41e-07 1.64e-02 NA NA
5. P A1KVH8 Pyridoxine 5'-phosphate synthase 3.88e-10 2.44e-06 NA NA
5. P Q8DQK4 Thiamine-phosphate synthase 1 4.50e-08 1.58e-05 NA NA
5. P Q9JYT0 3-dehydroquinate dehydratase 4.82e-09 3.30e-02 NA NA
5. P Q5GRJ9 Orotidine 5'-phosphate decarboxylase 1.03e-08 1.38e-03 NA NA
5. P A5IFW5 Pyridoxine 5'-phosphate synthase 2.04e-10 3.05e-06 NA NA
5. P B3R6U7 Orotidine 5'-phosphate decarboxylase 2.75e-07 4.02e-02 NA NA
5. P B7HWF4 Thiazole synthase 1.75e-09 4.66e-03 NA NA
5. P B4T0Z5 Thiamine-phosphate synthase 1.86e-09 3.44e-03 NA NA
5. P B7KL53 Orotidine 5'-phosphate decarboxylase 9.39e-09 2.27e-04 NA NA
5. P A5N6W8 3-dehydroquinate dehydratase 4.22e-09 2.20e-03 NA NA
5. P A6VPG9 Thiamine-phosphate synthase 7.45e-05 8.94e-06 NA NA
5. P B0K8T5 N-(5'-phosphoribosyl)anthranilate isomerase 6.59e-10 1.02e-18 NA NA
5. P Q5FLZ2 Deoxyribose-phosphate aldolase 1.16e-09 5.33e-03 NA NA
5. P Q02YS6 Thiamine-phosphate synthase 7.22e-09 1.57e-04 NA NA
5. P A8F498 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.78e-06 1.91e-02 NA NA
5. P A4SFW2 Thiazole synthase 6.49e-06 2.34e-03 NA NA
5. P B1HTW4 Heptaprenylglyceryl phosphate synthase 2.24e-08 5.41e-04 NA NA
5. P Q8D304 Pyridoxine 5'-phosphate synthase 4.47e-10 6.66e-09 NA NA
5. P C1D7L7 Pyridoxine 5'-phosphate synthase 1.62e-10 1.22e-05 NA NA
5. P Q822W4 N-(5'-phosphoribosyl)anthranilate isomerase 1.23e-08 2.91e-14 NA NA
5. P Q8Z325 Thiamine-phosphate synthase 1.74e-09 3.81e-03 NA NA
5. P Q97AR4 Geranylgeranylglyceryl phosphate synthase 2.63e-08 1.21e-02 NA NA
5. P B1MX63 Thiamine-phosphate synthase 1.20e-08 1.05e-05 NA NA
5. P A6VG83 Thiamine-phosphate synthase 7.02e-10 8.29e-05 NA NA
5. P Q8FLJ5 Tryptophan synthase alpha chain 1.59e-07 4.70e-03 NA NA
5. P Q1J8K5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.21e-08 1.21e-06 NA NA
5. P B9IU37 N-(5'-phosphoribosyl)anthranilate isomerase 1.33e-09 2.05e-15 NA NA
5. P B9E150 N-(5'-phosphoribosyl)anthranilate isomerase 8.06e-10 2.18e-13 NA NA
5. P Q8YLL0 N-(5'-phosphoribosyl)anthranilate isomerase 3.97e-10 1.03e-12 NA NA
5. P P65516 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.42e-08 2.88e-04 NA NA
5. P Q1BEL9 Thiamine-phosphate synthase 3.92e-09 1.92e-06 NA NA
5. P Q5H704 Pyridoxine 5'-phosphate synthase 4.45e-09 7.08e-07 NA NA
5. P A8AG60 Tryptophan synthase alpha chain 2.56e-03 8.58e-03 NA NA
5. P A5IC64 Thiazole synthase 7.01e-06 2.40e-03 NA NA
5. P Q0SSM0 Thiazole synthase 1.18e-09 4.12e-02 NA NA
5. P Q7VQZ9 Tryptophan synthase alpha chain 1.56e-04 2.80e-03 NA NA
5. P A2C897 Pyridoxine 5'-phosphate synthase 9.72e-10 1.12e-06 NA NA
5. P Q8CNK2 Thiamine-phosphate synthase 1.96e-05 1.39e-05 NA NA
5. P Q47HQ4 Tryptophan synthase alpha chain 5.09e-08 1.67e-02 NA NA
5. P O28671 N-(5'-phosphoribosyl)anthranilate isomerase 1.76e-10 3.13e-18 NA NA
5. P Q4ZVD9 Orotidine 5'-phosphate decarboxylase 4.68e-08 4.25e-03 NA NA
5. P Q9PIF1 Tryptophan synthase alpha chain 4.04e-07 7.77e-03 NA NA
5. P B1ITH3 Orotidine 5'-phosphate decarboxylase 3.79e-08 2.13e-02 NA NA
5. P B1XHJ6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.98e-06 1.69e-04 NA NA
5. P A9BS60 Orotidine 5'-phosphate decarboxylase 3.25e-07 2.68e-03 NA NA
5. P B1ZLY7 Tryptophan synthase alpha chain 1.03e-07 3.93e-02 NA NA
5. P B2SUX4 Pyridoxine 5'-phosphate synthase 4.02e-09 7.08e-07 NA NA
5. P A0PRY2 Thiamine-phosphate synthase 9.96e-09 8.68e-05 NA NA
5. P Q2JP46 Pyridoxine 5'-phosphate synthase 1.56e-09 1.01e-07 NA NA
5. P O74044 Triosephosphate isomerase 5.26e-08 3.24e-04 NA NA
5. P Q5LCA7 Thiamine-phosphate synthase 1.11e-08 1.94e-04 NA NA
5. P Q87JW8 Thiamine-phosphate synthase 2.27e-04 1.65e-05 NA NA
5. P Q83A36 3-dehydroquinate dehydratase 4.77e-09 4.60e-04 NA NA
5. P Q1QMP2 Orotidine 5'-phosphate decarboxylase 4.99e-09 3.94e-03 NA NA
5. P B7J5U0 Thiazole synthase 1.51e-05 1.91e-02 NA NA
5. P A7MUN7 Orotidine 5'-phosphate decarboxylase 5.46e-08 3.10e-04 NA NA
5. P Q6G0A2 Thiazole synthase 6.72e-06 1.31e-02 NA NA
5. P Q48VD6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.19e-08 1.10e-06 NA NA
5. P C0RGR3 Thiazole synthase 6.50e-05 3.68e-04 NA NA
5. P Q0HMB1 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.26e-08 3.54e-02 NA NA
5. P P51382 Tryptophan synthase alpha chain 7.74e-08 4.60e-02 NA NA
5. P Q5F5C2 Thiamine-phosphate synthase 1.29e-09 1.02e-04 NA NA
5. P B6EIY4 Orotidine 5'-phosphate decarboxylase 4.92e-08 2.70e-04 NA NA
5. P B6J887 Orotidine 5'-phosphate decarboxylase 2.28e-08 3.18e-03 NA NA
5. P A8Z3J9 3-methyl-2-oxobutanoate hydroxymethyltransferase 6.72e-06 1.54e-03 NA NA
5. P Q3BZR9 Pyridoxine 5'-phosphate synthase 4.08e-09 3.24e-07 NA NA
5. P A7IGG9 Thiamine-phosphate synthase 4.36e-08 1.94e-03 NA NA
5. P Q2N9N4 Orotidine 5'-phosphate decarboxylase 2.51e-08 4.22e-02 NA NA
5. P Q2RNS6 N-(5'-phosphoribosyl)anthranilate isomerase 1.13e-09 1.18e-17 NA NA
5. P A1AN65 Tryptophan synthase alpha chain 8.48e-08 8.03e-03 NA NA
5. P B8FUD4 Thiamine-phosphate synthase 3.18e-09 6.55e-05 NA NA
5. P Q9RVT0 Tryptophan synthase alpha chain 2.54e-07 3.56e-03 NA NA
5. P A4SDF7 Pyridoxine 5'-phosphate synthase 1.04e-09 4.01e-08 NA NA
5. P Q3Z6G1 Tryptophan synthase alpha chain 7.15e-08 2.87e-06 NA NA
5. P A7X240 Tryptophan synthase alpha chain 2.82e-08 4.29e-06 NA NA
5. P Q6GH32 Tryptophan synthase alpha chain 3.12e-08 2.87e-06 NA NA
5. P Q02P38 Orotidine 5'-phosphate decarboxylase 4.52e-08 3.62e-03 NA NA
5. P C4LEZ7 Orotidine 5'-phosphate decarboxylase 1.01e-07 1.14e-04 NA NA
5. P B0VRF8 Tryptophan synthase alpha chain 3.41e-08 1.72e-02 NA NA
5. P Q5PH79 3-dehydroquinate dehydratase 4.91e-09 2.73e-02 NA NA
5. P Q49Z39 Thiamine-phosphate synthase 2.32e-08 1.38e-04 NA NA
5. P A5UGT0 Thiamine-phosphate synthase 3.89e-08 2.81e-05 NA NA
5. P Q8ZX28 Triosephosphate isomerase 1.23e-08 1.62e-04 NA NA
5. P Q9PK67 N-(5'-phosphoribosyl)anthranilate isomerase 1.66e-08 8.58e-18 NA NA
5. P B7NVN0 Tryptophan synthase alpha chain 4.15e-03 5.16e-03 NA NA
5. P Q977X5 Orotidine 5'-phosphate decarboxylase 2.84e-10 3.56e-03 NA NA
5. P B7JUH3 N-(5'-phosphoribosyl)anthranilate isomerase 2.39e-10 5.70e-15 NA NA
5. P C6BZZ8 Orotidine 5'-phosphate decarboxylase 1.93e-08 4.51e-03 NA NA
5. P A4FXH7 Tryptophan synthase alpha chain 1.57e-08 5.74e-05 NA NA
5. P Q74J28 Orotidine 5'-phosphate decarboxylase 3.94e-08 1.60e-02 NA NA
5. P Q3YSH4 Orotidine 5'-phosphate decarboxylase 1.70e-08 2.04e-03 NA NA
5. P Q6GDK4 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.23e-08 2.48e-03 NA NA
5. P Q1RBA3 3-dehydroquinate dehydratase 3.90e-09 2.60e-02 NA NA
5. P Q9V1G9 Tryptophan synthase alpha chain 1.19e-07 8.13e-05 NA NA
5. P O51589 Putative N-acetylmannosamine-6-phosphate 2-epimerase 8.73e-07 1.54e-04 NA NA
5. P A7H2E1 Pyridoxine 5'-phosphate synthase 1.23e-08 1.94e-04 NA NA
5. P O34294 Thiamine-phosphate synthase 2.74e-10 4.21e-03 NA NA
5. P A2RKJ7 Thiamine-phosphate synthase 8.40e-09 2.19e-04 NA NA
5. P B7LRZ7 Orotidine 5'-phosphate decarboxylase 5.99e-08 2.75e-02 NA NA
5. P C6E1P3 Tryptophan synthase alpha chain 1.42e-08 6.64e-04 NA NA
5. P Q0THD6 3-dehydroquinate dehydratase 4.19e-09 2.48e-02 NA NA
5. P B8D970 Tryptophan synthase alpha chain 3.38e-05 2.65e-04 NA NA
5. P A5UC41 Tryptophan synthase alpha chain 1.54e-04 3.10e-03 NA NA
5. P Q74AI3 Tryptophan synthase alpha chain 1.12e-07 1.87e-03 NA NA
5. P Q5KZU0 Thiamine-phosphate synthase 2.92e-06 1.03e-04 NA NA
5. P A1BGM7 Thiamine-phosphate synthase 8.40e-10 3.27e-03 NA NA
5. P Q3K1L6 Thiamine-phosphate synthase 7.14e-09 1.44e-05 NA NA
5. P Q82SJ7 Pyridoxine 5'-phosphate synthase 1.82e-10 8.36e-07 NA NA
5. P Q48A93 Thiazole synthase 1.46e-05 2.85e-03 NA NA
5. P Q9CF39 3-dehydroquinate dehydratase 1.71e-07 1.98e-02 NA NA
5. P Q2FWG3 Thiamine-phosphate synthase 4.47e-08 6.66e-07 NA NA
5. P B3PVV1 N-(5'-phosphoribosyl)anthranilate isomerase 7.22e-10 2.18e-16 NA NA
5. P Q8U092 N-(5'-phosphoribosyl)anthranilate isomerase 9.81e-11 5.02e-24 NA NA
5. P Q8PT96 Tryptophan synthase alpha chain 9.36e-08 1.14e-02 NA NA
5. P O83578 Putative KHG/KDPG aldolase 1.10e-08 7.93e-04 NA NA
5. P B6I5K1 Thiazole synthase 5.20e-05 7.64e-03 NA NA
5. P Q0KF31 Thiazole synthase 2.23e-05 7.76e-05 NA NA
5. P Q4KFV3 Orotidine 5'-phosphate decarboxylase 4.61e-08 2.68e-03 NA NA
5. P Q8ZV18 N-(5'-phosphoribosyl)anthranilate isomerase 6.13e-10 6.44e-15 NA NA
5. P Q8DGQ5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.94e-06 5.08e-04 NA NA
5. P Q63GS5 Heptaprenylglyceryl phosphate synthase 5.42e-08 7.07e-04 NA NA
5. P Q6AAE4 Thiazole synthase 1.49e-04 3.00e-02 NA NA
5. P Q7VHV1 Pyridoxine 5'-phosphate synthase 4.42e-09 1.54e-07 NA NA
5. P A5FHG4 Orotidine 5'-phosphate decarboxylase 3.21e-07 3.71e-03 NA NA
5. P Q6A6A0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.74e-08 3.85e-04 NA NA
5. P Q3JCB7 Tryptophan synthase alpha chain 3.01e-08 5.38e-03 NA NA
5. P Q48U89 3-dehydroquinate dehydratase 7.55e-08 2.36e-02 NA NA
5. P C3LNL5 Orotidine 5'-phosphate decarboxylase 9.71e-08 7.93e-04 NA NA
5. P Q81GG4 Tryptophan synthase alpha chain 1.65e-08 1.99e-05 NA NA
5. P Q1MND5 Tryptophan synthase alpha chain 3.48e-07 4.25e-02 NA NA
5. P Q1MND7 N-(5'-phosphoribosyl)anthranilate isomerase 5.06e-10 3.69e-17 NA NA
5. P B4TQK3 Thiamine-phosphate synthase 2.00e-09 1.14e-03 NA NA
5. P Q1IH21 Tryptophan synthase alpha chain 1.30e-07 1.32e-02 NA NA
5. P Q1BM66 Tryptophan synthase alpha chain 7.39e-08 3.41e-02 NA NA
5. P P61413 Thiamine-phosphate synthase 8.01e-10 1.70e-05 NA NA
5. P Q7VIU7 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.30e-05 9.80e-03 NA NA
5. P B7LY40 Orotidine 5'-phosphate decarboxylase 3.86e-08 2.13e-02 NA NA
5. P P30139 Thiazole synthase 5.14e-05 5.25e-03 NA NA
5. P Q2FF35 Thiamine-phosphate synthase 7.34e-08 6.66e-07 NA NA
5. P Q0AF72 Pyridoxine 5'-phosphate synthase 1.91e-10 1.01e-06 NA NA
5. P C4ZSW1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.07e-06 1.69e-04 NA NA
5. P Q5HRH7 3-hexulose-6-phosphate synthase 5.11e-12 3.92e-06 NA NA
5. P A3P7M8 Tryptophan synthase alpha chain 1.18e-07 2.68e-03 NA NA
5. P Q1I5W1 Pyridoxine 5'-phosphate synthase 2.59e-10 1.62e-05 NA NA
5. P P67007 N-(5'-phosphoribosyl)anthranilate isomerase 1.88e-11 1.12e-19 NA NA
5. P P38448 KHG/KDPG aldolase 4.77e-09 2.73e-02 NA NA
5. P B1HX34 Thiamine-phosphate synthase 1.05e-09 1.97e-03 NA NA
5. P Q893R0 Thiamine-phosphate synthase 6.16e-09 2.51e-05 NA NA
5. P Q81TL9 N-(5'-phosphoribosyl)anthranilate isomerase 2.25e-09 2.58e-14 NA NA
5. P Q1XDA5 Tryptophan synthase alpha chain 6.67e-08 2.73e-02 NA NA
5. P C1DH67 Tryptophan synthase alpha chain 2.34e-05 1.56e-03 NA NA
5. P A8MDA4 Geranylgeranylglyceryl phosphate synthase 1.16e-08 5.12e-03 NA NA
5. P Q58515 Uncharacterized protein MJ1115 1.28e-11 7.79e-04 NA NA
5. P B6JCP1 N-(5'-phosphoribosyl)anthranilate isomerase 4.55e-10 1.94e-15 NA NA
5. P Q03CY2 N-(5'-phosphoribosyl)anthranilate isomerase 7.96e-10 3.23e-14 NA NA
5. P Q49WT0 3-hexulose-6-phosphate synthase 2 2.92e-12 2.49e-06 NA NA
5. P A2RJD1 3-dehydroquinate dehydratase 1.62e-07 7.07e-05 NA NA
5. P C1EVE6 Thiamine-phosphate synthase 3.19e-09 2.32e-03 NA NA
5. P Q0BQI7 N-(5'-phosphoribosyl)anthranilate isomerase 3.29e-09 3.89e-15 NA NA
5. P C6A2A3 Geranylgeranylglyceryl phosphate synthase 1.97e-08 1.49e-02 NA NA
5. P B0KF94 N-(5'-phosphoribosyl)anthranilate isomerase 6.82e-10 3.80e-20 NA NA
5. P A0B9D8 N-(5'-phosphoribosyl)anthranilate isomerase 1.62e-11 6.60e-18 NA NA
5. P Q83E06 Orotidine 5'-phosphate decarboxylase 2.29e-08 3.18e-03 NA NA
5. P Q65MR4 Heptaprenylglyceryl phosphate synthase 7.94e-08 5.43e-05 NA NA
5. P Q46Z21 Pyridoxine 5'-phosphate synthase 4.00e-10 7.79e-04 NA NA
5. P Q5HPH1 N-(5'-phosphoribosyl)anthranilate isomerase 3.15e-11 1.68e-18 NA NA
5. P Q8G2U9 Thiazole synthase 2.70e-05 1.66e-04 NA NA
5. P Q1LS25 Thiazole synthase 2.94e-05 3.08e-03 NA NA
5. P A9EXF3 Thiazole synthase 6.52e-05 1.36e-02 NA NA
5. P O59536 Triosephosphate isomerase 1.13e-08 7.26e-06 NA NA
5. P Q9HPG4 N-(5'-phosphoribosyl)anthranilate isomerase 4.34e-11 6.15e-12 NA NA
5. P Q9JWI2 Thiamine-phosphate synthase 1.16e-09 2.78e-04 NA NA
5. P Q3ZZ10 Tryptophan synthase alpha chain 8.61e-08 2.87e-06 NA NA
5. P A1AR94 Pyridoxine 5'-phosphate synthase 7.09e-10 2.51e-04 NA NA
5. P A8ZVC5 Pyridoxine 5'-phosphate synthase 1.75e-09 2.75e-04 NA NA
5. P O69158 Pyridoxine 5'-phosphate synthase 3.09e-10 1.50e-04 NA NA
5. P B2J1L6 N-(5'-phosphoribosyl)anthranilate isomerase 7.32e-11 3.15e-14 NA NA
5. P Q2KDF0 Orotidine 5'-phosphate decarboxylase 2.03e-09 3.12e-04 NA NA
5. P Q8TS37 Orotidine 5'-phosphate decarboxylase 4.39e-10 2.23e-02 NA NA
5. P Q4UNV9 Orotidine 5'-phosphate decarboxylase 6.01e-10 1.39e-03 NA NA
5. P Q161I8 Tryptophan synthase alpha chain 1.03e-07 4.21e-04 NA NA
5. P Q1JME5 3-dehydroquinate dehydratase 1.18e-05 2.36e-02 NA NA
5. P B5ZYG6 Orotidine 5'-phosphate decarboxylase 1.54e-09 6.07e-04 NA NA
5. P Q3A2I0 3-dehydroquinate dehydratase 6.20e-09 3.71e-03 NA NA
5. P B2USY5 Thiamine-phosphate synthase 1.95e-08 8.94e-03 NA NA
5. P B0SMR9 Thiamine-phosphate synthase 2.67e-08 8.22e-04 NA NA
5. P B9M7D5 Tryptophan synthase alpha chain 6.37e-08 4.66e-03 NA NA
5. P A4SDQ2 Tryptophan synthase alpha chain 2.32e-05 4.78e-03 NA NA
5. P Q926V7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.48e-06 8.58e-03 NA NA
5. P Q8DGP3 N-(5'-phosphoribosyl)anthranilate isomerase 7.93e-10 7.89e-16 NA NA
5. P B2RME4 Orotidine 5'-phosphate decarboxylase 1.69e-07 1.23e-02 NA NA
5. P A1RRN9 Geranylgeranylglyceryl phosphate synthase 9.26e-08 3.99e-04 NA NA
5. P Q2GG43 Orotidine 5'-phosphate decarboxylase 5.29e-09 1.16e-03 NA NA
5. P Q9ZL01 Thiamine-phosphate synthase 7.61e-09 6.82e-04 NA NA
5. P A3MZI8 Tryptophan synthase alpha chain 2.07e-04 9.48e-03 NA NA
5. P P42405 3-hexulose-6-phosphate synthase 1.60e-11 2.46e-05 NA NA
5. P B2S9A6 N-(5'-phosphoribosyl)anthranilate isomerase 6.28e-10 2.33e-18 NA NA
5. P A9M7F3 Thiazole synthase 3.78e-05 1.66e-04 NA NA
5. P C3PBW1 Thiamine-phosphate synthase 2.53e-06 2.00e-03 NA NA
5. P B2U0F1 Tryptophan synthase alpha chain 4.16e-03 2.20e-03 NA NA
5. P A0AFU8 3-dehydroquinate dehydratase 4.93e-09 1.66e-03 NA NA
5. P Q7MD32 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.06e-06 1.24e-02 NA NA
5. P Q0AZ86 Thiamine-phosphate synthase 1.82e-09 3.81e-04 NA NA
5. P B7M738 Thiazole synthase 5.16e-05 7.96e-03 NA NA
5. P A4J148 N-(5'-phosphoribosyl)anthranilate isomerase 1.15e-09 9.31e-19 NA NA
5. P Q5M4I0 Orotidine 5'-phosphate decarboxylase 4.10e-08 4.49e-02 NA NA
5. P B0V529 Tryptophan synthase alpha chain 2.41e-08 1.72e-02 NA NA
5. P B4U872 Pyridoxine 5'-phosphate synthase 1.74e-09 5.58e-07 NA NA
5. P A6VFU0 N-(5'-phosphoribosyl)anthranilate isomerase 5.05e-11 5.27e-17 NA NA
5. P Q5WWS3 Orotidine 5'-phosphate decarboxylase 1.15e-07 1.71e-03 NA NA
5. P Q5L6R5 Thiamine-phosphate synthase 1.26e-08 2.75e-04 NA NA
5. P B1ITJ5 Tryptophan synthase alpha chain 5.13e-07 3.74e-03 NA NA
5. P A9WFI5 Tryptophan synthase alpha chain 2.29e-07 5.33e-03 NA NA
5. P Q1QY43 N-(5'-phosphoribosyl)anthranilate isomerase 1.71e-10 1.58e-16 NA NA
5. P B8ZN60 N-(5'-phosphoribosyl)anthranilate isomerase 7.92e-10 9.98e-16 NA NA
5. P A8AUI0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.07e-08 4.32e-05 NA NA
5. P Q89WE6 N-(5'-phosphoribosyl)anthranilate isomerase 1.24e-10 1.73e-15 NA NA
5. P P37678 3-keto-L-gulonate-6-phosphate decarboxylase SgbH 4.26e-09 2.52e-07 NA NA
5. P Q4FMP0 Thiazole synthase 1.67e-05 1.45e-02 NA NA
5. P B0CJ70 Thiazole synthase 2.68e-05 2.36e-04 NA NA
5. P Q65I36 Tryptophan synthase alpha chain 3.06e-05 1.23e-03 NA NA
5. P B1WT19 N-(5'-phosphoribosyl)anthranilate isomerase 3.24e-10 1.83e-15 NA NA
5. P B3W6W7 N-(5'-phosphoribosyl)anthranilate isomerase 7.82e-10 2.95e-14 NA NA
5. P A0LA38 N-(5'-phosphoribosyl)anthranilate isomerase 1.04e-08 5.38e-18 NA NA
5. P A3DDS6 N-(5'-phosphoribosyl)anthranilate isomerase 7.38e-11 1.61e-14 NA NA
5. P C5CJH0 Thiazole synthase 3.36e-05 4.07e-03 NA NA
5. P Q32CV7 Pyridoxine 5'-phosphate synthase 2.72e-10 9.66e-11 NA NA
5. P Q8E5W9 Thiamine-phosphate synthase 6.90e-09 2.07e-05 NA NA
5. P Q32GQ2 Orotidine 5'-phosphate decarboxylase 4.71e-08 1.55e-02 NA NA
5. P B9LKB2 Tryptophan synthase alpha chain 2.20e-07 5.33e-03 NA NA
5. P B1J4E3 Pyridoxine 5'-phosphate synthase 2.83e-10 7.83e-03 NA NA
5. P A9AAU6 Tryptophan synthase alpha chain 1.61e-08 9.36e-05 NA NA
5. P Q21VL5 Thiamine-phosphate synthase 8.12e-09 1.89e-03 NA NA
5. P Q8R806 Thiamine-phosphate synthase 7.42e-10 2.53e-04 NA NA
5. P B5FS97 3-keto-L-gulonate-6-phosphate decarboxylase UlaD 1.28e-09 2.27e-08 NA NA
5. P P36923 3-dehydroquinate dehydratase 1.24e-08 1.10e-02 NA NA
6. F A4J9C4 Probable transaldolase 3.05e-06 NA NA 0.6148
6. F Q9PMQ6 Triosephosphate isomerase 1.20e-03 NA NA 0.4761
6. F B0SUL0 UPF0276 protein Caul_0757 2.18e-03 NA NA 0.471
6. F Q5HT16 Triosephosphate isomerase 1.03e-03 NA NA 0.4763
6. F Q8XMJ6 Probable transaldolase 2.99e-06 NA NA 0.6209
6. F A1AKQ8 Probable transaldolase 3.72e-06 NA NA 0.629
6. F Q7UC91 tRNA-dihydrouridine(16) synthase 6.56e-06 NA NA 0.5516
6. F A0PM27 Probable endonuclease 4 5.97e-04 NA NA 0.5805
6. F B5ED52 Probable transaldolase 3.53e-06 NA NA 0.5966
6. F C0M7L5 Probable transaldolase 3.10e-06 NA NA 0.5828
6. F B2HSJ8 Probable endonuclease 4 1.83e-03 NA NA 0.5861
6. F Q1J5E9 Probable transaldolase 3.11e-06 NA NA 0.5967
6. F C0MGU8 Probable transaldolase 3.11e-06 NA NA 0.583
6. F A7GCY3 Probable transaldolase 2.94e-06 NA NA 0.62
6. F Q3A7Y3 Probable transaldolase 3.81e-06 NA NA 0.6251
6. F C5DN02 Pentafunctional AROM polypeptide 1.49e-01 NA NA 0.5676
6. F Q5WTD7 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.69e-06 NA NA 0.5947
6. F A5U056 Probable endonuclease 4 2.40e-03 NA NA 0.5785
6. F A9A413 Probable transaldolase 2.76e-06 NA NA 0.6585
6. F Q0AUA5 Probable transaldolase 1.90e-06 NA NA 0.6327
6. F P67716 Probable tRNA-dihydrouridine synthase 1.20e-03 NA NA 0.5468
6. F Q4JW54 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.02e-09 NA NA 0.5522
6. F P9WQ12 Probable endonuclease 4 2.46e-03 NA NA 0.5884
6. F A5UCY8 Deoxyribose-phosphate aldolase 1.35e-09 NA NA 0.6063
6. F P63536 Probable endonuclease 4 2.38e-03 NA NA 0.5871
6. F P0A9I2 Citrate lyase subunit beta 2.70e-05 NA NA 0.4283
6. F A5I1C9 Probable transaldolase 3.19e-06 NA NA 0.6149
6. F Q8FFV5 tRNA-dihydrouridine(16) synthase 8.25e-06 NA NA 0.563
6. F C8Z543 Pentafunctional AROM polypeptide 1.50e-01 NA NA 0.6238
6. F B9M1X7 Probable transaldolase 2.88e-06 NA NA 0.6234
6. F Q1IWD2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.89e-06 NA NA 0.5538
6. F O26931 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.09e-09 NA NA 0.5692
6. F Q5PKA7 Thiamine-phosphate synthase 1.68e-09 NA NA 0.6515
6. F Q8CPX1 3-dehydroquinate dehydratase 3.79e-07 NA NA 0.5917
6. F Q9K6E4 Probable transaldolase 1.50e-06 NA NA 0.6393
6. F Q1JKK8 Probable transaldolase 3.02e-06 NA NA 0.5965
6. F C0QIA5 Probable transaldolase 2.38e-06 NA NA 0.6341
6. F B2A3J5 Probable transaldolase 1.06e-06 NA NA 0.5961
6. F P60580 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.32e-09 NA NA 0.4833
6. F C1FL18 Probable transaldolase 3.63e-06 NA NA 0.6272
6. F A8LX58 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.75e-09 NA NA 0.531
6. F Q1JFK0 Probable transaldolase 2.92e-06 NA NA 0.5845
6. F Q9HKI3 Probable transaldolase 2.68e-06 NA NA 0.6045
6. F A6LNG2 Probable transaldolase 3.36e-06 NA NA 0.615
6. F P30770 Probable endonuclease 4 1.92e-03 NA NA 0.6103
6. F Q6GD38 Probable tRNA-dihydrouridine synthase 1.23e-03 NA NA 0.5367
6. F Q7MH47 Triosephosphate isomerase 4.45e-05 NA NA 0.5092
6. F C7GIN5 Pentafunctional AROM polypeptide 1.51e-01 NA NA 0.6146
6. F B9DJG9 3-dehydroquinate dehydratase 2.82e-05 NA NA 0.5486
6. F Q0BX85 Probable transaldolase 2.49e-06 NA NA 0.6486
6. F Q24ML5 Probable transaldolase 7.72e-07 NA NA 0.6359
6. F Q88LF2 tRNA-dihydrouridine(16) synthase 3.59e-04 NA NA 0.6266
6. F Q8FNZ7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.50e-09 NA NA 0.5626
6. F P71319 5,10-methylenetetrahydrofolate reductase 3.96e-04 NA NA 0.4928
6. F Q899F3 Probable transaldolase 3.09e-06 NA NA 0.6214
6. F A5GBY8 Probable transaldolase 4.19e-06 NA NA 0.6296
6. F Q9A3E9 UPF0276 protein CC_3255 2.20e-03 NA NA 0.4195
6. F P66959 Probable transaldolase 2.99e-06 NA NA 0.5859
6. F A2RD32 Probable transaldolase 3.08e-06 NA NA 0.5965
6. F Q8XYX1 tRNA-dihydrouridine(16) synthase 1.88e-05 NA NA 0.5355
6. F Q0SV41 Probable transaldolase 2.73e-06 NA NA 0.62
6. F Q8ZU75 Uncharacterized DapA-like lyase PAE2915 1.00e-05 NA NA 0.5583
6. F C1AL03 Probable endonuclease 4 8.86e-04 NA NA 0.5558
6. F A5CYD0 Probable transaldolase 2.45e-06 NA NA 0.6304
6. F Q0TTA4 Probable transaldolase 2.13e-06 NA NA 0.6237
6. F B4U8P1 Probable transaldolase 1.94e-06 NA NA 0.6186
6. F Q6CJC4 Pentafunctional AROM polypeptide 1.51e-01 NA NA 0.5213
6. F Q02QB5 UPF0276 protein PA14_21580 1.40e-05 NA NA 0.4709
6. F P0DG13 Probable transaldolase 3.05e-06 NA NA 0.5861
6. F P50921 Triosephosphate isomerase 4.43e-05 NA NA 0.4824
6. F Q9JUP6 tRNA-dihydrouridine(16) synthase 3.78e-04 NA NA 0.5951
6. F Q6AR67 Probable transaldolase 2.64e-06 NA NA 0.6474
6. F Q8ZGV2 tRNA-dihydrouridine(16) synthase 7.56e-06 NA NA 0.579
6. F B2V7E1 Probable transaldolase 2.06e-06 NA NA 0.6236
6. F Q5XAK4 Probable transaldolase 3.19e-06 NA NA 0.5963
6. F Q67TE2 Probable transaldolase 2.92e-06 NA NA 0.6596
6. F O54235 5,10-methylenetetrahydrofolate reductase 5.23e-04 NA NA 0.4992
6. F A6TK31 Probable transaldolase 2.69e-06 NA NA 0.6145
6. F B3E1K9 Probable transaldolase 3.76e-06 NA NA 0.6294
6. F Q1JAF7 Probable transaldolase 3.11e-06 NA NA 0.593
6. F O68602 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.15e-09 NA NA 0.5427
6. F P44430 Deoxyribose-phosphate aldolase 1.35e-09 NA NA 0.6098
6. F P0DG12 Probable transaldolase 3.01e-06 NA NA 0.5861
6. F O83288 Deoxyribose-phosphate aldolase 9.76e-09 NA NA 0.6105
6. F Q0P8U3 Putative imidazole glycerol phosphate synthase subunit hisF2 1.12e-08 NA NA 0.575
6. F A9GI16 Probable transaldolase 2.11e-06 NA NA 0.6477
6. F A0A0H3CC29 UPF0276 protein CCNA_03000 2.93e-03 NA NA 0.56
6. F P57937 Deoxyribose-phosphate aldolase 2.24e-09 NA NA 0.6237
6. F P66961 Probable transaldolase 2.94e-06 NA NA 0.5861
6. F Q5HKD5 Probable tRNA-dihydrouridine synthase 1.74e-03 NA NA 0.5337
6. F Q9AMN9 tRNA-dihydrouridine(16) synthase 2.64e-04 NA NA 0.5697
6. F Q884C6 tRNA-dihydrouridine(16) synthase 3.92e-08 NA NA 0.6116
6. F Q5ZS58 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.71e-06 NA NA 0.5946
6. F C6E082 Probable transaldolase 3.41e-06 NA NA 0.5977
6. F Q8XEC6 tRNA-dihydrouridine(16) synthase 8.15e-06 NA NA 0.5522
6. F A7HAL6 UPF0276 protein Anae109_1558 1.93e-02 NA NA 0.5413
6. F B8DE74 4-hydroxy-tetrahydrodipicolinate synthase 9.00e-09 NA NA 0.5966
6. F B4U4L6 Probable transaldolase 3.17e-06 NA NA 0.5827
6. F A0A0H3CEP9 UPF0276 protein CCNA_03364 2.23e-03 NA NA 0.4507
6. F A7H5C4 Triosephosphate isomerase 9.15e-05 NA NA 0.4562
6. F Q6GKK9 Probable tRNA-dihydrouridine synthase 9.72e-04 NA NA 0.5366
6. F A4WJK5 Uncharacterized DapA-like lyase Pars_0992 7.50e-06 NA NA 0.5792
6. F Q04U62 Tryptophan synthase alpha chain 7.04e-08 NA NA 0.5471
6. F B8ZSC5 Probable endonuclease 4 2.16e-03 NA NA 0.6127
6. F Q2FQV3 3-dehydroquinate dehydratase 7.91e-05 NA NA 0.5557
6. F B5XMM1 Probable transaldolase 3.01e-06 NA NA 0.5857
6. F Q7VGK6 Triosephosphate isomerase 6.42e-03 NA NA 0.3997
6. F Q9HZ95 tRNA-dihydrouridine(16) synthase 3.53e-04 NA NA 0.5954
6. F B8E200 Probable transaldolase 2.69e-06 NA NA 0.6374
6. F B6YS36 3-methyl-2-oxobutanoate hydroxymethyltransferase 4.46e-06 NA NA 0.5706
6. F Q39YD4 Probable transaldolase 3.38e-06 NA NA 0.6317
6. F Q9HYW0 UPF0276 protein PA3283 1.27e-05 NA NA 0.4881
6. F B1IJR0 Probable transaldolase 2.94e-06 NA NA 0.6168
6. F B5EGX4 4-hydroxy-tetrahydrodipicolinate synthase 1.94e-08 NA NA 0.6214
6. F A1KGF0 Probable endonuclease 4 2.35e-03 NA NA 0.5885