Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54796.1
JCVISYN3A_0434

23S rRNA (uridine(1939)-m5)-methyltransferase.
M. mycoides homolog: Q6MTB4.
TIGRfam Classification: 5=Equivalog.
Category: Nonessential.

Statistics

Total GO Annotation: 161
Unique PROST Go: 115
Unique BLAST Go: 6
Unique Foldseek Go: 10

Total Homologs: 1650
Unique PROST Homologs: 642
Unique BLAST Homologs: 81
Unique Foldseek Homologs: 36

Literature

Danchin and Fang [1]: modifies m5U1939 in 23S rRNA, wrong annotation in Syn3.0|not TrmFO, demonstrated in Mycoplasma
Yang and Tsui [2]: NA
Antczak et al. [3]: trmFO; Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase
Zhang et al. [4]: GO:0002098|tRNA wobble uridine modification
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q1MHL2 (Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO) with a FATCAT P-Value: 0 and RMSD of 1.56 angstrom. The sequence alignment identity is 38.6%.
Structural alignment shown in left. Query protein AVX54796.1 colored as red in alignment, homolog Q1MHL2 colored as blue. Query protein AVX54796.1 is also shown in right top, homolog Q1MHL2 showed in right bottom. They are colored based on secondary structures. 

  AVX54796.1 MN-----KKVKIIGAGLAGCEAAYFLANNNIQVELYEVKTLIKNEVQKTNNFAELVCSNTFRSQSLL-NAAGILKAEMRRLNSLVIKIADSCKIDGDDAL 94
      Q1MHL2 MNTISSHSPIHVVGGGLAGSEAAWQIASSGVPVILHEMRGVRGTDAHKTDGLAELVCSNSFRSDDATSNAVGVIHAEMRMAGSLIMAAADRCQVPAGGAL 100

  AVX54796.1 AVDREDFSKKLTEVIKNHPNITIIEQNVSHIDDEN-DLTLIATGPLTTNELKEDIQRLIGKQKLFFMDASAPIITKDSIDFNKAYYSGRH-KL-----GK 187
      Q1MHL2 AVDRDGFSEAVTKAVHDHPLITVVREEVTGLPPRDWDLAIVATGPLTAPSLASAIQTETGEDSLAFFDAIAPIVYRESIDMDICWYQSRYDKVGPGGTGK 200

  AVX54796.1 -YICCPLNEQEFNEFADNLINAEQVQLKEFEKSIFFKGCQPIEQLAKTSKKLLLKGPMSSNNLLDQNNHQP----YAVVQLRQDDAKDSLYNMVGFQTNL 282
      Q1MHL2 DYINCPMDEAQYNAFVDALILGDTVGFKEWEGTPYFDGCLPIEVMAERGRETLRHGPMKPMGL--TNAHNPTVKAYAVVQLRQDNALGTLYNMVGFQTKL 298

  AVX54796.1 KWPEQKRVFQTIPGLQKAKIVRYGVMHKNYYINSPKILNFKLQVMRKKNVFFAGQITGVEGYIESASSGIWAAINILAFINNK----KLKPLPNTTILGA 378
      Q1MHL2 KYGAQADIFRMIPGLENAEFARLGGLHRNTYINSPTLLDPSLTLKSRPGLRFAGQITGCEGYVESASVGLMA--GRFAAAERKGEAISL-P-PATTALGS 394

  AVX54796.1 LTNYITNSKIY--------SLKPMKCNLG---------ILEQE--NKYQSDDKFYSFNN--SKNSLEEYIKQLNQILDTSI---- 438
      Q1MHL2 LLGHITGGHLVTDEEPGKRSFQPMNINFGLFPELQPGSIVKPEGVKRFRGKDKTIMKRQLIARRALADCATWLGQ--ESTLAESA 477

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0047151 methylenetetrahydrofolate-tRNA-(uracil-5-)-methyltransferase (FADH2-oxidizing) activity
1. PBF GO:0006569 tryptophan catabolic process
1. PBF GO:0030488 tRNA methylation
1. PBF GO:0070189 kynurenine metabolic process
1. PBF GO:0034354 'de novo' NAD biosynthetic process from tryptophan
1. PBF GO:0002098 tRNA wobble uridine modification
1. PBF GO:0016174 NAD(P)H oxidase H2O2-forming activity
1. PBF GO:0030698 5,10-methylenetetrahydrofolate-dependent tRNA (m5U54) methyltransferase activity
1. PBF GO:0005737 cytoplasm
1. PBF GO:0004502 kynurenine 3-monooxygenase activity
1. PBF GO:0050660 flavin adenine dinucleotide binding
1. PBF GO:0043420 anthranilate metabolic process
1. PBF GO:0019674 NAD metabolic process
1. PBF GO:0005741 mitochondrial outer membrane
1. PBF GO:0019805 quinolinate biosynthetic process
2. PF GO:0102067 geranylgeranyl diphosphate reductase activity
2. PF GO:0016117 carotenoid biosynthetic process
2. PF GO:0019478 D-amino acid catabolic process
2. PF GO:0052886 9,9'-dicis-carotene:quinone oxidoreductase activity
2. PF GO:0016491 oxidoreductase activity
2. PF GO:0055130 D-alanine catabolic process
2. PF GO:0052887 7,9,9'-tricis-neurosporene:quinone oxidoreductase activity
2. PF GO:0071949 FAD binding
2. PF GO:0019469 octopine catabolic process
2. PF GO:0043799 glycine oxidase activity
2. PF GO:0046872 metal ion binding
2. PF GO:0102164 2-heptyl-3-hydroxy-4(1H)-quinolone synthase activity
2. PF GO:0008718 D-amino-acid dehydrogenase activity
2. PF GO:0016719 carotene 7,8-desaturase activity
3. BF GO:0016021 integral component of membrane
5. P GO:0017133 mitochondrial electron transfer flavoprotein complex
5. P GO:0003973 (S)-2-hydroxy-acid oxidase activity
5. P GO:0031314 extrinsic component of mitochondrial inner membrane
5. P GO:0008115 sarcosine oxidase activity
5. P GO:0102099 FAD-dependent urate hydroxylase activity
5. P GO:0106355 4-hydroxybenzoate 3-monooxygenase [NADH] activity
5. P GO:0046467 membrane lipid biosynthetic process
5. P GO:0016901 oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor
5. P GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
5. P GO:0015044 rubredoxin-NAD+ reductase activity
5. P GO:0042443 phenylethylamine metabolic process
5. P GO:0005634 nucleus
5. P GO:0009399 nitrogen fixation
5. P GO:0043914 NADPH:sulfur oxidoreductase activity
5. P GO:0048072 compound eye pigmentation
5. P GO:0004497 monooxygenase activity
5. P GO:0005576 extracellular region
5. P GO:0019608 nicotine catabolic process
5. P GO:0008734 L-aspartate oxidase activity
5. P GO:0043731 6-hydroxynicotinate 3-monooxygenase activity
5. P GO:0046196 4-nitrophenol catabolic process
5. P GO:0008654 phospholipid biosynthetic process
5. P GO:0043639 benzoate catabolic process
5. P GO:0042207 styrene catabolic process
5. P GO:0110142 ubiquinone biosynthesis complex
5. P GO:0050622 glycine dehydrogenase (cyanide-forming) activity
5. P GO:1900554 asperfuranone biosynthetic process
5. P GO:0048039 ubiquinone binding
5. P GO:0009435 NAD biosynthetic process
5. P GO:0050451 CoA-disulfide reductase activity
5. P GO:0097621 monoamine oxidase activity
5. P GO:0045550 geranylgeranyl reductase activity
5. P GO:0043935 sexual sporulation resulting in formation of a cellular spore
5. P GO:0003979 UDP-glucose 6-dehydrogenase activity
5. P GO:0047919 GDP-mannose 6-dehydrogenase activity
5. P GO:0070404 NADH binding
5. P GO:0106364 4-hydroxy-3-all-trans-hexaprenylbenzoate oxygenase activity
5. P GO:0006554 lysine catabolic process
5. P GO:0016126 sterol biosynthetic process
5. P GO:0051699 proline oxidase activity
5. P GO:0000104 succinate dehydrogenase activity
5. P GO:0052589 malate dehydrogenase (menaquinone) activity
5. P GO:0019420 dissimilatory sulfate reduction
5. P GO:0036180 filamentous growth of a population of unicellular organisms in response to biotic stimulus
5. P GO:0009973 adenylyl-sulfate reductase activity
5. P GO:0019439 aromatic compound catabolic process
5. P GO:0016651 oxidoreductase activity, acting on NAD(P)H
5. P GO:0008177 succinate dehydrogenase (ubiquinone) activity
5. P GO:0102040 fumarate reductase (menaquinone)
5. P GO:0036187 cell growth mode switching, budding to filamentous
5. P GO:0008924 malate dehydrogenase (quinone) activity
5. P GO:0017000 antibiotic biosynthetic process
5. P GO:0018663 2,6-dihydroxypyridine 3-monooxygenase activity
5. P GO:1900815 monodictyphenone biosynthetic process
5. P GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase
5. P GO:0043640 benzoate catabolic process via hydroxylation
5. P GO:0050661 NADP binding
5. P GO:0051698 saccharopine oxidase activity
5. P GO:0071871 response to epinephrine
5. P GO:0006113 fermentation
5. P GO:0044550 secondary metabolite biosynthetic process
5. P GO:0018669 3-hydroxybenzoate 6-monooxygenase activity
5. P GO:0042135 neurotransmitter catabolic process
5. P GO:0008681 2-octaprenyl-6-methoxyphenol hydroxylase activity
5. P GO:0006072 glycerol-3-phosphate metabolic process
5. P GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation
5. P GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
5. P GO:0006744 ubiquinone biosynthetic process
5. P GO:0019168 2-octaprenylphenol hydroxylase activity
5. P GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
5. P GO:0050031 L-pipecolate oxidase activity
5. P GO:0000271 polysaccharide biosynthetic process
5. P GO:0006065 UDP-glucuronate biosynthetic process
5. P GO:0019628 urate catabolic process
5. P GO:0016114 terpenoid biosynthetic process
5. P GO:0009324 D-amino-acid dehydrogenase complex
5. P GO:0006696 ergosterol biosynthetic process
5. P GO:0016636 oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor
5. P GO:0050151 oleate hydratase activity
5. P GO:0045454 cell redox homeostasis
5. P GO:0045282 plasma membrane succinate dehydrogenase complex
5. P GO:0018659 4-hydroxybenzoate 3-monooxygenase activity
5. P GO:0045436 lycopene beta cyclase activity
5. P GO:0004174 electron-transferring-flavoprotein dehydrogenase activity
5. P GO:0016156 fumarate reductase (NADH) activity
5. P GO:0015046 rubredoxin-NADP+ reductase activity
5. P GO:0052591 sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity
5. P GO:0003756 protein disulfide isomerase activity
5. P GO:0009061 anaerobic respiration
5. P GO:0006650 glycerophospholipid metabolic process
5. P GO:0043783 oxidoreductase activity, acting on metal ions, flavin as acceptor
5. P GO:0018632 4-nitrophenol 4-monooxygenase activity
5. P GO:0047545 2-hydroxyglutarate dehydrogenase activity
5. P GO:0031305 integral component of mitochondrial inner membrane
5. P GO:0005504 fatty acid binding
5. P GO:0016166 phytoene dehydrogenase activity
5. P GO:0019477 L-lysine catabolic process
5. P GO:0022900 electron transport chain
5. P GO:0034628 'de novo' NAD biosynthetic process from aspartate
5. P GO:0019563 glycerol catabolic process
5. P GO:0106356 4-hydroxybenzoate 3-monooxygenase [NADPH] activity
5. P GO:0009820 alkaloid metabolic process
5. P GO:0051668 localization within membrane
5. P GO:0044318 L-aspartate:fumarate oxidoreductase activity
5. P GO:0006144 purine nucleobase metabolic process
5. P GO:0004506 squalene monooxygenase activity
5. P GO:0019480 L-alanine oxidation to pyruvate via D-alanine
5. P GO:0016731 oxidoreductase activity, acting on iron-sulfur proteins as donors, NAD or NADP as acceptor
5. P GO:0006099 tricarboxylic acid cycle
5. P GO:0070224 sulfide:quinone oxidoreductase activity
5. P GO:0018671 4-hydroxybenzoate 3-monooxygenase [NAD(P)H] activity
5. P GO:0034419 obsolete L-2-hydroxyglutarate oxidase activity
5. P GO:0018658 salicylate 1-monooxygenase activity
5. P GO:0047651 alkylhalidase activity
5. P GO:0102169 pyocyanin hydroxylase activity
6. F GO:0002097 tRNA wobble base modification
6. F GO:0019380 3-phenylpropionate catabolic process
6. F GO:0019622 3-(3-hydroxy)phenylpropionate catabolic process
6. F GO:0005886 plasma membrane
6. F GO:0008688 3-(3-hydroxyphenyl)propionate hydroxylase activity
6. F GO:0019505 resorcinol metabolic process
6. F GO:0004808 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity
6. F GO:0004355 glutamate synthase (NADPH) activity
6. F GO:0008767 UDP-galactopyranose mutase activity
6. F GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors
7. B GO:0070899 mitochondrial tRNA wobble uridine modification
7. B GO:0003723 RNA binding
7. B GO:0034276 kynurenic acid biosynthetic process
7. B GO:0005829 cytosol
7. B GO:1903296 positive regulation of glutamate secretion, neurotransmission
7. B GO:0097052 L-kynurenine metabolic process

Uniprot GO Annotations

GO Description
GO:0016740 transferase activity
GO:0047151 methylenetetrahydrofolate-tRNA-(uracil-5-)-methyltransferase (FADH2-oxidizing) activity
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0030698 5,10-methylenetetrahydrofolate-dependent tRNA (m5U54) methyltransferase activity
GO:0005737 cytoplasm
GO:0050660 flavin adenine dinucleotide binding
GO:0008168 methyltransferase activity
GO:0032259 methylation

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q55694 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 2.25e-02 0.001 0.7341
1. PBF Q89WP5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.33e-15 2.74e-02 2.76e-08 0.7216
1. PBF B1WR77 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.94e-72 1.88e-114 0.9473
1. PBF A4YJT4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.63e-13 1.42e-02 1.47e-07 0.6904
1. PBF C1C6S2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.43e-79 1.45e-130 0.9364
1. PBF Q0ANF3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.90e-64 1.62e-106 0.9394
1. PBF B0UI96 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.08e-61 1.23e-113 0.9397
1. PBF B9DS62 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.77e-76 2.24e-131 0.9324
1. PBF B4RDH0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.27e-65 3.90e-107 0.9327
1. PBF Q55692 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.42e-60 4.34e-107 0.9583
1. PBF Q2K957 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.97e-51 7.86e-110 0.926
1. PBF C6E557 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.65e-74 6.89e-123 0.9593
1. PBF Q5NL05 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 9.94e-03 1.59e-06 0.7518
1. PBF Q97R84 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.22e-80 2.50e-131 0.9309
1. PBF A5G7S3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.71e-75 5.97e-121 0.9579
1. PBF Q1JLM2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.23e-74 9.90e-133 0.9288
1. PBF Q0V5K1 Kynurenine 3-monooxygenase 2.85e-03 5.87e-04 9.39e-05 0.4055
1. PBF C4L614 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.07e-77 5.69e-138 0.9473
1. PBF Q9MZS9 Kynurenine 3-monooxygenase 2.61e-03 1.58e-02 0.035 0.413
1. PBF B5ZAL6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.22e-15 1.62e-02 3.38e-10 0.719
1. PBF A5D2W5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.74e-80 4.85e-121 0.9536
1. PBF Q043R6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.08e-83 4.47e-126 0.9477
1. PBF B9KRK8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.60e-74 6.47e-107 0.9332
1. PBF A7HXL5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.03e-60 7.81e-109 0.9081
1. PBF Q2RTI8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.74e-37 3.07e-109 0.9349
1. PBF C0MFF9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.81e-76 8.61e-132 0.9332
1. PBF P64233 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.76e-63 9.29e-103 0.9276
1. PBF Q8CPH2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.50e-76 4.95e-140 0.9534
1. PBF B0JFX8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.29e-72 5.36e-108 0.9492
1. PBF P59109 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.58e-62 2.51e-109 0.9532
1. PBF C1CRV5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.48e-79 9.63e-130 0.9345
1. PBF Q2W4D9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.00e-70 5.85e-117 0.9496
1. PBF A3PJ80 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.15e-73 1.39e-106 0.9328
1. PBF Q4A5P8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.55e-15 4.33e-02 1.63e-14 0.7537
1. PBF Q04A02 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.67e-82 4.96e-121 0.9524
1. PBF A5IJ51 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.91e-77 8.84e-128 0.9615
1. PBF B1AI24 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 3.63e-02 3.07e-10 0.7511
1. PBF B0CLM0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.16e-63 4.79e-102 0.9334
1. PBF B9MM32 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.26e-80 1.46e-127 0.9557
1. PBF C0M6C7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.41e-76 2.21e-132 0.9412
1. PBF Q9RYC3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.38e-14 3.86e-03 0.002 0.6958
1. PBF Q8E5M6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.41e-78 8.20e-134 0.9382
1. PBF B1ZWP4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.20e-14 9.02e-03 2.54e-06 0.728
1. PBF B0BZY6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.44e-15 3.12e-02 6.58e-06 0.7445
1. PBF Q2JRF7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.82e-64 1.90e-112 0.9435
1. PBF Q3K1B8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.00e-77 1.20e-134 0.9385
1. PBF A2REF7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.71e-74 2.21e-132 0.9465
1. PBF Q5N5J0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.29e-66 4.06e-111 0.941
1. PBF Q5FKE1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.52e-81 7.55e-120 0.9552
1. PBF Q9Z7T7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.55e-15 8.02e-03 0.004 0.749
1. PBF Q24UF0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.56e-86 1.22e-116 0.9558
1. PBF Q3AX63 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.88e-64 1.77e-117 0.9388
1. PBF Q8Y7K1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.04e-77 3.32e-145 0.9599
1. PBF Q98LE1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.56e-54 2.85e-103 0.9142
1. PBF A4WRQ2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.87e-73 5.87e-107 0.9322
1. PBF Q7U7T2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.47e-61 1.98e-116 0.9481
1. PBF C0ZFA9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.55e-80 1.65e-144 0.9537
1. PBF B7HLG5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.03e-76 5.22e-144 0.9453
1. PBF B7IUJ1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.19e-77 3.30e-144 0.9497
1. PBF Q7NFC3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.92e-63 5.03e-101 0.9531
1. PBF Q81WK3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.43e-77 6.01e-144 0.9499
1. PBF Q72IQ5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.09e-66 2.15e-115 0.9446
1. PBF B8E2F5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.28e-81 6.18e-126 0.9465
1. PBF Q92C76 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.02e-78 4.08e-145 0.9569
1. PBF B2V9U2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.32e-76 5.94e-132 0.6577
1. PBF C1CDT9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.76e-79 2.53e-130 0.9304
1. PBF Q2YXL7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9543
1. PBF Q6ALS7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.61e-77 8.64e-108 0.9431
1. PBF Q9CG79 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.12e-81 3.51e-135 0.9463
1. PBF Q0BYJ6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.54e-63 7.69e-109 0.9283
1. PBF A7INE1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.30e-65 9.67e-108 0.9164
1. PBF Q0AYP4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.09e-81 1.28e-122 0.954
1. PBF A7HL16 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.06e-76 6.06e-117 0.9482
1. PBF A1VBW6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.75e-34 6.05e-107 0.9341
1. PBF C1EP56 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.50e-77 9.09e-144 0.9558
1. PBF B1XK17 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.65e-74 1.13e-107 0.9412
1. PBF Q9RXU7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.24e-38 3.19e-102 0.9374
1. PBF Q1IVV5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.24e-13 2.10e-02 4.53e-04 0.7206
1. PBF Q1JBP0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.23e-74 9.90e-133 0.9461
1. PBF Q213W6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.41e-53 6.49e-109 0.9415
1. PBF Q5HPU1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.50e-76 4.95e-140 0.953
1. PBF A4J5Z8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.76e-84 1.91e-134 0.9608
1. PBF B0TH93 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.92e-82 1.01e-125 0.9518
1. PBF A8ID68 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.74e-66 5.48e-113 0.9335
1. PBF A6U169 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.35e-73 5.18e-137 0.948
1. PBF B1ZES7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.74e-53 3.23e-114 0.9511
1. PBF Q6KID6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.77e-15 9.75e-03 4.84e-10 0.7605
1. PBF A1USB2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.44e-64 2.54e-113 0.9201
1. PBF Q3A7H9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.12e-70 6.41e-118 0.9552
1. PBF P0DB36 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.41e-73 1.57e-131 0.9261
1. PBF Q67PC6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.48e-74 2.84e-118 0.9538
1. PBF A0RHK5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.50e-77 9.09e-144 0.9449
1. PBF Q46K52 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.23e-66 6.14e-116 0.9451
1. PBF Q03KX0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.51e-76 1.05e-132 0.9319
1. PBF Q07MJ4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.66e-54 2.40e-111 0.9401
1. PBF Q5M4M7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.90e-76 1.19e-132 0.9307
1. PBF A5V4M8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.08e-77 5.91e-108 0.938
1. PBF Q02D35 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.79e-14 9.79e-04 8.19e-05 0.7224
1. PBF Q8DZX5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.00e-77 1.20e-134 0.9339
1. PBF Q39X89 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.66e-74 2.68e-121 0.9578
1. PBF A4XIW8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.87e-84 7.68e-128 0.9541
1. PBF B0C6V8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.38e-67 7.31e-106 0.9382
1. PBF P64235 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9541
1. PBF A1B9F0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.64e-73 4.71e-103 0.9405
1. PBF B5YFC6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.62e-82 4.66e-125 0.6647
1. PBF Q8DQ51 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.93e-80 9.20e-131 0.9349
1. PBF A9VT70 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.38e-78 3.56e-144 0.9466
1. PBF Q6F1M4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 1 0.00e+00 9.56e-91 0.0 0.9724
1. PBF A3PDM1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.67e-54 2.56e-108 0.9476
1. PBF Q8UET6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.57e-47 8.97e-109 0.9271
1. PBF Q6G3Y9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.48e-64 1.11e-112 0.9484
1. PBF A5G168 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.55e-15 1.28e-05 2.68e-06 0.6991
1. PBF A8Z5Q4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.51e-14 2.59e-02 6.04e-08 0.745
1. PBF B9KAP3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.28e-75 1.16e-128 0.9622
1. PBF A6U8P9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.65e-50 5.52e-108 0.9415
1. PBF B7JJB0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.06e-77 6.78e-144 0.9503
1. PBF Q98QV8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.11e-15 1.69e-03 4.58e-12 0.7236
1. PBF A9BEK6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.84e-51 6.75e-119 0.9523
1. PBF Q02YZ3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.11e-80 5.93e-134 0.9412
1. PBF B1L7X2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.63e-78 2.27e-129 0.9613
1. PBF Q2JQ64 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.36e-57 5.04e-114 0.9418
1. PBF A2BXA3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.54e-63 5.06e-118 0.9441
1. PBF B1YIB2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.63e-76 9.25e-141 0.9522
1. PBF B5Y8G1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.44e-66 2.67e-88 0.9519
1. PBF B2IGU6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.15e-53 1.54e-109 0.9336
1. PBF Q2G718 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.49e-64 2.94e-100 0.9409
1. PBF Q732N8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.03e-76 5.22e-144 0.9495
1. PBF Q6HEY3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.06e-77 6.78e-144 0.9496
1. PBF A4VUS8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.38e-78 4.79e-132 0.9345
1. PBF Q7NM86 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.99e-15 1.18e-02 1.33e-06 0.7378
1. PBF Q6N5Z1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.83e-55 3.38e-109 0.929
1. PBF A0LDC6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.00e-77 2.81e-112 0.9352
1. PBF Q3SRR6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.99e-56 3.94e-109 0.9277
1. PBF Q2SRN2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 2 0.00e+00 1.33e-78 1.78e-90 0.6612
1. PBF P64236 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9528
1. PBF A9ISB8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.83e-58 1.31e-113 0.9558
1. PBF Q1JGS2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.79e-73 7.61e-134 0.9286
1. PBF B3PNC6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.55e-15 1.81e-03 7.61e-10 0.7056
1. PBF A5ISD5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.35e-73 5.18e-137 0.9479
1. PBF Q2LT41 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.00e-85 1.65e-120 0.9593
1. PBF A1ALD8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.90e-66 7.92e-116 0.9548
1. PBF Q6GHI4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.36e-74 8.27e-137 0.9471
1. PBF A9FRC1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.45e-43 1.42e-100 0.9093
1. PBF C0QTE2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.96e-82 7.92e-129 0.9574
1. PBF Q9PRA6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.44e-15 3.63e-02 3.07e-10 0.7481
1. PBF O68141 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.37e-74 7.52e-103 0.9369
1. PBF A7X1M6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9471
1. PBF Q49X36 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.09e-74 4.17e-137 0.9531
1. PBF Q5WFP8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.83e-80 1.98e-138 0.9532
1. PBF Q11HD9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.18e-59 1.92e-114 0.9188
1. PBF Q38WZ1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.06e-78 4.75e-129 0.9511
1. PBF Q8P106 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.54e-73 2.36e-132 0.9463
1. PBF Q3MA89 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.45e-73 2.66e-107 0.9487
1. PBF A8F516 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.59e-78 3.02e-126 0.6508
1. PBF Q99ZL9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.28e-75 4.15e-133 0.9286
1. PBF A3DCM0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.30e-82 4.04e-137 0.9554
1. PBF Q31AA9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.76e-56 1.20e-105 0.9512
1. PBF B0T866 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.34e-66 5.09e-105 0.9395
1. PBF O66962 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 9.02e-03 0.002 0.735
1. PBF B2A334 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.95e-75 1.22e-141 0.9626
1. PBF Q3AIZ7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.41e-69 5.65e-116 0.9514
1. PBF B7GGC8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.61e-74 1.87e-149 0.9562
1. PBF B1IBA6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.93e-80 9.20e-131 0.9355
1. PBF B9M5T8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.27e-78 1.71e-117 0.9494
1. PBF Q68XT0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.71e-14 4.53e-02 6.82e-09 0.7498
1. PBF Q1MQ25 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.95e-70 1.12e-107 0.9508
1. PBF P64232 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.76e-63 9.29e-103 0.9384
1. PBF Q9S449 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.57e-65 7.92e-104 0.9467
1. PBF A8G5I6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.34e-58 1.62e-104 0.9517
1. PBF Q2NAC8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.36e-70 1.35e-104 0.9457
1. PBF Q5NPP5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.20e-79 5.59e-114 0.9495
1. PBF Q6MTB4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 2 0.00e+00 2.22e-126 0.0 0.9994
1. PBF Q9WZJ3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.00e-78 4.77e-126 0.9582
1. PBF A2RKQ0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.28e-81 1.21e-133 0.9415
1. PBF B7HDV5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.56e-78 1.39e-143 0.9494
1. PBF A5EJU4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.32e-46 3.36e-108 0.9118
1. PBF B1I258 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.45e-74 9.45e-126 0.9544
1. PBF Q5HGI1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9542
1. PBF Q1QMC9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.94e-56 2.50e-109 0.9157
1. PBF P47619 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.00e-15 4.13e-02 6.38e-08 0.7068
1. PBF A2BRU5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.18e-57 3.99e-106 0.9471
1. PBF B9IVC1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.80e-77 9.29e-144 0.9498
1. PBF Q5M014 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.12e-76 6.20e-133 0.9306
1. PBF A7HDU6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.84e-66 2.81e-104 0.9425
1. PBF Q5XC46 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.26e-75 3.12e-134 0.9461
1. PBF A4W125 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.38e-78 4.79e-132 0.9404
1. PBF Q1GTZ7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.67e-66 5.67e-109 0.9533
1. PBF A9MAR7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.53e-63 1.55e-103 0.9204
1. PBF A7NN26 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.72e-14 1.79e-02 3.74e-05 0.7421
1. PBF Q1GGU2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.97e-74 1.62e-103 0.9442
1. PBF Q7NAK6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.78e-15 3.76e-02 4.85e-11 0.755
1. PBF Q6F0T3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 2 0.00e+00 4.31e-84 4.90e-139 0.9239
1. PBF A8FD77 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.84e-74 3.41e-146 0.9556
1. PBF Q2RJP8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.75e-72 3.50e-131 0.6361
1. PBF Q28PE7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.42e-71 1.54e-109 0.9572
1. PBF A9NHD0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.54e-73 3.68e-131 0.966
1. PBF B8JES4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.16e-65 1.58e-108 0.9503
1. PBF Q2SS13 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 1 0.00e+00 1.23e-120 0.0 0.9994
1. PBF Q2ILE0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.34e-71 2.25e-110 0.9379
1. PBF Q88W23 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.63e-79 1.44e-130 0.9476
1. PBF B4UII2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.95e-62 2.62e-108 0.933
1. PBF A2C3G4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.43e-63 1.98e-117 0.9462
1. PBF Q3AB71 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.30e-68 3.00e-111 0.9583
1. PBF Q1G9V1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.14e-82 2.91e-121 0.9522
1. PBF Q834K1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.27e-80 1.26e-141 0.9564
1. PBF C0QPI1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.13e-14 3.80e-02 0.003 0.7285
1. PBF A5VQ76 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.76e-63 9.29e-103 0.9376
1. PBF A7GRG2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.27e-78 7.15e-149 0.9506
1. PBF A6LJK8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.58e-76 4.34e-134 0.958
1. PBF P0CD73 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.44e-15 1.38e-02 0.019 0.7516
1. PBF B7IFU6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.01e-75 1.75e-127 0.9558
1. PBF Q6G9W2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9537
1. PBF A7Z4N3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.36e-76 3.79e-145 0.9499
1. PBF Q2YNL7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.54e-63 8.34e-103 0.9344
1. PBF A5GLJ3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.06e-58 3.43e-117 0.9303
1. PBF Q9A566 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.22e-62 9.41e-99 0.9444
1. PBF Q9KA24 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.65e-83 9.43e-147 0.9533
1. PBF B2IP98 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.22e-80 2.50e-131 0.9357
1. PBF Q819X4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.94e-78 1.32e-143 0.9497
1. PBF B5EHR5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.02e-73 1.08e-124 0.9593
1. PBF A2C8E1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.65e-60 2.59e-115 0.9514
1. PBF A3CN32 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.90e-76 2.01e-136 0.9297
1. PBF C3P5N4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.43e-77 6.01e-144 0.9496
1. PBF Q74A44 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.02e-76 3.75e-123 0.9623
1. PBF Q7TU75 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.83e-59 3.93e-112 0.9466
1. PBF P05428 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.89e-77 3.80e-133 0.9328
1. PBF Q02C58 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.86e-70 7.56e-109 0.9438
1. PBF Q1WU04 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.17e-84 1.69e-129 0.946
1. PBF A6QGF1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9543
1. PBF P64234 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9545
1. PBF C1CK27 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.76e-79 2.53e-130 0.9295
1. PBF Q2IWI0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.86e-55 3.24e-111 0.9403
1. PBF Q2FHI7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9544
1. PBF Q8YNJ4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.27e-73 1.12e-107 0.9454
1. PBF B8ZP43 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.76e-79 2.53e-130 0.936
1. PBF B4U7L4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.10e-61 6.89e-107 0.9325
1. PBF B1H0R2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.11e-15 2.53e-05 3.07e-07 0.7455
1. PBF Q5LST0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.31e-76 2.56e-105 0.9563
1. PBF A5IXW3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.44e-15 2.35e-02 5.83e-07 0.7233
1. PBF A0LE47 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.00e-15 2.76e-02 2.93e-04 0.7219
1. PBF Q720E5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.89e-76 1.12e-144 0.9567
1. PBF Q48TI1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.12e-74 2.25e-134 0.9476
1. PBF Q57DL3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.54e-63 8.34e-103 0.9344
1. PBF Q729K0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.57e-48 6.65e-110 0.9343
1. PBF Q6MTM6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 1 0.00e+00 3.29e-79 1.45e-87 0.6623
1. PBF A8LK18 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.31e-73 5.67e-104 0.9498
1. PBF Q039E2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.28e-75 3.01e-121 0.9585
1. PBF Q1MHL2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.06e-49 1.16e-112 0.9281
1. PBF Q166D3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.22e-75 4.27e-98 0.9586
1. PBF B5E446 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.93e-80 9.20e-131 0.9357
1. PBF A8Z3T1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 0.9473
1. PBF A9VXT4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.11e-51 2.87e-117 0.9315
1. PBF B1M5H7 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.57e-47 7.07e-112 0.9536
1. PBF P0DB37 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.41e-73 1.57e-131 0.9293
1. PBF A0AI79 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 3.10e-77 7.52e-143 0.9573
1. PBF Q636J4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.06e-77 6.78e-144 0.9498
1. PBF Q4L5V3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.32e-74 8.46e-137 0.9537
1. PBF Q8REM9 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.16e-74 1.27e-119 0.9575
1. PBF C3L795 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.43e-77 6.01e-144 0.9496
1. PBF B9KGL7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-13 1.49e-02 2.65e-05 0.7088
1. PBF Q05FY8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.11e-16 7.70e-24 1.33e-06 0.7605
1. PBF Q1J6J1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.51e-76 4.72e-134 0.9464
1. PBF B1HQJ3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.43e-81 1.76e-140 0.9359
1. PBF P39815 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.80e-81 9.94e-142 0.9502
1. PBF A5IXT6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 9.44e-78 1.87e-85 0.657
1. PBF A5GU85 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.42e-64 4.01e-115 0.9353
1. PBF Q0IB24 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.10e-62 8.09e-117 0.9441
1. PBF Q74JJ8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.31e-83 5.67e-125 0.9493
1. PBF B5YJL3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.49e-13 3.83e-02 9.80e-08 0.7263
1. PBF Q1ATM0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.18e-69 1.08e-115 0.9276
1. PBF A8YV48 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.82e-48 5.85e-129 0.9703
1. PBF Q31NM4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 6.29e-66 4.06e-111 0.943
1. PBF Q04KY2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.93e-80 9.20e-131 0.9346
1. PBF A6X1E3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.78e-56 4.95e-107 0.9325
1. PBF Q3KLJ9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.42e-14 1.35e-02 0.019 0.7512
1. PBF Q312C5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.77e-67 1.06e-104 0.9431
1. PBF Q7VD04 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.51e-60 3.22e-115 0.9308
1. PBF Q5SID2 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.59e-66 1.13e-114 0.9479
1. PBF Q65JN6 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.36e-80 2.00e-146 0.9542
1. PBF Q89L21 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.01e-55 8.70e-108 0.9301
1. PBF Q5L6Z0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.11e-15 2.10e-02 0.042 0.7509
1. PBF B9DPG3 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 5.14e-75 2.18e-133 0.9474
1. PBF Q92Q15 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.10e-56 8.19e-111 0.9492
1. PBF O66913 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.40e-71 1.15e-117 0.9611
1. PBF A4YV54 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 8.28e-44 1.54e-105 0.9168
1. PBF Q3J349 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.05e-74 4.68e-106 0.9307
1. PBF Q6MHW5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.30e-65 1.45e-101 0.9514
1. PBF Q1IHM1 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 7.07e-77 9.07e-121 0.952
1. PBF A8AXH0 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 1.45e-77 3.67e-137 0.9312
1. PBF Q1J148 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 2.54e-49 2.12e-100 0.9356
1. PBF Q136I8 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.68e-58 3.31e-108 0.9379
2. PF B0VNF5 D-amino acid dehydrogenase 3.32e-01 6.01e-05 NA 0.3667
2. PF Q55087 Geranylgeranyl diphosphate reductase 5.56e-03 1.33e-06 NA 0.3811
2. PF A8Y432 Kynurenine 3-monooxygenase 4.99e-03 4.63e-07 NA 0.3409
2. PF B0RWG2 D-amino acid dehydrogenase 3.06e-01 4.50e-05 NA 0.3324
2. PF Q1I2V6 D-amino acid dehydrogenase 3.38e-01 2.80e-05 NA 0.3193
2. PF P74306 Zeta-carotene desaturase 5.43e-02 3.15e-02 NA 0.383
2. PF Q2P316 Kynurenine 3-monooxygenase 4.83e-03 4.91e-04 NA 0.3658
2. PF B0U4V3 D-amino acid dehydrogenase 3.22e-01 7.42e-06 NA 0.3123
2. PF B1JLH4 D-amino acid dehydrogenase 4.69e-01 4.25e-05 NA 0.3264
2. PF B0RV00 Kynurenine 3-monooxygenase 6.39e-03 7.66e-05 NA 0.4374
2. PF O50214 Styrene monooxygenase StyA 5.24e-02 2.24e-12 NA 0.3931
2. PF A1CT23 Kynurenine 3-monooxygenase 3.13e-03 2.48e-03 NA 0.3321
2. PF Q88CB1 D-amino acid dehydrogenase 2 2.79e-01 3.55e-05 NA 0.323
2. PF Q8PGC9 D-amino acid dehydrogenase 1.27e-01 2.37e-05 NA 0.3283
2. PF A9IP97 D-amino acid dehydrogenase 2.91e-01 5.75e-05 NA 0.3601
2. PF Q9RAE6 D-amino acid dehydrogenase 2.60e-01 1.04e-03 NA 0.349
2. PF B1M860 D-amino acid dehydrogenase 2.32e-01 4.66e-04 NA 0.338
2. PF Q7Q6A7 Kynurenine 3-monooxygenase 5.76e-03 1.20e-03 NA 0.3516
2. PF P33642 Glycine oxidase 1.51e-02 2.79e-02 NA 0.4884
2. PF Q88BB6 D-amino acid dehydrogenase 2.50e-01 1.38e-05 NA 0.3405
2. PF Q0BUV2 D-amino acid dehydrogenase 3.04e-01 1.82e-02 NA 0.3216
2. PF Q4UT92 Kynurenine 3-monooxygenase 1.60e-02 1.54e-04 NA 0.3485
2. PF J4VWM7 FAD-dependent monooxygenase OpS4 5.44e-03 8.82e-04 NA 0.3639
2. PF B1J4P3 D-amino acid dehydrogenase 2.89e-01 4.55e-05 NA 0.3171
2. PF B7H2E9 D-amino acid dehydrogenase 3.33e-01 3.44e-05 NA 0.3716
2. PF B0V6N4 D-amino acid dehydrogenase 3.49e-01 3.44e-05 NA 0.3381
2. PF B0UBI8 D-amino acid dehydrogenase 1.11e-01 7.87e-04 NA 0.3181
2. PF Q1CJ86 D-amino acid dehydrogenase 1.73e-01 2.87e-05 NA 0.3232
2. PF O06489 Putative oxidoreductase YetM 8.46e-04 1.08e-04 NA 0.3743
2. PF A9BU40 D-amino acid dehydrogenase 1.54e-01 7.84e-05 NA 0.3436
2. PF Q1DDU6 Kynurenine 3-monooxygenase 9.58e-03 4.37e-04 NA 0.3853
2. PF Q2GQG8 Kynurenine 3-monooxygenase 5.11e-03 5.48e-06 NA 0.378
2. PF B0Y7C3 Kynurenine 3-monooxygenase 5.09e-03 9.47e-03 NA 0.3263
2. PF Q7S3C9 Kynurenine 3-monooxygenase 1.75e-03 2.54e-02 NA 0.359
2. PF A2QPD9 Kynurenine 3-monooxygenase 3 6.03e-03 4.66e-04 NA 0.341
2. PF Q1C7V0 D-amino acid dehydrogenase 3.64e-01 2.87e-05 NA 0.3251
2. PF B9K2I7 D-amino acid dehydrogenase 2.93e-01 9.66e-05 NA 0.3321
2. PF B7VMK8 D-amino acid dehydrogenase 4.96e-01 3.50e-03 NA 0.3518
2. PF A9R9D3 D-amino acid dehydrogenase 2.03e-01 2.87e-05 NA 0.3228
2. PF A6UB96 D-amino acid dehydrogenase 2.73e-01 7.39e-04 NA 0.3509
2. PF Q8ZEL7 D-amino acid dehydrogenase 4.73e-01 2.87e-05 NA 0.3258
2. PF A3M0Z0 D-amino acid dehydrogenase 1.92e-01 4.45e-05 NA 0.3301
2. PF A0A4P8GF19 Flavin-dependent monooxygenase eupH 3.70e-03 1.14e-03 NA 0.3725
2. PF Q86PM2 Kynurenine 3-monooxygenase 6.89e-03 7.39e-04 NA 0.3537
2. PF A1DMD5 Kynurenine 3-monooxygenase 3.74e-03 5.80e-03 NA 0.3416
2. PF Q3BV41 Kynurenine 3-monooxygenase 8.46e-03 6.38e-04 NA 0.3356
2. PF Q8PM34 Kynurenine 3-monooxygenase 5.53e-03 3.61e-04 NA 0.3602
2. PF Q6DIZ8 Kynurenine 3-monooxygenase 1.30e-03 6.10e-03 NA 0.4365
2. PF Q9S3U9 Violacein synthase 1.15e-02 7.22e-09 NA 0.3637
2. PF Q3BNX3 D-amino acid dehydrogenase 1.31e-01 3.25e-05 NA 0.319
2. PF Q5H038 Kynurenine 3-monooxygenase 7.58e-03 5.45e-04 NA 0.3527
2. PF Q87AK0 D-amino acid dehydrogenase 2.31e-01 1.29e-05 NA 0.3113
2. PF Q8PAD3 Kynurenine 3-monooxygenase 2.26e-02 1.54e-04 NA 0.4103
2. PF Q0CRI5 Kynurenine 3-monooxygenase 3.72e-03 4.42e-04 NA 0.3713
2. PF A4XD40 Kynurenine 3-monooxygenase 3.87e-03 3.63e-06 NA 0.3906
2. PF A8I711 D-amino acid dehydrogenase 1.52e-01 2.14e-04 NA 0.3205
2. PF B2SIT6 Kynurenine 3-monooxygenase 1.06e-02 6.94e-04 NA 0.3087
2. PF Q7MND7 D-amino acid dehydrogenase 4.88e-01 1.14e-02 NA 0.3571
2. PF A1B072 D-amino acid dehydrogenase 2.40e-01 3.00e-05 NA 0.3575
2. PF Q2UPP1 Kynurenine 3-monooxygenase 4.35e-03 2.86e-03 NA 0.3859
2. PF A8LVF4 Kynurenine 3-monooxygenase 7.37e-03 1.87e-06 NA 0.37
2. PF A0A2G5ICC7 Monooxygenase CTB7 1.06e-03 3.26e-03 NA 0.3668
2. PF A0A2I6PIZ8 FAD-dependent monooxygenase nodY2 1.19e-02 1.42e-03 NA 0.3962
2. PF A0A0E4AFH6 Probable 2-heptyl-3-hydroxy-4(1H)-quinolone synthase AqdB2 5.53e-03 4.70e-05 NA 0.3825
2. PF Q4UQB4 D-amino acid dehydrogenase 1.97e-01 4.30e-05 NA 0.3323
2. PF A2Q9N7 Kynurenine 3-monooxygenase 1 3.81e-03 4.50e-05 NA 0.361
2. PF Q9HU99 D-amino acid dehydrogenase 2 3.40e-02 1.04e-04 NA 0.3791
2. PF C5B9W5 D-amino acid dehydrogenase 1.94e-01 1.51e-03 NA 0.353
2. PF Q66AQ6 D-amino acid dehydrogenase 3.95e-01 2.87e-05 NA 0.3263
2. PF C1DJZ7 D-amino acid dehydrogenase 2.78e-01 2.21e-04 NA 0.3173
2. PF Q8P4Q9 D-amino acid dehydrogenase 2.06e-01 4.30e-05 NA 0.3307
2. PF Q11PP7 Kynurenine 3-monooxygenase 4.43e-03 2.95e-03 NA 0.3908
2. PF Q5B2N0 Kynurenine 3-monooxygenase 4.22e-03 5.58e-03 NA 0.3504
2. PF Q1QXY5 D-amino acid dehydrogenase 2.75e-01 1.24e-02 NA 0.3349
2. PF A4TJC4 D-amino acid dehydrogenase 4.02e-01 8.19e-05 NA 0.324
2. PF P9WM50 Uncharacterized protein MT1298 1.26e-02 1.60e-04 NA 0.3395
2. PF B2K3Q3 D-amino acid dehydrogenase 3.71e-01 2.87e-05 NA 0.3229
2. PF Q4WN75 Kynurenine 3-monooxygenase 3.88e-03 9.47e-03 NA 0.3161
2. PF Q84HF5 Kynurenine 3-monooxygenase 6.28e-03 3.55e-06 NA 0.3772
2. PF P08065 Succinate dehydrogenase flavoprotein subunit 9.82e-03 1.39e-03 NA 0.4109
3. BF Q2STD7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.91e-14 NA 9.79e-06 0.7168
3. BF A3QJS1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.27e-14 NA 5.32e-06 0.6938
3. BF B6JAJ1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.24e-13 NA 3.13e-09 0.6991
3. BF A6M3M4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.42e-14 NA 0.003 0.7247
3. BF A5U9Q7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 1.10e-06 0.7137
3. BF Q72B11 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.57e-14 NA 2.83e-09 0.7377
3. BF A0RLR1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.00e-15 NA 4.17e-06 0.7039
3. BF Q5ZRJ2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.77e-15 NA 5.78e-07 0.7336
3. BF A1T100 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 6.19e-04 0.7503
3. BF Q9F5X1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.94e-14 NA 8.67e-06 0.7285
3. BF C5CW10 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.03e-14 NA 4.14e-08 0.7015
3. BF A0PX78 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.20e-14 NA 0.002 0.7058
3. BF Q3YVP5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 6.85e-06 0.7204
3. BF Q2FDE9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.00e-15 NA 3.23e-08 0.6996
3. BF Q5HCI4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.33e-15 NA 3.23e-08 0.6951
3. BF B1I835 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.44e-15 NA 1.48e-04 0.7112
3. BF B1IHR8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.23e-13 NA 8.23e-05 0.6967
3. BF Q6ND15 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.37e-13 NA 2.35e-08 0.6698
3. BF Q9ZML9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.22e-15 NA 1.42e-08 0.7058
3. BF A8LPC3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.50e-14 NA 7.23e-06 0.6834
3. BF Q7TU19 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.42e-14 NA 6.79e-07 0.6946
3. BF B5QVE1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.77e-15 NA 2.07e-06 0.6972
3. BF Q1R4J1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 1.82e-06 0.7202
3. BF P0CAV0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.30e-14 NA 5.23e-07 0.6999
3. BF Q0TLZ5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.55e-13 NA 4.90e-05 0.7301
3. BF C6DJG3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 2.65e-06 0.7281
3. BF A1WGT2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.34e-14 NA 5.28e-06 0.7013
3. BF Q9WYA1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.33e-15 NA 2.02e-06 0.7637
3. BF Q5QZI8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.61e-13 NA 4.17e-06 0.6861
3. BF A9BQJ1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.77e-15 NA 8.75e-06 0.6962
3. BF A4SC27 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.55e-15 NA 7.64e-09 0.724
3. BF Q6APZ2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.44e-15 NA 1.42e-07 0.756
3. BF Q6YQV5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.45e-14 NA 9.80e-11 0.7434
3. BF B8EDW1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.26e-14 NA 9.15e-05 0.7113
3. BF Q899S1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.18e-14 NA 1.75e-04 0.713
3. BF Q1QSB9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.30e-14 NA 4.28e-06 0.7407
3. BF A1KRM5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.44e-15 NA 0.003 0.6983
3. BF Q1J990 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.66e-15 NA 6.88e-05 0.7115
3. BF B2IJQ4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.73e-14 NA 2.26e-08 0.7085
3. BF A1AVB1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.55e-15 NA 8.56e-07 0.7503
3. BF A5CXV2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.15e-13 NA 2.39e-05 0.6985
3. BF Q63PG8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.75e-14 NA 2.15e-06 0.7232
3. BF A1V8U3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.58e-14 NA 3.10e-06 0.7138
3. BF B5RFV4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.00e-15 NA 2.07e-06 0.7125
3. BF B5FDA8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.83e-14 NA 1.23e-05 0.7
3. BF Q1QBM0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.99e-14 NA 0.003 0.7056
3. BF Q2S6M9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.88e-15 NA 3.58e-05 0.7428
3. BF Q6G5W5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.11e-15 NA 3.06e-08 0.7001
3. BF Q0TAW8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.77e-14 NA 1.82e-06 0.6942
3. BF O51879 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.17e-13 NA 6.04e-08 0.7038
3. BF Q72H88 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.63e-14 NA 1.96e-04 0.7064
3. BF Q317W7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.58e-14 NA 5.99e-05 0.6893
3. BF A6KZP0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.09e-14 NA 0.002 0.7305
3. BF A4TSI4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.54e-14 NA 5.18e-07 0.7039
3. BF Q02DE3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.44e-14 NA 1.88e-05 0.71
3. BF Q11CN3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.90e-13 NA 7.31e-07 0.7053
3. BF Q8D3K0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.09e-14 NA 3.77e-05 0.7025
3. BF Q5F5Y0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.74e-14 NA 0.003 0.6946
3. BF A6TXE4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.16e-13 NA 2.24e-04 0.6959
3. BF Q040F4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.88e-15 NA 2.32e-05 0.7247
3. BF C4LDX1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.83e-14 NA 1.62e-04 0.6998
3. BF Q04MU9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.15e-14 NA 1.55e-04 0.7115
3. BF B2V6C3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.39e-13 NA 0.004 0.6639
3. BF Q9PNA7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.55e-15 NA 2.27e-09 0.7118
3. BF Q329T0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.99e-15 NA 1.41e-06 0.7247
3. BF Q5P4J6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.29e-14 NA 0.035 0.7027
3. BF B0TAB5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.02e-14 NA 1.17e-05 0.7496
3. BF O83084 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.84e-14 NA 4.79e-07 0.6902
3. BF B1KQ45 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.38e-14 NA 1.15e-05 0.7012
3. BF Q4UZP9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.88e-15 NA 2.35e-04 0.6963
3. BF Q2YR12 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.75e-13 NA 1.42e-06 0.69
3. BF Q0VKW3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.48e-14 NA 8.60e-06 0.6925
3. BF A4YCI9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.73e-14 NA 1.51e-05 0.6958
3. BF Q8DDH9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.38e-14 NA 2.34e-05 0.6972
3. BF A9AJF1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.54e-14 NA 1.21e-06 0.7199
3. BF A3PFG3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.63e-14 NA 2.24e-04 0.6924
3. BF Q1I2H6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.49e-14 NA 1.27e-05 0.7448
3. BF A4VS73 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.50e-14 NA 3.56e-06 0.7022
3. BF A4ITX0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.55e-15 NA 1.68e-07 0.7316
3. BF A5CY45 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 2.11e-06 0.7031
3. BF Q110Q9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.89e-15 NA 5.21e-06 0.7152
3. BF A2BTQ6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.40e-14 NA 7.88e-05 0.7077
3. BF A6WUK1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.29e-14 NA 8.84e-05 0.7091
3. BF Q6MGL6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.32e-14 NA 1.77e-09 0.7054
3. BF A6LG59 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.34e-14 NA 8.76e-08 0.7043
3. BF B9JV52 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.88e-15 NA 3.63e-06 0.7626
3. BF B5ER53 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.99e-15 NA 9.05e-05 0.7083
3. BF Q8XAY0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.88e-15 NA 7.54e-07 0.7201
3. BF Q1CCG6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 5.18e-07 0.7152
3. BF A5WGD0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.14e-13 NA 7.89e-05 0.6899
3. BF A9IZX9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.39e-14 NA 2.39e-04 0.7329
3. BF A6Q6Q7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.00e-15 NA 1.48e-08 0.7213
3. BF A7NBA3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.74e-14 NA 3.15e-06 0.71
3. BF Q88RW8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.34e-14 NA 1.88e-05 0.7028
3. BF Q87K98 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.66e-15 NA 7.84e-05 0.7394
3. BF Q13E21 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.78e-13 NA 6.73e-09 0.6736
3. BF Q7VK79 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.68e-14 NA 4.71e-10 0.7525
3. BF Q1CUU1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.55e-15 NA 1.38e-08 0.7107
3. BF Q3B6Y3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.99e-15 NA 4.48e-07 0.7361
3. BF Q0A4L7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.55e-15 NA 6.93e-09 0.7069
3. BF Q48BF4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.21e-14 NA 2.60e-06 0.7283
3. BF Q5H6D9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.80e-14 NA 4.83e-05 0.7253
3. BF A0RQV2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 7.75e-11 0.7117
3. BF A4JA22 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.52e-14 NA 3.38e-06 0.7374
3. BF B4RS92 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.01e-14 NA 2.84e-04 0.711
3. BF Q8DRS6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.33e-15 NA 5.47e-06 0.7528
3. BF B2HUB2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.39e-14 NA 7.45e-06 0.705
3. BF Q8PQE8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.73e-14 NA 1.97e-04 0.6993
3. BF Q7V9J7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.51e-14 NA 6.01e-05 0.7113
3. BF Q15MT3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.34e-14 NA 1.86e-04 0.6952
3. BF Q31KG6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.44e-15 NA 6.99e-06 0.7285
3. BF A7ZTV2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.11e-15 NA 1.82e-06 0.7201
3. BF Q4R4P6 Protein MTO1 homolog, mitochondrial 1.28e-12 NA 7.76e-06 0.6915
3. BF Q663P9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 5.18e-07 0.7113
3. BF Q6CYI6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-15 NA 2.94e-06 0.7089
3. BF P0DB35 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.66e-15 NA 6.82e-05 0.7198
3. BF Q5HTS6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.44e-15 NA 2.71e-09 0.7337
3. BF B0V7I0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.49e-14 NA 7.45e-06 0.7045
3. BF Q2GHA4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.90e-13 NA 1.67e-08 0.6843
3. BF A4WGE6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.07e-06 0.7085
3. BF Q72LR0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.22e-15 NA 1.07e-06 0.7313
3. BF A5F468 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.66e-15 NA 5.39e-05 0.6983
3. BF Q8Z2Q7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.99e-06 0.7139
3. BF B1XSC4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.71e-14 NA 3.14e-05 0.7285
3. BF B7NF57 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.82e-14 NA 1.82e-06 0.7015
3. BF Q1G7Z5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.44e-15 NA 3.44e-06 0.7454
3. BF Q7U3P8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.88e-15 NA 2.34e-07 0.7022
3. BF A8GUR1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.34e-14 NA 1.40e-08 0.7193
3. BF A4W4N0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.66e-15 NA 6.17e-05 0.7225
3. BF B7H0I9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.41e-14 NA 7.72e-06 0.7054
3. BF P53362 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.52e-13 NA 1.53e-06 0.7398
3. BF Q81JH3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 4.17e-06 0.7002
3. BF B1K1K2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.64e-14 NA 3.13e-06 0.7406
3. BF A0LEF5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.25e-14 NA 5.23e-06 0.7455
3. BF A8G1X6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.40e-14 NA 2.37e-06 0.7009
3. BF A8AU87 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.37e-14 NA 1.12e-04 0.7143
3. BF Q7TUW5 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 NA 5.80e-93 0.9292
3. BF Q3YRH0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.98e-13 NA 3.43e-08 0.6917
3. BF A9MJQ9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.33e-15 NA 1.73e-06 0.7163
3. BF A5VA83 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.22e-15 NA 3.91e-05 0.71
3. BF Q0BJM8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.67e-14 NA 3.02e-06 0.737
3. BF A9KLX8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.33e-15 NA 1.65e-06 0.706
3. BF Q1BR97 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.89e-14 NA 2.97e-06 0.7215
3. BF B1JR32 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 5.18e-07 0.7182
3. BF Q0ADD6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.67e-14 NA 4.50e-06 0.7326
3. BF Q24M99 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.55e-15 NA 3.53e-08 0.6677
3. BF B7VN07 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.66e-15 NA 4.97e-07 0.6994
3. BF A7FPL9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.29e-13 NA 7.61e-05 0.6956
3. BF Q5WSS4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.69e-14 NA 1.14e-06 0.7028
3. BF B1X9W9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.70e-14 NA 1.82e-06 0.7045
3. BF Q2A464 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.66e-14 NA 3.15e-06 0.7013
3. BF A3P104 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.70e-14 NA 3.10e-06 0.7162
3. BF Q49UI5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.00e-15 NA 8.83e-09 0.7161
3. BF Q8YJS5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.71e-14 NA 4.04e-06 0.7357
3. BF A6Q5D5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.09e-13 NA 7.95e-08 0.722
3. BF P44763 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.48e-14 NA 1.12e-06 0.7104
3. BF Q31DK8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.30e-14 NA 1.00e-06 0.7055
3. BF A9NBA8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 4.14e-05 0.6806
3. BF Q0SNY6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.11e-14 NA 1.02e-06 0.7271
3. BF Q0BW93 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.45e-14 NA 7.34e-06 0.7232
3. BF B0UWH3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.33e-15 NA 2.82e-08 0.7087
3. BF Q3BYP1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.61e-14 NA 2.29e-04 0.7243
3. BF Q1GCL9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.60e-14 NA 3.54e-05 0.7057
3. BF Q9JX41 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.10e-15 NA 0.005 0.6954
3. BF A1VD34 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.17e-14 NA 3.06e-09 0.728
3. BF Q11PC8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.35e-14 NA 1.48e-06 0.7361
3. BF Q39PR0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.30e-14 NA 4.57e-06 0.7201
3. BF Q1MPS7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.45e-14 NA 4.45e-08 0.7187
3. BF Q0I6D8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.66e-15 NA 3.85e-05 0.7002
3. BF A9VTL9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.33e-15 NA 3.12e-06 0.7244
3. BF A9KX17 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.88e-15 NA 9.00e-05 0.7085
3. BF A0AMD1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.33e-15 NA 2.28e-05 0.7296
3. BF B6JKE5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.55e-15 NA 1.29e-08 0.7171
3. BF B9E8Z3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.81e-06 0.7103
3. BF A4XN50 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.88e-15 NA 8.72e-06 0.7302
3. BF Q4K399 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.54e-14 NA 3.75e-06 0.7012
3. BF Q1MA19 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.34e-13 NA 1.10e-04 0.7015
3. BF Q0AKE9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.42e-14 NA 1.28e-08 0.6925
3. BF Q3AGK9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.55e-15 NA 8.81e-08 0.7284
3. BF A7N0X6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.77e-15 NA 1.99e-04 0.7488
3. BF B3CR62 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.18e-14 NA 3.33e-07 0.6985
3. BF A6VF43 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.44e-14 NA 2.30e-05 0.7033
3. BF Q310P0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.30e-14 NA 7.18e-10 0.7231
3. BF A4VYE0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.77e-15 NA 6.17e-05 0.7182
3. BF Q5FFY7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.33e-13 NA 7.19e-06 0.7002
3. BF C1D5H3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.75e-14 NA 8.81e-07 0.7022
3. BF A4J9S0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.39e-14 NA 5.12e-05 0.7153
3. BF Q3J6M0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.88e-15 NA 4.85e-04 0.7451
3. BF A1WSY5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.65e-14 NA 4.60e-06 0.696
3. BF A5N450 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.12e-13 NA 0.001 0.7125
3. BF P0A3F0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.66e-15 NA 0.002 0.7639
3. BF B7NR43 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.62e-14 NA 1.82e-06 0.7053
3. BF A6UEE8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.00e-15 NA 1.44e-05 0.7168
3. BF C1D0A9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.44e-15 NA 3.74e-04 0.695
3. BF B7M597 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-15 NA 1.82e-06 0.7112
3. BF A6WX77 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.80e-14 NA 1.72e-06 0.7255
3. BF Q0BMJ8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.54e-14 NA 3.15e-06 0.7038
3. BF Q5LWF3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.38e-14 NA 7.86e-05 0.6808
3. BF B0KRB9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.18e-14 NA 1.86e-05 0.7029
3. BF B1YGA7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.55e-15 NA 2.34e-06 0.7339
3. BF A1RQC1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.09e-14 NA 1.51e-05 0.7018
3. BF A4GAI2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.88e-15 NA 2.97e-06 0.701
3. BF A4IYN2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.10e-14 NA 3.20e-06 0.7099
3. BF B0K8H8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.44e-15 NA 3.85e-05 0.718
3. BF Q2K2S1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.43e-14 NA 1.78e-04 0.7511
3. BF Q630B9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 4.06e-06 0.7037
3. BF B1JFV2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.34e-14 NA 2.00e-05 0.729
3. BF Q8EY59 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.44e-15 NA 1.08e-06 0.7196
3. BF B2S1Z2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.80e-14 NA 4.79e-07 0.6792
3. BF Q87TS3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.84e-14 NA 7.74e-06 0.7014
3. BF B0SS01 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.33e-15 NA 2.43e-05 0.7305
3. BF B4SYE2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 2.06e-06 0.7204
3. BF B7MGG1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.82e-06 0.7127
3. BF Q65CN2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.55e-15 NA 1.00e-05 0.7349
3. BF Q3K430 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.13e-14 NA 3.30e-06 0.7409
3. BF Q252Y3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.00e-15 NA 0.027 0.7393
3. BF Q2RFI9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.55e-15 NA 1.40e-06 0.7303
3. BF Q6F0E6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.27e-14 NA 3.71e-09 0.7553
3. BF A3CRB1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.18e-14 NA 6.00e-05 0.7064
3. BF A1SBV1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.45e-14 NA 3.18e-06 0.6936
3. BF Q2S6G8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.24e-14 NA 8.88e-07 0.7239
3. BF B2A469 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.15e-14 NA 3.02e-09 0.733
3. BF A6TG45 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.02e-06 0.7088
3. BF Q17VU9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.89e-15 NA 8.00e-08 0.698
3. BF Q058G2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.88e-15 NA 3.77e-06 0.7442
3. BF Q5FHQ6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.44e-15 NA 6.76e-05 0.75
3. BF A5EV65 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.91e-14 NA 1.04e-08 0.7242
3. BF C1FAF1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.20e-13 NA 3.22e-06 0.7137
3. BF Q5X9C2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.10e-15 NA 6.82e-05 0.7118
3. BF B0RMP9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.22e-15 NA 1.66e-04 0.7201
3. BF A7I199 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.99e-15 NA 1.82e-08 0.7188
3. BF B1L9P0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 1.96e-06 0.7643
3. BF Q1RGT1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.54e-14 NA 1.40e-08 0.7613
3. BF Q2NQ95 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.66e-15 NA 1.19e-07 0.7389
3. BF Q033L1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.78e-13 NA 2.47e-05 0.7172
3. BF C5BKL4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.23e-14 NA 4.86e-05 0.7188
3. BF Q650H5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.25e-13 NA 3.30e-05 0.7058
3. BF A3N2V3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.90e-14 NA 5.56e-06 0.7322
3. BF Q2LXU8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.05e-13 NA 3.27e-08 0.7251
3. BF A8A6K4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 1.82e-06 0.7202
3. BF Q6HAF3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.11e-15 NA 4.17e-06 0.7035
3. BF Q8XH31 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.21e-13 NA 4.94e-05 0.722
3. BF B8EQ21 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.51e-14 NA 0.001 0.7098
3. BF Q3JXU7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.54e-14 NA 3.07e-06 0.7296
3. BF A9NEC4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.00e-15 NA 1.44e-11 0.7389
3. BF Q4L2Z3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.62e-13 NA 1.17e-07 0.7016
3. BF Q1JED6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.77e-15 NA 6.37e-05 0.7116
3. BF A1W0H2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 2.27e-09 0.7324
3. BF A3PNS6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.44e-14 NA 0.050 0.7067
3. BF Q5N1E7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.89e-15 NA 7.24e-06 0.7222
3. BF Q7M9M5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.11e-15 NA 2.54e-09 0.7168
3. BF B8D8G6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.52e-14 NA 2.01e-09 0.7089
3. BF Q6F9Q1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.31e-14 NA 1.68e-06 0.7344
3. BF Q46IB4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.30e-14 NA 1.92e-06 0.692
3. BF B7N2I0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.82e-06 0.72
3. BF B6EHU8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.53e-14 NA 1.49e-05 0.698
3. BF Q6MA36 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.80e-13 NA 2.77e-05 0.7318
3. BF Q9KNG4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.33e-15 NA 5.39e-05 0.7569
3. BF Q1QRZ1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.46e-13 NA 5.07e-07 0.6794
3. BF Q3AP21 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.88e-15 NA 2.00e-08 0.72
3. BF Q3SF55 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.87e-14 NA 1.00e-07 0.7098
3. BF A8HAH4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.88e-15 NA 4.85e-05 0.7185
3. BF C3PM94 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.16e-13 NA 1.45e-07 0.7546
3. BF Q04WG0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.99e-15 NA 2.50e-06 0.7215
3. BF Q47U38 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.11e-15 NA 5.82e-04 0.7558
3. BF Q1JJD7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.99e-15 NA 6.88e-05 0.7198
3. BF B1XYL1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.46e-14 NA 1.93e-05 0.7174
3. BF Q83PJ6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.11e-15 NA 1.79e-06 0.7203
3. BF Q746Q4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-15 NA 9.28e-07 0.7535
3. BF A7MMW3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 5.14e-06 0.7027
3. BF A2RH03 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.44e-15 NA 6.88e-05 0.7245
3. BF B2TUN4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.44e-15 NA 1.99e-06 0.72
3. BF A5IKF8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.77e-15 NA 1.26e-06 0.7636
3. BF A8MKR8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.88e-15 NA 1.01e-04 0.7022
3. BF Q8E8A9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.44e-15 NA 4.22e-05 0.7065
3. BF B7J1B1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.78e-15 NA 1.53e-06 0.7473
3. BF Q16CZ6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.22e-14 NA 7.97e-06 0.7048
3. BF A3DHY7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.48e-14 NA 2.41e-06 0.7078
3. BF Q8DLF8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.22e-15 NA 1.48e-04 0.7016
3. BF A9R5U9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.88e-14 NA 5.18e-07 0.6988
3. BF Q5E1M6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.40e-14 NA 1.23e-05 0.7075
3. BF B0BW03 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.22e-13 NA 1.49e-07 0.7447
3. BF B1IWZ7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.00e-15 NA 1.82e-06 0.7128
3. BF Q8RAT8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1 1.18e-14 NA 1.92e-05 0.7243
3. BF Q7VQW3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.44e-15 NA 7.24e-07 0.7132
3. BF Q8Z9R8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.44e-15 NA 5.18e-07 0.7226
3. BF B0T6E1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.29e-13 NA 7.95e-07 0.7107
3. BF P94613 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 4.14e-05 0.6768
3. BF A7GWM5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.10e-13 NA 2.85e-09 0.7187
3. BF A4STQ4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.22e-15 NA 3.49e-05 0.7179
3. BF P57117 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.74e-14 NA 2.31e-09 0.7268
3. BF Q047G0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.10e-15 NA 6.12e-06 0.7498
3. BF A5VT19 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.15e-13 NA 1.56e-06 0.7019
3. BF O32806 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.11e-15 NA 2.16e-04 0.7425
3. BF Q72WU4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 4.20e-06 0.7033
3. BF A0KR28 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.19e-14 NA 3.49e-05 0.7128
3. BF P56138 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.22e-15 NA 1.34e-08 0.7064
3. BF Q48QN0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.66e-15 NA 6.94e-05 0.7197
3. BF A1JTD9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 2.07e-07 0.7228
3. BF P57945 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.58e-14 NA 9.51e-08 0.7061
3. BF Q7VPP9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.33e-15 NA 3.37e-05 0.7439
3. BF B7UMK6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 1.77e-06 0.7204
3. BF Q21QL5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.60e-13 NA 9.41e-06 0.6759
3. BF B5Z9Y2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.66e-15 NA 1.38e-08 0.7043
3. BF B3Q8A7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.44e-15 NA 2.61e-08 0.6774
3. BF Q8RHA1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1 1.44e-14 NA 1.19e-07 0.7338
3. BF Q5LXK0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.44e-15 NA 3.45e-06 0.7629
3. BF A7H2I7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.55e-15 NA 6.29e-09 0.7354
3. BF B8G0L2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.44e-15 NA 2.86e-08 0.6791
3. BF B1HPM2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.00e-15 NA 1.74e-06 0.7337
3. BF Q5HAN4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.25e-14 NA 4.34e-06 0.7072
3. BF B2T7L1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.43e-14 NA 8.29e-07 0.7303
3. BF A7GVP6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.55e-15 NA 1.73e-06 0.7121
3. BF Q5NFM8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.18e-14 NA 3.15e-06 0.7184
3. BF B2JJL1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.43e-14 NA 1.75e-06 0.7143
3. BF A6GVK0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.15e-14 NA 8.85e-06 0.7369
3. BF C0Q2P1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 1.77e-06 0.7288
3. BF Q5PA19 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.87e-14 NA 2.35e-05 0.7018
3. BF A2CDR8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.00e-15 NA 2.41e-05 0.708
3. BF Q3M790 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.89e-15 NA 6.51e-05 0.7306
3. BF A3DAS5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.94e-14 NA 9.23e-05 0.7039
3. BF A6W3T9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.21e-14 NA 4.90e-04 0.7029
3. BF B1ZGG2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.66e-15 NA 8.30e-08 0.7158
3. BF Q662I6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.11e-14 NA 3.83e-06 0.7355
3. BF A0M6J7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.12e-14 NA 1.74e-04 0.7366
3. BF Q602E7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.67e-15 NA 5.81e-12 0.7565
3. BF A1TI78 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.19e-14 NA 2.21e-06 0.6941
3. BF Q8YR87 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 8.37e-05 0.6906
3. BF Q5M250 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.55e-15 NA 3.45e-06 0.7628
3. BF Q814F7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 4.79e-06 0.7161
3. BF B3H2Q2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.69e-14 NA 5.61e-06 0.7219
3. BF Q2JXG8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.11e-15 NA 1.65e-05 0.7271
3. BF Q0HD68 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.98e-14 NA 3.61e-05 0.6971
3. BF Q6FYB9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.21e-14 NA 5.13e-05 0.6956
3. BF Q8PDG1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.15e-13 NA 2.35e-04 0.6935
3. BF Q0SPQ4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.90e-14 NA 4.94e-05 0.7226
3. BF Q8A2N7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.84e-14 NA 0.001 0.7417
3. BF Q4FSB8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.99e-14 NA 0.004 0.7055
3. BF Q82YX0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.66e-15 NA 1.84e-04 0.7493
3. BF Q4A909 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.78e-15 NA 5.97e-12 0.7616
3. BF B8CVV6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.44e-14 NA 3.28e-05 0.7003
3. BF Q5RB71 Protein MTO1 homolog, mitochondrial 1.34e-12 NA 7.62e-06 0.6991
3. BF Q99XI8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.33e-15 NA 6.53e-05 0.7201
3. BF Q65PZ9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.00e-15 NA 3.96e-08 0.7245
3. BF A6QKK1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-15 NA 3.23e-08 0.6964
3. BF Q67J34 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.20e-14 NA 1.22e-06 0.7438
3. BF A5I815 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.16e-13 NA 7.61e-05 0.6981
3. BF A8EWV0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.42e-13 NA 4.26e-09 0.7142
3. BF B1KUB1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.43e-13 NA 7.54e-05 0.7029
3. BF Q6LLF7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.31e-14 NA 5.43e-04 0.7059
3. BF Q8KA85 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.88e-15 NA 3.45e-08 0.7338
3. BF B8GW33 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.24e-14 NA 5.23e-07 0.7022
3. BF A7GJN8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.38e-13 NA 7.81e-05 0.6921
3. BF Q2P915 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.73e-14 NA 4.83e-05 0.6893
3. BF Q9CEJ4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.55e-15 NA 7.54e-04 0.7424
3. BF Q6MRU5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.08e-14 NA 7.16e-11 0.7424
3. BF B1XJY4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.44e-15 NA 1.98e-05 0.7406
3. BF B4F0D8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.22e-14 NA 3.01e-05 0.7016
3. BF Q2Y5B4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.40e-14 NA 1.30e-06 0.7082
3. BF A1AHS1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.82e-06 0.7203
3. BF C4K911 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.11e-15 NA 1.03e-06 0.712
3. BF Q1C086 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.44e-15 NA 5.18e-07 0.7153
3. BF Q62FS8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.73e-14 NA 3.10e-06 0.7138
3. BF B5YXE5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.55e-15 NA 7.54e-07 0.7245
3. BF Q5SGV8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.30e-14 NA 1.52e-04 0.7062
3. BF Q4QMT9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 3.78e-07 0.7037
3. BF A1U7I5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.23e-14 NA 3.34e-07 0.7035
3. BF B0BRY1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.81e-14 NA 5.37e-06 0.7322
3. BF A1BCG1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.55e-15 NA 8.65e-08 0.6936
3. BF Q0I5W4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.71e-14 NA 2.18e-08 0.7075
3. BF A2S6L0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.59e-14 NA 3.10e-06 0.7172
3. BF B7GMV9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.77e-15 NA 2.14e-05 0.7245
3. BF Q21DG2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.86e-14 NA 7.90e-05 0.7091
3. BF Q6GD93 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.44e-15 NA 3.06e-08 0.6951
3. BF B1M186 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.55e-15 NA 1.31e-08 0.7175
3. BF A5II62 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.92e-14 NA 5.30e-07 0.6973
3. BF Q8DRH8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.24e-14 NA 1.55e-04 0.7167
3. BF A3MQI7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.74e-14 NA 3.10e-06 0.7222
3. BF A5GPI1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.66e-15 NA 2.12e-06 0.7121
3. BF B1LL68 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.82e-06 0.7327
3. BF Q8ZKW6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.55e-15 NA 2.06e-06 0.7124
3. BF Q07UP1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.48e-13 NA 3.87e-08 0.6669
3. BF Q5WAG4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.89e-15 NA 3.87e-05 0.7176
3. BF A6T482 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.20e-14 NA 1.13e-05 0.7132
3. BF Q30P84 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.89e-15 NA 1.63e-07 0.7148
3. BF Q5X0Z8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.48e-14 NA 5.30e-07 0.6972
3. BF Q8CMN6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.55e-07 0.7045
3. BF Q97CW3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.34e-13 NA 1.23e-06 0.7061
3. BF Q8UBM0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.34e-14 NA 1.14e-05 0.7199
3. BF A3NF54 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.70e-14 NA 3.50e-06 0.7204
3. BF Q3AG55 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.47e-13 NA 3.03e-08 0.7056
3. BF P25756 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.77e-14 NA 1.79e-05 0.7035
3. BF Q1J457 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.33e-15 NA 6.94e-05 0.7199
3. BF A4WVY9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.67e-14 NA 0.022 0.706
3. BF Q31UP0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.67e-14 NA 1.82e-06 0.7044
3. BF B5EZ07 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.33e-15 NA 2.06e-06 0.7127
3. BF B0TQG5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.42e-14 NA 2.81e-05 0.7015
3. BF Q3AUG9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.77e-15 NA 7.33e-06 0.7341
3. BF Q82S78 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.00e-15 NA 1.11e-05 0.703
3. BF Q3JYG3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.55e-15 NA 0.002 0.7565
3. BF P59485 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.65e-13 NA 3.04e-06 0.7137
3. BF A6LL84 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.47e-14 NA 1.38e-06 0.7229
3. BF Q2YZB9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.44e-15 NA 3.37e-08 0.6998
3. BF A8EXC3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.14e-13 NA 8.82e-09 0.6962
3. BF Q2NJ23 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.39e-14 NA 1.64e-12 0.7434
3. BF A5CDS8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.28e-14 NA 2.17e-07 0.6999
3. BF Q1IVL5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.15e-13 NA 0.001 0.7216
3. BF A9KBS8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.66e-15 NA 4.14e-05 0.6837
3. BF A9MXB8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 1.95e-06 0.7123
3. BF A8ACP7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.00e-15 NA 1.46e-06 0.7202
3. BF Q8EKU3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.11e-15 NA 4.00e-08 0.7042
3. BF P25812 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.00e-15 NA 3.32e-06 0.7145
3. BF B2US42 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.78e-15 NA 1.46e-08 0.7042
3. BF B7IC15 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.12e-14 NA 7.72e-06 0.7074
3. BF Q13SP0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.45e-14 NA 1.47e-06 0.7115
3. BF B0TY78 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.28e-14 NA 1.88e-06 0.7033
3. BF A4SUS3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.65e-14 NA 7.32e-06 0.724
3. BF Q478A2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.66e-15 NA 4.27e-06 0.7417
3. BF Q02X03 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.33e-15 NA 2.18e-04 0.7457
3. BF B8D6S0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.60e-13 NA 2.04e-09 0.7156
3. BF Q2GD63 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.49e-13 NA 8.47e-08 0.6969
3. BF A6VL66 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.61e-14 NA 1.61e-06 0.7085
3. BF Q97T36 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.24e-14 NA 1.52e-04 0.711
3. BF B3CLI3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.70e-13 NA 3.66e-07 0.703
3. BF B2UGW0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.77e-15 NA 2.21e-05 0.7272
3. BF A8YTQ6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.10e-14 NA 4.45e-04 0.7567
3. BF Q9K1G0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.99e-14 NA 0.002 0.6986
3. BF Q60CS5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.08e-14 NA 8.27e-07 0.7115
3. BF Q71VV1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.11e-15 NA 2.53e-05 0.7441
3. BF Q12HP0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.41e-14 NA 1.14e-05 0.6953
3. BF Q39ZT1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.55e-15 NA 8.75e-07 0.7273
3. BF A7FPF0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.44e-15 NA 4.96e-07 0.7156
3. BF A8FMP4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.44e-15 NA 4.28e-09 0.7279
3. BF Q926U8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.77e-15 NA 2.90e-05 0.7318
3. BF Q9ZE90 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.90e-13 NA 7.06e-09 0.7246
3. BF Q8Y3M5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.77e-15 NA 2.71e-05 0.745
3. BF B2K7J2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.59e-14 NA 5.18e-07 0.7076
3. BF Q2GC38 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.88e-15 NA 0.002 0.698
3. BF Q5PJX1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.55e-15 NA 1.17e-06 0.7202
3. BF Q0HPF0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.98e-14 NA 3.61e-05 0.6974
3. BF Q1LTU7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.52e-14 NA 2.09e-05 0.6946
3. BF B6I3X8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-15 NA 1.82e-06 0.7128
3. BF B1I6S1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.91e-14 NA 0.001 0.7174
3. BF Q57HW9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 2.00e-06 0.7123
3. BF A8GLZ9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.58e-13 NA 1.90e-08 0.72
3. BF A0KQY9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.25e-14 NA 7.97e-05 0.696
3. BF A9BGL2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.04e-14 NA 1.40e-06 0.7133
3. BF B7V7A2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.43e-14 NA 1.88e-05 0.7032
3. BF Q0SYT5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.72e-14 NA 1.79e-06 0.6968
3. BF B0UJI8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.11e-15 NA 9.82e-09 0.7035
3. BF Q7WRF1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.44e-15 NA 0.001 0.6988
3. BF Q12HF2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.09e-14 NA 1.39e-06 0.6947
3. BF A1K1Q4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.59e-14 NA 0.014 0.7425
3. BF A1AXX7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.33e-13 NA 3.81e-05 0.7032
3. BF Q07VT3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.15e-14 NA 1.23e-04 0.6972
3. BF A7HNL1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.77e-15 NA 1.44e-08 0.7671
3. BF Q7NA86 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.10e-14 NA 3.40e-05 0.7184
3. BF B4TAY3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 2.06e-06 0.7122
3. BF Q4AAU6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.67e-15 NA 1.19e-11 0.7579
3. BF P0A6U4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 1.82e-06 0.6971
3. BF B7JB95 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.88e-15 NA 9.05e-05 0.7107
3. BF A8F0G3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.19e-13 NA 2.70e-08 0.753
3. BF Q14H30 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.47e-14 NA 3.15e-06 0.7127
3. BF C4ZZ19 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.82e-06 0.7203
3. BF Q1GP63 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.33e-14 NA 6.05e-05 0.7529
3. BF Q1CVH6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.22e-15 NA 8.21e-07 0.7035
3. BF Q2WBG9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.51e-14 NA 2.64e-06 0.7106
3. BF Q0K5L6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.52e-14 NA 1.97e-06 0.7264
3. BF Q0ATU6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.55e-13 NA 1.54e-06 0.7088
3. BF A5FL86 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.75e-14 NA 4.32e-05 0.7438
3. BF B9M9W3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.34e-14 NA 3.76e-06 0.703
3. BF A5UHB8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.59e-14 NA 1.16e-06 0.7045
3. BF A7ZBK0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.88e-15 NA 1.73e-09 0.7224
3. BF Q03I89 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.88e-15 NA 3.22e-06 0.7625
3. BF Q87DB3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.11e-15 NA 3.58e-05 0.7423
3. BF Q0BWA9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.39e-14 NA 1.90e-08 0.7431
3. BF Q7MTG9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.29e-14 NA 2.01e-05 0.6997
3. BF Q9PBN4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.59e-14 NA 3.49e-05 0.711
3. BF Q056V5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.22e-15 NA 2.50e-06 0.7228
3. BF A8F522 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.30e-14 NA 5.41e-06 0.7319
3. BF A7ZAW0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.55e-15 NA 5.70e-07 0.6929
3. BF Q5LIY5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.60e-14 NA 3.08e-05 0.7429
3. BF B0CJG1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.35e-14 NA 1.41e-06 0.7357
3. BF Q4UN88 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.09e-13 NA 2.73e-08 0.7333
3. BF Q2N6I8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.88e-15 NA 0.017 0.7183
3. BF P64230 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 3.06e-08 0.7001
3. BF Q73GE7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.91e-13 NA 3.93e-07 0.7109
3. BF Q494F8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.10e-15 NA 4.72e-07 0.7571
3. BF B3PIT8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.46e-14 NA 6.39e-05 0.7011
3. BF Q8NZ02 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.66e-15 NA 6.71e-05 0.7116
3. BF B5FN44 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.64e-14 NA 2.07e-06 0.7005
3. BF Q92KW2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.44e-14 NA 4.33e-06 0.7262
3. BF A8GQL7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.31e-13 NA 1.49e-07 0.7502
3. BF A4Y198 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.28e-14 NA 1.01e-05 0.7167
3. BF Q7TUJ1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.18e-14 NA 2.73e-05 0.716
3. BF A1AV42 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.79e-13 NA 5.62e-05 0.7386
3. BF Q8R6K9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2 1.40e-14 NA 8.62e-07 0.7512
3. BF Q74H95 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.66e-15 NA 2.16e-05 0.7225
3. BF Q5HS35 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.88e-15 NA 1.55e-07 0.7049
3. BF A0Q753 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.74e-14 NA 3.49e-06 0.7053
3. BF C4K176 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.23e-13 NA 1.40e-07 0.7579
3. BF A7X7A7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-15 NA 3.06e-08 0.6985
3. BF Q73PH1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.01e-14 NA 9.37e-07 0.6854
3. BF A8FJF9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.33e-15 NA 4.50e-06 0.6952
3. BF B0S904 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.11e-15 NA 2.43e-05 0.7145
3. BF A8GLL0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.77e-15 NA 6.85e-07 0.7086
3. BF P75221 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.11e-15 NA 1.70e-07 0.7256
3. BF A7HSL1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.77e-15 NA 3.49e-05 0.6987
3. BF Q1WVH6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.33e-15 NA 6.90e-05 0.7149
3. BF Q92JI3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.20e-13 NA 1.43e-07 0.7359
3. BF Q9HT09 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.83e-14 NA 1.98e-05 0.7117
3. BF Q7ULV7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.71e-14 NA 6.15e-08 0.7094
4. PB Q6C9M8 Kynurenine 3-monooxygenase 3.18e-03 2.93e-05 0.014 NA
4. PB B0BCD7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.99e-15 1.19e-02 0.022 NA
4. PB Q824M2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.22e-15 2.51e-02 0.027 NA
4. PB A5E8G8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.82e-13 5.10e-03 3.98e-08 NA
4. PB Q9PJP3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.44e-15 4.62e-03 0.008 NA
4. PB A5UY26 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.61e-14 3.46e-02 2.32e-05 NA
4. PB B0B872 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.77e-15 1.19e-02 0.022 NA
4. PB Q2FZ31 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 0.00e+00 4.04e-73 4.35e-137 NA
5. P Q9KDJ5 L-aspartate oxidase 3.66e-02 3.08e-09 NA NA
5. P Q0BTB0 Probable malate:quinone oxidoreductase 3.69e-02 1.78e-04 NA NA
5. P O67931 Sulfide-quinone reductase 7.23e-03 3.63e-02 NA NA
5. P B0BR13 Probable malate:quinone oxidoreductase 7.71e-02 3.09e-02 NA NA
5. P P55349 Hydroxysqualene dehydroxylase 1.09e-01 1.50e-02 NA NA
5. P Q8TVE9 Digeranylgeranylglycerophospholipid reductase 1 1.64e-02 3.59e-05 NA NA
5. P O24913 Malate:quinone oxidoreductase 4.40e-02 4.67e-03 NA NA
5. P Q12YW2 Digeranylgeranylglycerophospholipid reductase 1 1.60e-03 2.82e-04 NA NA
5. P B7H655 Probable malate:quinone oxidoreductase 4.89e-02 1.43e-02 NA NA
5. P B5BEP9 Nitric oxide reductase FlRd-NAD(+) reductase 1.48e-01 1.67e-02 NA NA
5. P A0A0H3LKL4 6-hydroxynicotinate 3-monooxygenase 5.87e-04 1.76e-04 NA NA
5. P A6T923 FAD-dependent urate hydroxylase 8.09e-05 4.60e-05 NA NA
5. P B7LW23 Nitric oxide reductase FlRd-NAD(+) reductase 1.38e-01 4.17e-02 NA NA
5. P B5F365 Nitric oxide reductase FlRd-NAD(+) reductase 1.44e-01 2.71e-02 NA NA
5. P A0A2I1BSV1 FAD-dependent monooxygenase nvfK 5.93e-03 1.74e-03 NA NA
5. P A3MHR1 D-amino acid dehydrogenase 3.41e-01 3.81e-04 NA NA
5. P Q5WY16 Kynurenine 3-monooxygenase 3.02e-03 3.99e-06 NA NA
5. P Q639Y8 Probable malate:quinone oxidoreductase 5.38e-02 1.62e-02 NA NA
5. P Q02N79 2-heptyl-3-hydroxy-4(1H)-quinolone synthase 4.75e-03 6.28e-05 NA NA
5. P A0A4V1E8I5 FAD-dependent monooxygenase eupB 6.75e-03 1.69e-03 NA NA
5. P Q54NS8 Apoptosis-inducing factor homolog B 1.35e-02 1.32e-02 NA NA
5. P A2R6G7 Halogenase otaD 1.18e-02 3.79e-03 NA NA
5. P A0A3B1EFQ2 FAD-dependent monooxygenase str9 2.17e-02 3.34e-06 NA NA
5. P A2C0M6 Probable malate:quinone oxidoreductase 4.04e-02 4.74e-02 NA NA
5. P Q0W349 Digeranylgeranylglycerophospholipid reductase 6.09e-03 7.66e-05 NA NA
5. P Q46904 Probable electron transfer flavoprotein-quinone oxidoreductase YgcN 8.41e-03 2.65e-07 NA NA
5. P C0Z9W8 Probable malate:quinone oxidoreductase 5.69e-02 2.00e-02 NA NA
5. P Q8PU50 Digeranylgeranylglycerophospholipid reductase 2.67e-02 6.23e-06 NA NA
5. P A0QRI8 Menaquinone reductase 1.04e-02 7.79e-03 NA NA
5. P L0E4H0 FAD-dependent monooxygenase phqK 5.93e-03 3.50e-04 NA NA
5. P Q4WLW7 FAD-dependent monooxygenase fmqB 2.02e-02 1.95e-02 NA NA
5. P Q2SY06 D-amino acid dehydrogenase 1.86e-01 1.90e-04 NA NA
5. P Q53552 Salicylate hydroxylase 3.45e-03 2.71e-04 NA NA
5. P A3NXU9 D-amino acid dehydrogenase 3.12e-01 5.81e-04 NA NA
5. P B4TKD3 D-amino acid dehydrogenase 2.12e-01 2.26e-05 NA NA
5. P T2G6Z9 Adenylylsulfate reductase subunit alpha 3.63e-02 1.15e-07 NA NA
5. P Q4WD43 Amino acid oxidase fsqB 1.93e-02 1.51e-04 NA NA
5. P P0A6J6 D-amino acid dehydrogenase 2.40e-01 2.59e-05 NA NA
5. P A6TAW4 D-amino acid dehydrogenase 2.18e-01 3.72e-05 NA NA
5. P Q2SF51 Probable malate:quinone oxidoreductase 4.71e-02 1.61e-02 NA NA
5. P Q1RKF8 UDP-glucose 6-dehydrogenase 3.30e-01 2.22e-02 NA NA
5. P Q68XN9 Succinate dehydrogenase flavoprotein subunit 2.75e-02 1.99e-03 NA NA
5. P Q92206 Squalene monooxygenase 4.89e-03 2.71e-02 NA NA
5. P B7N3Z3 D-amino acid dehydrogenase 1.31e-01 2.59e-05 NA NA
5. P P09820 Protein FixC 6.53e-03 9.23e-10 NA NA
5. P B7N6U1 Nitric oxide reductase FlRd-NAD(+) reductase 1.48e-01 1.39e-02 NA NA
5. P P77337 Probable electron transfer flavoprotein-quinone oxidoreductase YdiS 7.96e-03 7.92e-09 NA NA
5. P A3PRF6 D-amino acid dehydrogenase 2.33e-01 5.14e-05 NA NA
5. P C1EYZ6 Probable malate:quinone oxidoreductase 5.20e-02 1.86e-02 NA NA
5. P B0BTN3 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.66e-01 3.56e-02 NA NA
5. P Q9ZKQ7 D-amino acid dehydrogenase 1.20e-01 1.12e-02 NA NA
5. P E1ACP7 Notoamide E oxidase notB 9.68e-03 6.21e-05 NA NA
5. P P54974 Lycopene beta-cyclase 3.70e-02 9.98e-05 NA NA
5. P P96718 UDP-glucose 6-dehydrogenase YwqF 2.60e-01 3.01e-03 NA NA
5. P A4WDR7 Nitric oxide reductase FlRd-NAD(+) reductase 1.37e-01 3.09e-02 NA NA
5. P P0AC42 Succinate dehydrogenase flavoprotein subunit 1.69e-01 3.39e-03 NA NA
5. P Q465Z7 Digeranylgeranylglycerophospholipid reductase 7.32e-03 1.91e-05 NA NA
5. P P0A6J7 D-amino acid dehydrogenase 2.44e-01 2.59e-05 NA NA
5. P Q54RE8 Kynurenine 3-monooxygenase 8.56e-03 9.04e-05 NA NA
5. P B4RBL4 D-amino acid dehydrogenase 1.82e-01 1.40e-03 NA NA
5. P P96800 Uncharacterized protein Mbar_A1602 8.39e-04 2.80e-03 NA NA
5. P Q8CV11 Probable malate:quinone oxidoreductase 4.87e-02 1.42e-03 NA NA
5. P Q0CJ62 6-methylsalicylic acid decarboxylase atA 4.34e-03 3.25e-05 NA NA
5. P Q9JX24 D-amino acid dehydrogenase 2.74e-01 2.09e-03 NA NA
5. P Q8TQQ6 Digeranylgeranylglycerophospholipid reductase 2.40e-03 1.56e-06 NA NA
5. P G3XMC2 FAD-dependent monooxygenase azaH 2.54e-03 5.31e-03 NA NA
5. P Q6DF46 Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial 5.68e-03 3.11e-04 NA NA
5. P P72835 Uncharacterized protein slr1300 1.07e-03 2.09e-03 NA NA
5. P Q2RMZ4 Ubiquinone hydroxylase UbiL 4.06e-04 3.11e-04 NA NA
5. P A7IHQ4 D-amino acid dehydrogenase 2.17e-01 3.04e-03 NA NA
5. P Q6L0M1 Digeranylgeranylglycerophospholipid reductase 1.46e-03 1.90e-07 NA NA
5. P Q4JA33 Digeranylgeranylglycerophospholipid reductase 1.29e-02 1.87e-06 NA NA
5. P A4SNB0 D-amino acid dehydrogenase 2.53e-01 6.10e-03 NA NA
5. P Q56RZ2 FAD-dependent monooxygenase ltmM 2.03e-03 6.40e-03 NA NA
5. P P64175 Fumarate reductase flavoprotein subunit 2.60e-02 6.87e-04 NA NA
5. P P55931 Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 2.84e-02 6.10e-03 NA NA
5. P Q2NFZ1 Digeranylgeranylglycerophospholipid reductase 1 6.37e-03 8.28e-05 NA NA
5. P A0A0H4TXY1 Flavin-dependent monooxygenase 5.86e-03 1.05e-03 NA NA
5. P A0A0C1BV72 FAD-dependent monooxygenase opaC 1.20e-02 1.14e-03 NA NA
5. P B4TF25 Nitric oxide reductase FlRd-NAD(+) reductase 1.47e-01 9.11e-03 NA NA
5. P A5FMP6 Kynurenine 3-monooxygenase 5.55e-03 2.56e-05 NA NA
5. P A8GFF7 D-amino acid dehydrogenase 3.72e-01 3.28e-05 NA NA
5. P P23262 Salicylate hydroxylase 2.99e-03 1.94e-04 NA NA
5. P Q8DF11 D-amino acid dehydrogenase 3.08e-01 8.59e-03 NA NA
5. P Q735Z0 Probable malate:quinone oxidoreductase 5.37e-02 1.37e-02 NA NA
5. P P25535 2-octaprenylphenol hydroxylase 1.08e-03 2.74e-05 NA NA
5. P Q39IE1 D-amino acid dehydrogenase 1.65e-01 4.23e-04 NA NA
5. P B3H2E6 Probable malate:quinone oxidoreductase 8.25e-02 3.09e-02 NA NA
5. P A0A142C7A0 FAD-dependent monooxygenase phnB 1.25e-03 7.63e-04 NA NA
5. P Q7VFF6 Probable malate:quinone oxidoreductase 5.16e-02 5.98e-03 NA NA
5. P Q57KT2 Nitric oxide reductase FlRd-NAD(+) reductase 1.48e-01 1.11e-02 NA NA
5. P Q92J97 Succinate dehydrogenase flavoprotein subunit 3.74e-02 3.53e-03 NA NA
5. P O06834 Styrene monooxygenase StyA 1.60e-02 2.14e-12 NA NA
5. P Q9HVF1 Probable malate:quinone oxidoreductase 2 4.45e-02 1.22e-02 NA NA
5. P B6I9Q0 D-amino acid dehydrogenase 1.37e-01 2.59e-05 NA NA
5. P A1Z746 Kynurenine 3-monooxygenase 3.25e-03 1.00e-05 NA NA
5. P A4XNV3 D-amino acid dehydrogenase 2.55e-01 6.56e-05 NA NA
5. P Q9SJA7 Probable sarcosine oxidase 8.33e-02 1.24e-02 NA NA
5. P P25534 2-octaprenyl-6-methoxyphenol hydroxylase 9.87e-04 5.54e-06 NA NA
5. P P44894 Fumarate reductase flavoprotein subunit 1.42e-02 7.57e-03 NA NA
5. P B4SUJ5 D-amino acid dehydrogenase 1.60e-01 2.26e-05 NA NA
5. P A3MZ98 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.58e-01 3.56e-02 NA NA
5. P Q9JSX4 L-aspartate oxidase 2.15e-02 1.40e-07 NA NA
5. P Q0TB17 Protein CbrA 2.44e-02 6.49e-05 NA NA
5. P Q51363 L-aspartate oxidase 2.08e-02 6.30e-06 NA NA
5. P A5WAY8 D-amino acid dehydrogenase 2.85e-01 5.03e-05 NA NA
5. P Q4JV42 Probable malate:quinone oxidoreductase 5.16e-02 4.57e-02 NA NA
5. P Q21795 Kynurenine 3-monooxygenase 3.85e-03 3.99e-07 NA NA
5. P C4TP09 4-hydroxybenzoate 3-monooxygenase (NAD(P)H) 3.71e-02 1.23e-04 NA NA
5. P A1A653 Fe-regulated protein 8 5.61e-02 3.90e-03 NA NA
5. P B4T3B2 Nitric oxide reductase FlRd-NAD(+) reductase 1.44e-01 1.08e-02 NA NA
5. P B7ILI6 Probable malate:quinone oxidoreductase 5.23e-02 2.51e-02 NA NA
5. P A0A455LLW0 FAD-dependent monooxygenase atnJ 6.32e-03 1.56e-04 NA NA
5. P A7ZZC3 D-amino acid dehydrogenase 2.43e-01 2.59e-05 NA NA
5. P Q8XQG4 L-aspartate oxidase 2 1.58e-02 1.39e-04 NA NA
5. P A0A1L9WLG2 FAD-dependent monooxygenase AacuC 1.72e-02 3.38e-06 NA NA
5. P Q5HKD6 Probable malate:quinone oxidoreductase 3 2.20e-02 6.32e-04 NA NA
5. P Q329C3 Protein CbrA 2.16e-02 3.93e-04 NA NA
5. P H1VM35 FAD-dependent monooxygenase dpchE 3.73e-03 1.03e-03 NA NA
5. P Q6HHE0 Probable malate:quinone oxidoreductase 5.30e-02 1.86e-02 NA NA
5. P C3LW14 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 1.52e-01 3.30e-02 NA NA
5. P B7LSJ5 D-amino acid dehydrogenase 1.42e-01 6.92e-06 NA NA
5. P B9E972 Oleate hydratase 1.88e-01 3.80e-05 NA NA
5. P A9MFX5 Nitric oxide reductase FlRd-NAD(+) reductase 1.43e-01 1.64e-02 NA NA
5. P B8HAT7 Probable malate:quinone oxidoreductase 2.92e-02 3.21e-02 NA NA
5. P Q5HKN2 Probable malate:quinone oxidoreductase 2 2.79e-02 9.94e-03 NA NA
5. P Q8CVK0 Protein CbrA 2.39e-02 7.25e-05 NA NA
5. P Q2FUA4 Digeranylgeranylglycerophospholipid reductase 3.07e-03 2.80e-06 NA NA
5. P Q60356 Uncharacterized FAD-dependent oxidoreductase MJ0033 1.01e-02 8.29e-04 NA NA
5. P Q8ZQU3 Succinate dehydrogenase flavoprotein subunit 1.58e-02 1.74e-03 NA NA
5. P Q58915 Uncharacterized protein MJ1520 1.12e-02 4.10e-04 NA NA
5. P Q8Z4C4 Nitric oxide reductase FlRd-NAD(+) reductase 1.49e-01 1.05e-02 NA NA
5. P Q9X8N8 L-aspartate oxidase 2.67e-02 1.92e-04 NA NA
5. P Q98F08 D-amino acid dehydrogenase 1 2.76e-01 2.02e-02 NA NA
5. P A0RFE8 Probable malate:quinone oxidoreductase 5.93e-02 2.38e-02 NA NA
5. P B6I697 Nitric oxide reductase FlRd-NAD(+) reductase 1.47e-01 1.58e-02 NA NA
5. P B1XA76 D-amino acid dehydrogenase 1.39e-01 2.59e-05 NA NA
5. P Q9HNS3 Probable anaerobic glycerol-3-phosphate dehydrogenase subunit B 1.68e-01 1.55e-02 NA NA
5. P A9WQR6 Probable malate:quinone oxidoreductase 3.88e-02 3.53e-02 NA NA
5. P Q57NK9 D-amino acid dehydrogenase 2.50e-01 1.25e-05 NA NA
5. P B6JPI8 Probable malate:quinone oxidoreductase 4.94e-02 5.69e-03 NA NA
5. P A8A3I8 Nitric oxide reductase FlRd-NAD(+) reductase 1.50e-01 2.69e-02 NA NA
5. P D7PHZ9 FAD-dependent monooxygenase vrtH 1.89e-03 1.69e-03 NA NA
5. P C4ZYV6 Nitric oxide reductase FlRd-NAD(+) reductase 1.36e-01 3.59e-02 NA NA
5. P B2FL98 Kynurenine 3-monooxygenase 6.78e-03 9.29e-04 NA NA
5. P A9BE38 Probable malate:quinone oxidoreductase 5.46e-02 7.27e-03 NA NA
5. P Q3JQ00 D-amino acid dehydrogenase 2.71e-01 5.81e-04 NA NA
5. P Q8X850 Nitric oxide reductase FlRd-NAD(+) reductase 1.39e-01 3.06e-02 NA NA
5. P C4ZTN0 D-amino acid dehydrogenase 1.41e-01 2.59e-05 NA NA
5. P A6TBU4 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 1.40e-01 1.19e-02 NA NA
5. P A9M3T2 D-amino acid dehydrogenase 3.33e-01 1.65e-03 NA NA
5. P B5XVA0 Nitric oxide reductase FlRd-NAD(+) reductase 1.44e-01 4.09e-02 NA NA
5. P P9WNY8 Menaquinone reductase 1.04e-02 8.84e-03 NA NA
5. P C0LTM1 3-hydroxy-4-methyl-anthranilyl-[aryl-carrier protein] 5-monooxygenase 1.87e-03 3.59e-06 NA NA
5. P Q2U5I0 Probable FAD-dependent monooxygenase kojA 6.32e-02 3.83e-03 NA NA
5. P Q2FIA5 Coenzyme A disulfide reductase 1.11e-01 2.20e-02 NA NA
5. P Q3IXK6 D-amino acid dehydrogenase 2.68e-01 4.02e-05 NA NA
5. P Q6GDJ6 Probable malate:quinone oxidoreductase 2 1.91e-02 7.94e-03 NA NA
5. P A4IMR6 Probable malate:quinone oxidoreductase 8.63e-02 1.24e-02 NA NA
5. P P31456 Protein CbrA 1.30e-02 8.03e-04 NA NA
5. P P68644 Protein FixC 9.01e-03 5.95e-10 NA NA
5. P Q93NG3 2,6-dihydroxypyridine 3-monooxygenase 6.24e-03 2.43e-03 NA NA
5. P B5RDG6 Nitric oxide reductase FlRd-NAD(+) reductase 1.45e-01 1.80e-02 NA NA
5. P A4QF08 Probable malate:quinone oxidoreductase 6.42e-02 8.18e-03 NA NA
5. P P55699 Uncharacterized protein y4xG 6.37e-02 3.50e-04 NA NA
5. P B7UHC3 Nitric oxide reductase FlRd-NAD(+) reductase 1.42e-01 2.66e-02 NA NA
5. P B5QV90 Nitric oxide reductase FlRd-NAD(+) reductase 1.45e-01 1.18e-02 NA NA
5. P A9MVW7 D-amino acid dehydrogenase 2.46e-01 2.26e-05 NA NA
5. P B2JF25 D-amino acid dehydrogenase 3.27e-01 1.14e-04 NA NA
5. P A5VVJ0 D-amino acid dehydrogenase 1.57e-01 4.88e-02 NA NA
5. P Q929Z2 L-aspartate oxidase 7.91e-03 3.29e-09 NA NA
5. P Q7N3Z6 D-amino acid dehydrogenase 2.27e-01 6.87e-04 NA NA
5. P A4JCJ3 D-amino acid dehydrogenase 1.84e-01 7.95e-04 NA NA
5. P Q337B8 Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 2.20e-02 9.75e-03 NA NA
5. P A7FI92 D-amino acid dehydrogenase 3.21e-01 2.87e-05 NA NA
5. P Q8XX54 D-amino acid dehydrogenase 2 1.47e-02 1.17e-03 NA NA
5. P Q579E2 D-amino acid dehydrogenase 1.54e-01 4.88e-02 NA NA
5. P Q87D19 L-aspartate oxidase 1.40e-02 3.51e-08 NA NA
5. P A6U077 Coenzyme A disulfide reductase 1.10e-01 1.69e-02 NA NA
5. P G3KLH4 FAD-dependent monooxygenase adaC 4.90e-03 3.07e-03 NA NA
5. P A0K5P0 D-amino acid dehydrogenase 1.59e-01 2.38e-04 NA NA
5. P B1LQ29 Nitric oxide reductase FlRd-NAD(+) reductase 1.28e-01 2.76e-02 NA NA
5. P Q93L51 Flavin-dependent monooxygenase 3.58e-03 5.14e-05 NA NA
5. P Q7NWR6 D-amino acid dehydrogenase 3.28e-01 1.18e-03 NA NA
5. P B1YV52 D-amino acid dehydrogenase 4.82e-01 3.53e-04 NA NA
5. P Q9F131 3-hydroxybenzoate 6-hydroxylase 1 9.15e-04 4.60e-05 NA NA
5. P G3FLZ8 Flavin-dependent halogenase armH2 5.24e-03 7.87e-03 NA NA
5. P Q81P44 Probable malate:quinone oxidoreductase 7.84e-02 1.86e-02 NA NA
5. P P26484 Protein FixC 6.64e-03 1.55e-10 NA NA
5. P Q7ZAG8 Sulfide-quinone reductase 1.05e-02 1.59e-05 NA NA
5. P P9WN91 Fumarate reductase flavoprotein subunit 2.46e-02 6.87e-04 NA NA
5. P A0A098DME4 FAD-dependent monooxygenase dpfgE 5.35e-03 2.56e-04 NA NA
5. P Q2YWW1 Coenzyme A disulfide reductase 1.13e-01 1.32e-02 NA NA
5. P B7I1Q9 D-amino acid dehydrogenase 2.73e-01 3.44e-05 NA NA
5. P Q8Z4K0 L-aspartate oxidase 9.73e-03 3.19e-06 NA NA
5. P Q5JE27 Digeranylgeranylglycerophospholipid reductase 1.80e-02 1.98e-04 NA NA
5. P A8Z076 Coenzyme A disulfide reductase 1.10e-01 2.20e-02 NA NA
5. P Q5AR56 Monooxygenase asqM 3.24e-02 2.96e-08 NA NA
5. P Q5EXK1 3-hydroxybenzoate 6-hydroxylase 3.00e-04 1.07e-04 NA NA
5. P A0A084B9Z5 FAD-dependent monooxygenase SAT7 8.10e-03 3.83e-03 NA NA
5. P Q8XNE2 L-aspartate oxidase 6.60e-02 5.62e-09 NA NA
5. P A0KJP1 D-amino acid dehydrogenase 2.19e-01 1.95e-02 NA NA
5. P C3LT39 D-amino acid dehydrogenase 4.15e-01 8.55e-04 NA NA
5. P P51585 GDP-mannose 6-dehydrogenase 2.31e-01 4.17e-02 NA NA
5. P Q1BY09 D-amino acid dehydrogenase 1.73e-01 2.38e-04 NA NA
5. P Q9JXD7 Probable malate:quinone oxidoreductase 5.16e-02 1.89e-02 NA NA
5. P A0A4P8DJF6 FAD-dependent monooxygenase dmxR9 2.59e-02 1.54e-04 NA NA
5. P P10902 L-aspartate oxidase 1.10e-02 2.87e-06 NA NA
5. P C5FM59 FAD-dependent monooxygenase nscC 3.04e-03 4.92e-02 NA NA
5. P B5XK69 Oleate hydratase 3.13e-01 1.42e-04 NA NA
5. P Q88Q83 Glycine oxidase 1.08e-02 2.71e-02 NA NA
5. P B0UVX7 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.29e-01 3.27e-02 NA NA
5. P A5CPE3 Probable malate:quinone oxidoreductase 7.20e-02 5.86e-03 NA NA
5. P Q9C447 FAD-dependent monooxygenase paxM 3.44e-03 2.18e-03 NA NA
5. P Q81C25 Probable malate:quinone oxidoreductase 5.32e-02 8.93e-03 NA NA
5. P Q979Y7 Digeranylgeranylglycerophospholipid reductase 2.71e-03 3.20e-07 NA NA
5. P Q887Z4 Probable malate:quinone oxidoreductase 3.19e-02 1.72e-02 NA NA
5. P P75728 3-demethoxyubiquinol 3-hydroxylase 4.40e-04 1.55e-05 NA NA
5. P F2JXJ2 Putative FAD-dependent oxidoreductase LodB 1.13e-02 4.30e-05 NA NA
5. P Q0TII6 D-amino acid dehydrogenase 2.45e-01 2.59e-05 NA NA
5. P A7X0I7 Coenzyme A disulfide reductase 1.11e-01 1.50e-02 NA NA
5. P A5F3D0 D-amino acid dehydrogenase 3.31e-01 1.15e-03 NA NA
5. P P37631 Uncharacterized protein YhiN 5.65e-03 3.33e-03 NA NA
5. P O54068 UDP-glucose 6-dehydrogenase 1.71e-01 8.18e-03 NA NA
5. P Q57952 Digeranylgeranylglycerophospholipid reductase 2.83e-03 9.98e-07 NA NA
5. P O26377 Digeranylgeranylglycerophospholipid reductase 1 7.44e-03 1.84e-06 NA NA
5. P Q9FLC2 Monooxygenase 3 2.36e-02 3.26e-03 NA NA
5. P B7JBP8 Sulfide-quinone reductase 1.14e-02 2.06e-02 NA NA
5. P Q1R7Y9 Nitric oxide reductase FlRd-NAD(+) reductase 1.44e-01 2.08e-02 NA NA
5. P Q83SQ7 Protein FixC 8.32e-03 2.94e-10 NA NA
5. P Q88FY2 6-hydroxynicotinate 3-monooxygenase 1.12e-03 1.54e-03 NA NA
5. P B1MFK1 2-heptyl-3-hydroxy-4(1H)-quinolone synthase 7.03e-03 2.90e-05 NA NA
5. P O30745 D-amino acid dehydrogenase 3.00e-01 3.89e-05 NA NA
5. P B0RIH2 Probable malate:quinone oxidoreductase 8.05e-02 2.18e-03 NA NA
5. P B5XNY5 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.12e-01 3.01e-02 NA NA
5. P A0A2U8U2L4 FAD-dependent monooxygenase asL4 8.67e-04 3.04e-03 NA NA
5. P A0A0M3STX4 FAD-dependent monooxygenase aurC 2.16e-02 1.80e-02 NA NA
5. P B6HN76 FAD-dependent monooxygenase sorC 1.98e-03 2.27e-03 NA NA
5. P A3N262 Probable malate:quinone oxidoreductase 6.54e-02 2.20e-02 NA NA
5. P A7RDN6 Renalase 3.14e-02 4.02e-02 NA NA
5. P B5XQ81 D-amino acid dehydrogenase 3.21e-01 8.10e-05 NA NA
5. P Q0TEG9 Nitric oxide reductase FlRd-NAD(+) reductase 1.42e-01 1.86e-02 NA NA
5. P Q88PU7 Probable malate:quinone oxidoreductase 1 2.31e-02 7.00e-03 NA NA
5. P B3FWT7 Non-heme halogenase rdc2 7.02e-03 1.22e-02 NA NA
5. P O57765 L-aspartate oxidase 1.06e-02 2.79e-12 NA NA
5. P O05897 Uncharacterized protein Rv3254 3.93e-03 2.85e-08 NA NA
5. P B0KQ74 D-amino acid dehydrogenase 2.88e-01 3.55e-05 NA NA
5. P P65422 Probable malate:quinone oxidoreductase 1 4.82e-02 2.90e-02 NA NA
5. P L7WR46 FAD-dependent monooxygenase notI' 5.02e-03 1.00e-02 NA NA
5. P Q8XWM7 L-aspartate oxidase 1 1.00e-02 3.94e-08 NA NA
5. P Q65R09 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.06e-01 2.61e-02 NA NA
5. P B9JI94 D-amino acid dehydrogenase 1.40e-01 4.66e-04 NA NA
5. P A6TCX6 Nitric oxide reductase FlRd-NAD(+) reductase 1.44e-01 4.05e-02 NA NA
5. P P86491 6-hydroxynicotinate 3-monooxygenase 2.82e-03 9.99e-04 NA NA
5. P B0R6S4 Probable anaerobic glycerol-3-phosphate dehydrogenase subunit B 1.62e-01 1.55e-02 NA NA
5. P A2QTE7 FAD-dependent monooxygenase orf3 3.72e-03 1.70e-02 NA NA
5. P A8ANR8 Nitric oxide reductase FlRd-NAD(+) reductase 1.36e-01 4.17e-02 NA NA
5. P Q8ZMJ6 Nitric oxide reductase FlRd-NAD(+) reductase 1.40e-01 1.35e-02 NA NA
5. P P9WJJ8 L-aspartate oxidase 2.75e-02 3.11e-06 NA NA
5. P O57920 Digeranylgeranylglycerophospholipid reductase 1.49e-02 1.06e-05 NA NA
5. P Q8CQ96 Probable malate:quinone oxidoreductase 2 2.32e-02 8.02e-03 NA NA
5. P A7F8U1 Mannitol-1-phosphate 5-dehydrogenase 2.40e-01 1.98e-02 NA NA
5. P Q12WF0 Digeranylgeranylglycerophospholipid reductase 2 5.33e-03 3.35e-04 NA NA
5. P Q981X2 D-amino acid dehydrogenase 3 1.94e-01 1.03e-02 NA NA
5. P Q32H27 D-amino acid dehydrogenase 1.32e-01 2.34e-05 NA NA
5. P A3LNF8 Kynurenine 3-monooxygenase 2.20e-03 4.09e-06 NA NA
5. P Q88EM0 D-amino acid dehydrogenase 1 1.88e-01 1.36e-04 NA NA
5. P Q5HCU5 Probable malate:quinone oxidoreductase 2 1.62e-02 7.94e-03 NA NA
5. P Q01911 Flavin-dependent monooxygenase 3.60e-03 3.51e-05 NA NA
5. P A6US00 Digeranylgeranylglycerophospholipid reductase 2.60e-03 1.26e-06 NA NA
5. P Q7UCT6 D-amino acid dehydrogenase 1.31e-01 2.68e-05 NA NA
5. P B4RR07 D-amino acid dehydrogenase 1.20e-01 9.10e-04 NA NA
5. P O34292 Putative thiamine biosynthesis oxidoreductase ThiO 1.90e-02 2.84e-02 NA NA
5. P Q8NXE8 Coenzyme A disulfide reductase 1.11e-01 2.08e-02 NA NA
5. P Q3S4B7 3-hydroxybenzoate 6-hydroxylase 2.68e-03 9.66e-05 NA NA
5. P Q2NFF7 Digeranylgeranylglycerophospholipid reductase 2 9.58e-03 5.03e-05 NA NA
5. P Q9UYU5 NAD(P)H sulfur oxidoreductase (CoA-dependent) 7.57e-02 4.74e-02 NA NA
5. P Q16134 Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 3.01e-02 1.49e-02 NA NA
5. P Q9ZMY5 Malate:quinone oxidoreductase 4.97e-02 5.21e-03 NA NA
5. P O52582 Coenzyme A disulfide reductase 1.14e-01 1.82e-02 NA NA
5. P B2VJ51 D-amino acid dehydrogenase 3.55e-01 5.93e-04 NA NA
5. P Q3S8R0 6-methylpretetramide 4-monooxygenase 1.70e-03 4.16e-05 NA NA
5. P A1JQN9 D-amino acid dehydrogenase 4.20e-01 2.48e-05 NA NA
5. P G0R6T0 FAD-dependent monooxygenase sor5 3.84e-03 1.04e-03 NA NA
5. P Q9I1S2 Hydrogen cyanide synthase subunit HcnB 2.46e-02 3.19e-03 NA NA
5. P Q9HTQ0 D-amino acid dehydrogenase 1 1.91e-01 7.33e-05 NA NA
5. P B8IJ86 D-amino acid dehydrogenase 2.48e-01 8.46e-04 NA NA
5. P A5V4F9 D-amino acid dehydrogenase 2.19e-01 3.50e-03 NA NA
5. P Q8ZP17 D-amino acid dehydrogenase 1.74e-01 2.26e-05 NA NA
5. P B8NI25 Amino acid oxidase imqH 8.41e-02 2.76e-02 NA NA
5. P Q8KHZ8 Flavin-dependent tryptophan halogenase RebH 7.94e-02 1.72e-02 NA NA
5. P O43029 L-pipecolate oxidase 9.24e-02 1.14e-02 NA NA
5. P Q4P0N0 Kynurenine 3-monooxygenase 3.82e-02 3.28e-04 NA NA
5. P B1XCN8 Nitric oxide reductase FlRd-NAD(+) reductase 1.40e-01 3.59e-02 NA NA
5. P C1I201 Para-nitrophenol 4-monooxygenase 1.41e-05 2.18e-03 NA NA
5. P Q9UTM9 L-saccharopine oxidase 2.03e-02 3.60e-03 NA NA
5. P Q1RLY6 Kynurenine 3-monooxygenase 5.25e-03 8.42e-03 NA NA
5. P A0A0U2JT80 Flavin-dependent halogenase armH3 4.83e-03 3.29e-03 NA NA
5. P Q4WLD1 FAD-dependent monooxygenase pyr5 6.59e-03 1.03e-03 NA NA
5. P Q13VE3 D-amino acid dehydrogenase 2.40e-01 1.96e-04 NA NA
5. P B9J484 Probable malate:quinone oxidoreductase 5.38e-02 1.45e-02 NA NA
5. P Q9PF27 D-amino acid dehydrogenase 2.18e-01 1.00e-05 NA NA
5. P P38032 L-aspartate oxidase 1.54e-02 7.00e-08 NA NA
5. P Q672V4 FAD-dependent monooxygenase atmM 7.26e-03 1.04e-03 NA NA
5. P Q5F5E9 Probable malate:quinone oxidoreductase 7.02e-02 1.82e-02 NA NA
5. P A8AFS0 D-amino acid dehydrogenase 3.74e-01 1.10e-05 NA NA
5. P C6DH98 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.51e-01 3.04e-02 NA NA
5. P P47285 Uncharacterized protein MG039 1.50e-02 1.35e-02 NA NA
5. P Q7W641 D-amino acid dehydrogenase 4.04e-01 8.20e-04 NA NA
5. P A7ZTP5 Protein CbrA 2.38e-02 4.96e-04 NA NA
5. P A0A0U3AL34 Flavin-dependent halogenase armH4 1.39e-02 1.12e-02 NA NA
5. P B5ET22 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 1.80e-01 1.65e-03 NA NA
5. P Q9K107 L-aspartate oxidase 2.17e-02 3.40e-07 NA NA
5. P V3TQ67 Fumarate reductase flavoprotein subunit 8.72e-03 3.87e-02 NA NA
5. P D9PU00 Fumarate reductase (CoM/CoB) subunit A 8.69e-03 8.63e-06 NA NA
5. P A0A1Y0BRF9 FAD-dependent monooxygenase adrH 6.24e-03 8.34e-03 NA NA
5. P A8GG95 Nitric oxide reductase FlRd-NAD(+) reductase 1.08e-01 3.66e-02 NA NA
5. P B1IUA3 D-amino acid dehydrogenase 1.42e-01 2.59e-05 NA NA
5. P O69282 Malate:quinone oxidoreductase 6.60e-02 8.18e-03 NA NA
5. P B5FTN1 D-amino acid dehydrogenase 2.35e-01 2.26e-05 NA NA
5. P Q10058 Putative oxidoreductase C1F5.03c 1.45e-02 4.53e-03 NA NA
5. P D3HKY4 Flavin-dependent monooxygenase 1.07e-02 1.30e-02 NA NA
5. P Q62M46 D-amino acid dehydrogenase 3.54e-01 3.81e-04 NA NA
5. P C0PWN3 Nitric oxide reductase FlRd-NAD(+) reductase 1.47e-01 1.11e-02 NA NA
5. P B4EXU2 D-amino acid dehydrogenase 3.24e-01 1.09e-03 NA NA
5. P B7NJF1 D-amino acid dehydrogenase 1.39e-01 2.59e-05 NA NA
5. P P10331 Protein FixC 6.03e-03 1.47e-09 NA NA
5. P O66973 L-aspartate oxidase 9.18e-03 1.10e-03 NA NA
5. P Q98AV8 L-aspartate oxidase 1.10e-02 4.92e-09 NA NA
5. P B2TZB5 D-amino acid dehydrogenase 1.31e-01 1.84e-05 NA NA
5. P C6DGU9 D-amino acid dehydrogenase 3.21e-01 3.13e-03 NA NA
5. P Q9HKS9 Digeranylgeranylglycerophospholipid reductase 2.59e-03 2.02e-07 NA NA
5. P B3H0P4 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.12e-01 3.56e-02 NA NA
5. P A0M4X2 Kynurenine 3-monooxygenase 9.77e-03 7.58e-05 NA NA
5. P P54982 Phytoene desaturase 1.48e-01 1.11e-04 NA NA
5. P A8A6F0 Protein CbrA 2.56e-02 6.64e-05 NA NA
5. P B1HNU2 Probable malate:quinone oxidoreductase 6.78e-02 4.58e-03 NA NA
5. P Q8TZL4 L-aspartate oxidase 7.39e-03 1.01e-13 NA NA
5. P Q3Z2V9 D-amino acid dehydrogenase 2.46e-01 2.59e-05 NA NA
5. P B7MKI0 Nitric oxide reductase FlRd-NAD(+) reductase 1.38e-01 2.08e-02 NA NA
5. P A5GRE3 Probable malate:quinone oxidoreductase 4.85e-02 6.10e-03 NA NA
5. P Q6GAV6 Coenzyme A disulfide reductase 1.11e-01 2.08e-02 NA NA
5. P A6VJ23 Digeranylgeranylglycerophospholipid reductase 2.27e-03 1.90e-07 NA NA
5. P Q17VT7 Probable malate:quinone oxidoreductase 4.86e-02 1.89e-02 NA NA
5. P A7I9P9 Digeranylgeranylglycerophospholipid reductase 1.97e-03 3.85e-07 NA NA
5. P B4TT18 Nitric oxide reductase FlRd-NAD(+) reductase 1.44e-01 1.37e-02 NA NA
5. P A0A2U8U2L0 FAD-dependent monooxygenase asL6 2.19e-02 9.47e-06 NA NA
5. P A1RVM8 D-proline dehydrogenase 6.86e-02 3.30e-02 NA NA
5. P A6UWL1 Digeranylgeranylglycerophospholipid reductase 6.78e-03 1.70e-06 NA NA
5. P S0DQN6 FAD-dependent monooxygenase fsr3 2.78e-02 1.39e-04 NA NA
5. P C3LEY8 Probable malate:quinone oxidoreductase 5.33e-02 1.86e-02 NA NA
5. P B7JSX2 Probable malate:quinone oxidoreductase 5.12e-02 1.86e-02 NA NA
5. P O01884 Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial 7.15e-03 4.46e-04 NA NA
5. P Q03298 p-hydroxybenzoate hydroxylase 1.11e-02 1.20e-04 NA NA
5. P Q55276 Lycopene beta cyclase 2.07e-02 1.25e-07 NA NA
5. P Q9RW68 Uncharacterized carotenoid cyclase DR_0801 9.91e-03 9.99e-04 NA NA
5. P Q1QUD2 Probable malate:quinone oxidoreductase 4.95e-02 2.27e-03 NA NA
5. P Q5RDD3 Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 2.91e-02 7.06e-03 NA NA
5. P D4GSC3 Digeranylgeranylglycerophospholipid reductase 5.73e-03 1.10e-06 NA NA
5. P B5M9L6 Putative epoxidase LasC 3.31e-03 7.36e-08 NA NA
5. P P53572 Protein FixC 9.21e-03 9.02e-08 NA NA
5. P A0A455LLW9 FAD-dependent monooxygenase ntnJ 4.83e-03 2.24e-05 NA NA
5. P Q31ZN0 D-amino acid dehydrogenase 1.28e-01 2.68e-05 NA NA
5. P A1KRK7 D-amino acid dehydrogenase 3.27e-01 2.07e-03 NA NA
5. P A9WVT6 D-amino acid dehydrogenase 1.53e-01 4.21e-02 NA NA
5. P P53318 Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial 1.50e-02 1.89e-02 NA NA
5. P P38169 Kynurenine 3-monooxygenase 4.31e-03 2.90e-06 NA NA
5. P B7NSJ1 Nitric oxide reductase FlRd-NAD(+) reductase 1.30e-01 2.66e-02 NA NA
5. P Q6LSE4 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.48e-01 3.33e-02 NA NA
5. P P72449 Carotenoid phi-ring synthase 2.01e-01 3.36e-02 NA NA
5. P B5B0J6 FAD-dependent urate hydroxylase 6.13e-05 1.98e-06 NA NA
5. P Q8Y0W7 D-amino acid dehydrogenase 1 3.45e-01 1.59e-05 NA NA
5. P A2QMH1 Kynurenine 3-monooxygenase 2 3.24e-03 1.40e-06 NA NA
5. P P00438 p-hydroxybenzoate hydroxylase 9.18e-03 8.56e-05 NA NA
5. P Q32CL7 Nitric oxide reductase FlRd-NAD(+) reductase 1.39e-01 1.89e-02 NA NA
5. P F8G0M4 6-hydroxy-3-succinoylpyridine 3-monooxygenase HspB 1.01e-05 3.63e-02 NA NA
5. P C5A6E5 Digeranylgeranylglycerophospholipid reductase 1.54e-02 1.11e-04 NA NA
5. P H1ZZA4 Aurachin C monooxygenase/isomerase 2.55e-03 2.74e-04 NA NA
5. P Q7V8S6 Probable malate:quinone oxidoreductase 5.99e-02 1.35e-02 NA NA
5. P Q8Z9K9 Protein FixC 9.43e-03 1.00e-09 NA NA
5. P B4SIE4 D-amino acid dehydrogenase 2.44e-01 1.17e-05 NA NA
5. P B4EAP1 D-amino acid dehydrogenase 2.03e-01 1.67e-04 NA NA
5. P Q99VC0 Coenzyme A disulfide reductase 1.11e-01 1.50e-02 NA NA
5. P M1W850 FAD-dependent monooxygenase CPUR_05423 7.16e-03 2.87e-05 NA NA
5. P P58739 D-amino acid dehydrogenase 2.32e-01 1.72e-02 NA NA
5. P P20922 Fumarate reductase flavoprotein subunit 8.62e-03 5.26e-03 NA NA
5. P A1JIB0 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 1.46e-01 4.25e-02 NA NA
5. P B7UQ73 D-amino acid dehydrogenase 2.40e-01 1.37e-05 NA NA
5. P Q8NLB6 3-hydroxybenzoate 6-hydroxylase 7.33e-03 1.82e-05 NA NA
5. P B2T612 D-amino acid dehydrogenase 2.43e-01 5.63e-04 NA NA
5. P Q2KIL4 Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial 5.58e-03 1.62e-02 NA NA
5. P Q9HWG9 5-methylphenazine-1-carboxylate 1-monooxygenase 2.34e-02 5.12e-04 NA NA
5. P Q2YIL0 D-amino acid dehydrogenase 1.53e-01 4.88e-02 NA NA
5. P B5F4E4 D-amino acid dehydrogenase 1.62e-01 1.03e-05 NA NA
5. P A0A1R3RGJ2 Halogenase otaD 1.13e-02 3.43e-03 NA NA
5. P A2SQK1 Digeranylgeranylglycerophospholipid reductase 4.01e-03 1.04e-04 NA NA
5. P Q6GIB7 Coenzyme A disulfide reductase 1.12e-01 2.56e-02 NA NA
5. P Q6G669 Probable malate:quinone oxidoreductase 2 2.54e-02 7.94e-03 NA NA
5. P Q06DK7 Flavin-dependent monooxygenase 3.48e-03 3.51e-05 NA NA
5. P A0A0U1LQD9 FAD-dependent monooxygenase cctM 7.32e-03 8.02e-03 NA NA
5. P A7MKD3 D-amino acid dehydrogenase 2.28e-01 4.75e-05 NA NA
5. P P59403 Nitric oxide reductase FlRd-NAD(+) reductase 1.36e-01 2.71e-02 NA NA
5. P Q83IZ5 Protein CbrA 2.44e-02 9.14e-05 NA NA
5. P A0A2V5GWU4 FAD-dependent monooxygenase pyvC 4.17e-03 4.14e-04 NA NA
5. P Q3YWC2 Protein CbrA 2.16e-02 7.55e-04 NA NA
5. P A0A097ZPF7 FAD-dependent monooxygenase andE 6.50e-03 7.64e-03 NA NA
5. P Q8Z687 D-amino acid dehydrogenase 1.22e-01 2.16e-05 NA NA
5. P P37339 L-2-hydroxyglutarate dehydrogenase 1.36e-01 8.55e-04 NA NA
5. P P0AC43 Succinate dehydrogenase flavoprotein subunit 3.72e-02 3.39e-03 NA NA
5. P P65423 Probable malate:quinone oxidoreductase 1 5.00e-02 2.90e-02 NA NA
5. P A1AHM5 Protein CbrA 3.08e-02 4.97e-05 NA NA
5. P B7MK86 D-amino acid dehydrogenase 3.04e-01 2.84e-05 NA NA
5. P C0Q330 D-amino acid dehydrogenase 2.50e-01 8.73e-06 NA NA
5. P Q9PC57 L-aspartate oxidase 1.29e-02 1.69e-07 NA NA
5. P C0RM68 D-amino acid dehydrogenase 1.48e-01 4.88e-02 NA NA
5. P A9MCK4 D-amino acid dehydrogenase 1.55e-01 4.05e-02 NA NA
5. P B7LEC2 Nitric oxide reductase FlRd-NAD(+) reductase 1.40e-01 2.98e-02 NA NA
5. P E4V2N4 FAD-dependent monooxygenase nscC 7.13e-03 1.53e-02 NA NA
5. P Q751I2 Kynurenine 3-monooxygenase 3.58e-03 4.92e-05 NA NA
5. P C4L056 Probable malate:quinone oxidoreductase 5.13e-02 8.18e-03 NA NA
5. P A9A6R1 Digeranylgeranylglycerophospholipid reductase 2.47e-03 2.31e-07 NA NA
5. P B2GFJ0 Probable malate:quinone oxidoreductase 5.16e-02 9.38e-03 NA NA
5. P A0A0U5CJU6 FAD-dependent monooxygenase ausM 8.09e-03 1.61e-02 NA NA
5. P Q5VYX0 Renalase 4.21e-02 4.83e-02 NA NA
5. P Q4KCZ0 1H-pyrrole-2-carbonyl-[peptidyl-carrier protein] chlorinase 2.09e-02 1.47e-06 NA NA
5. P A2S4P8 D-amino acid dehydrogenase 3.41e-01 3.81e-04 NA NA
5. P A0A6G9KH61 FAD-dependent monooxygenase nanF 1.98e-03 2.09e-04 NA NA
5. P P31038 Succinate dehydrogenase flavoprotein subunit 3.68e-02 5.31e-03 NA NA
5. P Q9Y2Z9 Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial 5.89e-03 2.59e-02 NA NA
5. P Q8TUV8 Digeranylgeranylglycerophospholipid reductase 2 2.96e-03 6.49e-05 NA NA
5. P A0A059WYP6 Flavin-dependent monooxygenase 9.24e-03 3.13e-03 NA NA
5. P Q8FEN4 Nitric oxide reductase FlRd-NAD(+) reductase 1.38e-01 1.79e-02 NA NA
5. P Q8U4J0 Digeranylgeranylglycerophospholipid reductase 1.66e-02 2.93e-05 NA NA
5. P C5H881 Non-heme halogenase radH 9.44e-03 3.06e-02 NA NA
5. P Q8CMY4 Probable malate:quinone oxidoreductase 4 1.88e-02 4.06e-03 NA NA
5. P A7ZKW0 D-amino acid dehydrogenase 2.60e-01 2.59e-05 NA NA
5. P Q8ZD80 L-aspartate oxidase 9.42e-03 5.49e-07 NA NA
5. P O27753 Digeranylgeranylglycerophospholipid reductase 2 1.15e-02 8.32e-07 NA NA
5. P O25597 D-amino acid dehydrogenase 1.05e-01 9.47e-03 NA NA
5. P Q75F69 Squalene monooxygenase 1.84e-03 4.53e-02 NA NA
5. P Q972D2 L-aspartate oxidase 2.39e-02 1.32e-10 NA NA
5. P Q479B1 D-amino acid dehydrogenase 2.96e-01 2.21e-04 NA NA
5. P Q5AUX8 FAD-dependent monooxygenase dbaH 8.83e-03 2.00e-02 NA NA
5. P B2FLQ1 D-amino acid dehydrogenase 2.49e-01 3.04e-06 NA NA
5. P A0A0E3D8L6 FAD-dependent monooxygenase penM 2.93e-03 2.72e-03 NA NA
5. P B8F6F3 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 1.50e-01 5.98e-03 NA NA
5. P A4VGT8 D-amino acid dehydrogenase 2.60e-01 2.82e-04 NA NA
5. P Q92GB1 UDP-glucose 6-dehydrogenase 3.87e-01 4.57e-02 NA NA
5. P P0A6J5 D-amino acid dehydrogenase 1.60e-01 2.59e-05 NA NA
5. P C7DLJ6 Oleate hydratase 2.12e-01 2.27e-03 NA NA
5. P A5IRE8 Coenzyme A disulfide reductase 1.10e-01 1.69e-02 NA NA
5. P B5FSZ2 Nitric oxide reductase FlRd-NAD(+) reductase 1.47e-01 1.29e-02 NA NA
5. P O81816 Monooxygenase 2 3.07e-02 4.70e-02 NA NA
5. P A5IG23 Kynurenine 3-monooxygenase 2.85e-03 2.70e-06 NA NA
5. P Q53208 Protein FixC 5.07e-03 5.87e-10 NA NA
5. P B7MYL1 Nitric oxide reductase FlRd-NAD(+) reductase 1.51e-01 2.42e-02 NA NA
5. P P0CU30 Kynurenine 3-monooxygenase 1.61e-03 1.36e-04 NA NA
5. P P9WM51 Uncharacterized protein Rv1260 1.27e-02 1.60e-04 NA NA
5. P B4RQQ5 Probable malate:quinone oxidoreductase 4.95e-02 1.82e-02 NA NA
5. P B7MTW7 D-amino acid dehydrogenase 1.38e-01 2.84e-05 NA NA
5. P B1IUW8 Nitric oxide reductase FlRd-NAD(+) reductase 1.41e-01 3.59e-02 NA NA
5. P Q6F6Y2 FAD-dependent urate hydroxylase 7.06e-03 5.48e-06 NA NA
5. P Q31X75 Nitric oxide reductase FlRd-NAD(+) reductase 1.40e-01 3.40e-02 NA NA
5. P P37596 Nitric oxide reductase FlRd-NAD(+) reductase 1.37e-01 3.59e-02 NA NA
5. P Q5HDJ0 Probable malate:quinone oxidoreductase 1 4.69e-02 2.40e-02 NA NA
5. P C5DAE0 Probable malate:quinone oxidoreductase 8.53e-02 4.57e-02 NA NA
5. P Q9KPA4 L-aspartate oxidase 1.00e-02 3.00e-06 NA NA
5. P O65727 Squalene monooxygenase 1,1 2.85e-04 1.34e-02 NA NA
5. P P9WJJ9 L-aspartate oxidase 2.75e-02 3.11e-06 NA NA
5. P P32476 Squalene monooxygenase 4.95e-03 3.98e-02 NA NA
5. P A0A0E4AFG7 Putative 2-heptyl-3-hydroxy-4(1H)-quinolone synthase AqdB1 1.56e-03 2.02e-05 NA NA
5. P A4FZB4 Digeranylgeranylglycerophospholipid reductase 2.46e-03 1.66e-06 NA NA
5. P P26172 Geranylgeranyl diphosphate reductase 1.20e-03 2.46e-03 NA NA
5. P Q0BH74 D-amino acid dehydrogenase 4.14e-01 3.08e-04 NA NA
5. P Q9V2B0 Digeranylgeranylglycerophospholipid reductase 1.58e-02 6.28e-05 NA NA
5. P P68645 Protein FixC 9.31e-03 5.95e-10 NA NA
5. P A6H1P4 Kynurenine 3-monooxygenase 8.65e-03 1.76e-05 NA NA
5. P Q8XA23 L-aspartate oxidase 1.08e-02 1.47e-06 NA NA
5. P C3NZS9 Probable malate:quinone oxidoreductase 5.67e-02 1.86e-02 NA NA
5. P Q6M083 Digeranylgeranylglycerophospholipid reductase 2.34e-03 1.42e-07 NA NA
5. P A7GQI9 Probable malate:quinone oxidoreductase 7.82e-02 2.24e-03 NA NA
5. P B6D1N4 FAD-dependent urate hydroxylase 7.85e-05 3.51e-05 NA NA
5. P Q9C1W3 Probable squalene monooxygenase 6.05e-03 2.59e-03 NA NA
5. P Q97ZC5 L-aspartate oxidase 1.35e-02 2.90e-10 NA NA
5. P Q5HL19 Probable malate:quinone oxidoreductase 4 2.00e-02 3.86e-03 NA NA
5. P Q2W3H2 D-amino acid dehydrogenase 2.64e-01 1.22e-03 NA NA
5. P A0A1U8QHS4 FAD-dependent monooxygenase sdgC 8.13e-02 8.20e-04 NA NA
5. P Q1RHB9 Succinate dehydrogenase flavoprotein subunit 3.80e-02 2.16e-03 NA NA
5. P B6HJU4 FAD-dependent monooxygenase roqM 3.71e-03 1.11e-03 NA NA
5. P B5R2W7 D-amino acid dehydrogenase 2.09e-01 2.26e-05 NA NA
5. P Q56RZ6 FAD-dependent monooxygenase ltmM 1.03e-02 9.20e-03 NA NA
5. P P32614 Fumarate reductase 1 3.43e-02 9.20e-03 NA NA
5. P A2CBH2 Probable malate:quinone oxidoreductase 6.51e-02 2.02e-02 NA NA
5. P D9IL23 Lycopene beta cyclase, chloroplastic 1.65e-02 2.59e-02 NA NA
5. P Q4UJM1 Succinate dehydrogenase flavoprotein subunit 3.82e-02 4.86e-03 NA NA
5. P Q2NER9 Digeranylgeranylglycerophospholipid reductase 3 3.96e-03 1.03e-06 NA NA
5. P B2U036 Nitric oxide reductase FlRd-NAD(+) reductase 1.48e-01 3.59e-02 NA NA
5. P A0A0E3D8L5 FAD-dependent monooxygenase janM 2.46e-03 2.48e-03 NA NA
5. P Q49617 L-aspartate oxidase 2.50e-02 4.30e-07 NA NA
5. P Q58582 Uncharacterized protein MJ1182 2.15e-03 1.80e-09 NA NA
5. P A6QFI1 Coenzyme A disulfide reductase 1.11e-01 2.20e-02 NA NA
5. P A1V6K0 D-amino acid dehydrogenase 3.82e-01 3.81e-04 NA NA
5. P Q0T5L2 D-amino acid dehydrogenase 1.32e-01 2.68e-05 NA NA
5. P Q1CV68 Probable malate:quinone oxidoreductase 5.27e-02 4.95e-03 NA NA
5. P Q6D4N9 D-amino acid dehydrogenase 1.61e-01 1.22e-03 NA NA
5. P Q48PZ1 D-amino acid dehydrogenase 2.22e-01 9.34e-05 NA NA
5. P Q59661 Succinate dehydrogenase flavoprotein subunit 3.59e-02 1.46e-02 NA NA
5. P Q89T28 D-amino acid dehydrogenase 3.09e-01 3.69e-02 NA NA
5. P Q50008 Coproporphyrinogen III oxidase 6.23e-02 4.45e-02 NA NA
5. P A3NC12 D-amino acid dehydrogenase 3.57e-01 3.81e-04 NA NA
5. P Q01331 Lycopene beta-cyclase 4.90e-02 2.16e-05 NA NA
5. P A1KWH2 Probable malate:quinone oxidoreductase 4.62e-02 1.38e-02 NA NA
5. P A1R7M9 Probable malate:quinone oxidoreductase 5.19e-02 3.66e-02 NA NA
5. P Q7SHH9 FAD-dependent monooxygenase srdH 7.73e-03 6.16e-03 NA NA
5. P O85227 Hydrogen cyanide synthase subunit HcnB 2.02e-02 1.49e-02 NA NA
5. P A0ST45 Monooxygenase CTB7 4.29e-03 1.67e-03 NA NA
5. P Q9V2R0 L-aspartate oxidase 1.03e-02 8.68e-12 NA NA
5. P Q5A7M3 Kynurenine 3-monooxygenase 3.08e-03 7.58e-05 NA NA
5. P Q89XM4 Probable malate:quinone oxidoreductase 2.59e-02 2.90e-02 NA NA
5. P P9WJJ0 NADH dehydrogenase-like protein MT1860 1.51e-02 1.06e-03 NA NA
5. P B5Z372 Nitric oxide reductase FlRd-NAD(+) reductase 1.38e-01 3.06e-02 NA NA
5. P Q6G6V5 Probable malate:quinone oxidoreductase 1 4.89e-02 2.90e-02 NA NA
5. P A9ADT7 D-amino acid dehydrogenase 1.95e-01 8.29e-04 NA NA
5. P Q0T1D6 Nitric oxide reductase FlRd-NAD(+) reductase 1.45e-01 2.71e-02 NA NA
5. P Q6GE66 Probable malate:quinone oxidoreductase 1 4.79e-02 3.63e-02 NA NA
5. P A0B573 Digeranylgeranylglycerophospholipid reductase 1.12e-02 8.73e-07 NA NA
5. P Q8ZMX9 L-aspartate oxidase 9.72e-03 3.67e-06 NA NA
5. P Q5E0X7 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 1.99e-01 8.64e-04 NA NA
5. P Q9S3U8 Protodeoxyviolaceinate monooxygenase 5.04e-03 9.11e-10 NA NA
5. P O81815 Monooxygenase 1 1.05e-02 6.32e-04 NA NA
5. P Q0C9L4 FAD-dependent monooxygenase ctvC 6.31e-03 1.49e-03 NA NA
5. P L7WME6 Notoamide E oxidase notB' 1.35e-02 3.51e-05 NA NA
5. P B6HV36 FAD-dependent monooxygenase adrH 3.24e-03 9.38e-03 NA NA
5. P A5ABG5 FAD-dependent monooxygenase pynG 2.15e-02 8.46e-04 NA NA
5. P A3KEZ1 D-amino acid dehydrogenase 1.11e-01 8.84e-03 NA NA
5. P Q92XP4 Opine oxidase subunit A 3.66e-02 1.18e-02 NA NA
5. P B8GGQ9 Digeranylgeranylglycerophospholipid reductase 7.03e-03 9.76e-05 NA NA
5. P Q9I0Q0 2-heptyl-3-hydroxy-4(1H)-quinolone synthase 2.50e-02 5.81e-05 NA NA
5. P Q7AHT0 Protein FixC 9.60e-03 7.12e-10 NA NA
5. P Q0SYN3 Protein CbrA 2.44e-02 9.34e-05 NA NA
5. P P00363 Fumarate reductase flavoprotein subunit 1.01e-02 4.76e-03 NA NA
5. P Q97K95 L-aspartate oxidase 4.25e-03 2.09e-09 NA NA
5. P Q8CQE8 Probable malate:quinone oxidoreductase 3 2.51e-02 5.34e-04 NA NA
5. P Q6UPE1 Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 2.85e-02 1.49e-02 NA NA
5. P O65992 Mannitol-1-phosphate 5-dehydrogenase 2.89e-01 3.80e-02 NA NA
5. P Q5HHB4 Coenzyme A disulfide reductase 1.10e-01 2.12e-02 NA NA
5. P Q3YYF3 Nitric oxide reductase FlRd-NAD(+) reductase 1.41e-01 2.10e-02 NA NA
5. P Q7A6H1 Coenzyme A disulfide reductase 1.10e-01 1.50e-02 NA NA
5. P B7LGU9 D-amino acid dehydrogenase 2.53e-01 2.59e-05 NA NA
5. P A0A2I6PIZ2 FAD-dependent monooxygenase nodM 6.40e-03 3.69e-04 NA NA
5. P Q4L4Y7 Coenzyme A disulfide reductase 1.42e-01 2.74e-02 NA NA
5. P Q5PCU1 D-amino acid dehydrogenase 2.45e-01 1.03e-05 NA NA
5. P Q9KTV1 D-amino acid dehydrogenase 3.84e-01 8.55e-04 NA NA
5. P A3CST9 Digeranylgeranylglycerophospholipid reductase 1.26e-02 1.18e-05 NA NA
5. P Q8YXJ6 L-aspartate oxidase 2.68e-02 9.47e-03 NA NA
5. P Q5PF36 Nitric oxide reductase FlRd-NAD(+) reductase 1.42e-01 1.67e-02 NA NA
5. P A7ZQE0 Nitric oxide reductase FlRd-NAD(+) reductase 1.49e-01 3.59e-02 NA NA
5. P E1ACQ4 FAD-dependent monooxygenase notI 4.37e-03 3.01e-03 NA NA
5. P Q54EN1 Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial 7.33e-03 1.62e-02 NA NA
5. P A0A140JWT1 FAD-dependent monooxygenase ptmM 3.98e-03 2.00e-04 NA NA
5. P Q9HNZ0 L-aspartate oxidase 5.39e-03 3.71e-07 NA NA
5. P Q9HTK9 Rubredoxin-NAD(+) reductase 1.09e-01 3.24e-02 NA NA
5. P B8M9J8 FAD-dependent monooxygenase tropB 4.71e-03 6.71e-05 NA NA
5. P Q5F5W1 D-amino acid dehydrogenase 1.15e-01 9.10e-04 NA NA
5. P A4WBF2 D-amino acid dehydrogenase 3.03e-01 2.37e-05 NA NA
5. P A1TFU9 FAD-dependent urate hydroxylase 4.06e-03 8.65e-05 NA NA
5. P P0AC41 Succinate dehydrogenase flavoprotein subunit 3.68e-02 3.39e-03 NA NA
5. P Q5E3X0 Nitric oxide reductase FlRd-NAD(+) reductase 9.09e-02 2.04e-02 NA NA
5. P O29786 Digeranylgeranylglycerophospholipid reductase 3.19e-03 1.78e-04 NA NA
5. P B1JXT8 D-amino acid dehydrogenase 1.64e-01 2.98e-04 NA NA
5. P B5BI50 D-amino acid dehydrogenase 1.11e-01 1.03e-05 NA NA
5. P P20586 p-hydroxybenzoate hydroxylase 9.99e-03 8.65e-05 NA NA
5. P A9MP60 D-amino acid dehydrogenase 3.68e-01 8.01e-05 NA NA
5. P A5UNX8 Digeranylgeranylglycerophospholipid reductase 6.96e-04 5.56e-07 NA NA
5. P B2I8Y3 D-amino acid dehydrogenase 2.08e-01 1.29e-05 NA NA
5. P Q9JWK3 Probable malate:quinone oxidoreductase 4.45e-02 1.98e-02 NA NA
5. P Q6BV21 Kynurenine 3-monooxygenase 2.73e-03 3.00e-06 NA NA
5. P Q1R4P6 Protein CbrA 2.45e-02 4.97e-05 NA NA
5. P P9WNY9 Menaquinone reductase 1.12e-02 8.84e-03 NA NA
5. P Q5BEJ7 FAD-dependent monooxygenase afoD 4.13e-03 5.38e-05 NA NA
5. P A2QX24 FAD-dependent monooxygenase adaC 5.37e-03 2.16e-03 NA NA
5. P P99115 Probable malate:quinone oxidoreductase 2 2.63e-02 7.94e-03 NA NA
5. P Q1H378 D-amino acid dehydrogenase 2.72e-01 5.75e-03 NA NA
5. P P65421 Probable malate:quinone oxidoreductase 1 4.87e-02 2.90e-02 NA NA
5. P Q92R32 L-aspartate oxidase 1.96e-02 4.45e-05 NA NA
5. P B4TXX3 D-amino acid dehydrogenase 3.03e-01 1.03e-05 NA NA
5. P Q7VM49 Anaerobic glycerol-3-phosphate dehydrogenase subunit B 2.95e-01 1.29e-02 NA NA
5. P P9WEY1 FAD-dependent monooxygenase dpmaE 4.85e-03 8.84e-03 NA NA
5. P P9WN90 Fumarate reductase flavoprotein subunit 2.54e-02 6.87e-04 NA NA
5. P Q921G7 Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 2.77e-02 1.06e-02 NA NA
5. P P9WJJ1 NADH dehydrogenase-like protein Rv1812c 1.51e-02 1.05e-03 NA NA
5. P Q4ZZW4 D-amino acid dehydrogenase 2.46e-01 1.02e-04 NA NA
5. P Q9A4C3 L-aspartate oxidase 1.28e-02 7.28e-07 NA NA
5. P P65500 L-aspartate oxidase 2.51e-02 3.11e-06 NA NA
5. P Q5L055 Probable malate:quinone oxidoreductase 8.57e-02 4.92e-02 NA NA
5. P P21687 Lycopene beta-cyclase 1.10e-01 1.78e-03 NA NA
5. P Q0CF72 FAD-dependent monooxygenase ATEG_07662 5.64e-03 5.47e-03 NA NA
5. P B7M9E8 Nitric oxide reductase FlRd-NAD(+) reductase 1.40e-01 2.98e-02 NA NA
5. P Q7WI07 D-amino acid dehydrogenase 3.15e-01 1.60e-03 NA NA
5. P B7HVJ1 Probable malate:quinone oxidoreductase 8.11e-02 1.45e-02 NA NA
5. P B7LXA3 D-amino acid dehydrogenase 1.35e-01 2.59e-05 NA NA
5. P A0A2U8U2L6 Salicylate hydroxylase asL1 7.33e-03 2.62e-04 NA NA
5. P A0A2I6PJ01 FAD-dependent monooxygenase nodY1 3.92e-03 3.73e-04 NA NA
5. P A0A3G9GX61 FAD-dependent monooxygenase cdmI 5.08e-03 3.56e-02 NA NA
5. P A1AEQ1 Nitric oxide reductase FlRd-NAD(+) reductase 1.41e-01 2.08e-02 NA NA
5. P P9WEX4 FAD-dependent monooxygenase dpasE 4.75e-03 4.14e-03 NA NA
5. P Q98B75 D-amino acid dehydrogenase 2 3.23e-01 9.89e-04 NA NA
5. P Q64133 Amine oxidase [flavin-containing] A 8.79e-02 2.00e-02 NA NA
5. P D0VWY5 Glutathione amide reductase 7.52e-02 3.30e-02 NA NA
5. P P26294 15-cis-phytoene desaturase 1.78e-01 3.26e-03 NA NA
5. P Q8ZRW9 Protein FixC 9.21e-03 8.27e-10 NA NA
5. P Q5BH33 FAD-dependent monooxygenase mdpD 2.56e-02 2.05e-04 NA NA
5. P A0A2I1C3T9 FAD-dependent monooxygenase nsrK 9.24e-03 2.42e-05 NA NA
5. P Q0UI13 FAD-dependent monooxygenase elcH 1.75e-02 3.28e-05 NA NA
5. P P9WEQ4 FAD-dependent monooxygenase olcE 6.27e-03 1.98e-04 NA NA
5. P Q2IZZ7 D-amino acid dehydrogenase 3.37e-01 5.80e-03 NA NA
5. P Q8GAJ0 4-methylaminobutanoate oxidase (methylamine-forming) 5.38e-02 1.81e-03 NA NA
5. P G4V4G6 Succinate dehydrogenase flavoprotein subunit 1.78e-02 7.79e-04 NA NA
5. P Q60151 Glutathione reductase 5.93e-02 4.05e-02 NA NA
5. P K2QVI4 FAD-dependent monooxygenase dpmpE 5.73e-03 8.46e-05 NA NA
5. P Q6FFR5 D-amino acid dehydrogenase 1.86e-01 1.57e-03 NA NA
5. P P51054 Succinate dehydrogenase flavoprotein subunit 3.13e-02 1.35e-03 NA NA
5. P Q7M827 8-methylmenaquinol:fumarate reductase flavoprotein subunit 2.89e-02 2.92e-02 NA NA
5. P P65424 Probable malate:quinone oxidoreductase 2 2.54e-02 7.94e-03 NA NA
5. P Q73VU0 Probable malate:quinone oxidoreductase 8.38e-02 9.65e-03 NA NA
5. P Q8U8J4 L-aspartate oxidase 1.25e-02 4.25e-08 NA NA
5. P A0A1E1FFL6 FAD-dependent monooxygenase prhF 6.91e-03 2.35e-02 NA NA
5. P Q9Z9Q7 Probable malate:quinone oxidoreductase 4.84e-02 2.02e-02 NA NA
5. P P74562 L-aspartate oxidase 1.35e-02 7.92e-05 NA NA
5. P Q8NUM4 Probable malate:quinone oxidoreductase 2 2.55e-02 5.15e-03 NA NA
5. P B2SDA2 D-amino acid dehydrogenase 1.56e-01 4.88e-02 NA NA
5. P A9M485 Probable malate:quinone oxidoreductase 4.91e-02 2.38e-02 NA NA
5. P Q9K1H5 D-amino acid dehydrogenase 3.24e-01 1.76e-03 NA NA
5. P Q8XBZ8 Protein CbrA 2.24e-02 8.55e-04 NA NA
5. P P0DOW1 Asperlicin C monooxygenase 3.23e-03 3.81e-04 NA NA
5. P D4B1Y1 Probable FAD-dependent monooxygenase 6.08e-03 1.51e-04 NA NA
5. P Q63S25 D-amino acid dehydrogenase 3.43e-01 4.10e-04 NA NA
5. P A9N0E0 Nitric oxide reductase FlRd-NAD(+) reductase 1.45e-01 2.02e-02 NA NA
5. P Q8YD04 D-amino acid dehydrogenase 1.53e-01 4.88e-02 NA NA
5. P Q6Q2J0 Amine oxidase [flavin-containing] A 8.28e-02 4.17e-02 NA NA
5. P Q8Y5N4 L-aspartate oxidase 1.52e-02 1.19e-08 NA NA
5. P Q2KIG0 Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial 2.72e-02 8.18e-03 NA NA
6. F A4SVT8 Ferredoxin--NADP reductase 1.39e-01 NA NA 0.3176
6. F B6HZX3 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 2.54e-03 NA NA 0.3975
6. F B7M2Z5 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 2.50e-03 NA NA 0.3922
6. F Q4L978 4,4'-diaponeurosporene oxygenase 1.24e-01 NA NA 0.3629
6. F Q3M859 Bifunctional protein ThiO/ThiG 1.32e-01 NA NA 0.3918
6. F B7MPB4 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 3.28e-03 NA NA 0.4181
6. F M1WCF5 Monoogygenase CPUR_05431 3.66e-02 NA NA 0.3595
6. F Q5HCY6 4,4'-diaponeurosporene oxygenase 1.12e-01 NA NA 0.3547
6. F Q2Y7P9 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC 1.48e-01 NA NA 0.3634
6. F Q31N27 Probable zeta-carotene desaturase 5.51e-02 NA NA 0.397
6. F Q3Z585 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 3.45e-03 NA NA 0.3979
6. F Q8NUQ3 4,4'-diaponeurosporene oxygenase 1.01e-01 NA NA 0.3628
6. F Q53589 4,4'-diaponeurosporene oxygenase 1.06e-01 NA NA 0.3643
6. F Q31JE7 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC 1.02e-01 NA NA 0.3186
6. F Q4VKU9 4,4'-diapolycopene oxygenase 1.78e-01 NA NA 0.3342
6. F Q04XS7 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC 9.79e-02 NA NA 0.3263
6. F Q6GDN5 4,4'-diaponeurosporene oxygenase 1.07e-01 NA NA 0.3603
6. F Q2FDU3 4,4'-diaponeurosporene oxygenase 1.00e-01 NA NA 0.3645
6. F B3WCB2 Ferredoxin--NADP reductase 2.19e-02 NA NA 0.3891
6. F Q48485 UDP-galactopyranose mutase 1.12e-01 NA NA 0.3638
6. F Q2YWE5 4,4'-diaponeurosporene oxygenase 1.02e-01 NA NA 0.3598
6. F D7AF64 NADPH-Fe(3+) oxidoreductase subunit beta 1.51e-01 NA NA 0.3143
6. F A6WYV7 D-amino acid dehydrogenase 2.32e-01 NA NA 0.3519
6. F Q92XP5 Opine oxidase subunit B 5.63e-02 NA NA 0.4271
6. F Q3IYH4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.93e-14 NA NA 0.7176
6. F B1XBJ4 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 2.67e-03 NA NA 0.4085
6. F Q9R6X4 Zeta-carotene desaturase 5.73e-02 NA NA 0.4003
6. F Q99R73 4,4'-diaponeurosporene oxygenase 6.36e-02 NA NA 0.3613
6. F A4JPY1 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 1 6.26e-03 NA NA 0.3544
6. F O32159 Uncharacterized oxidoreductase YurR 3.11e-02 NA NA 0.4758
6. F P54978 Phytoene desaturase (lycopene-forming) 1.19e-01 NA NA 0.3748
6. F Q7A3D9 4,4'-diaponeurosporene oxygenase 9.45e-02 NA NA 0.364
6. F O34399 Glutamate synthase [NADPH] small chain 7.85e-02 NA NA 0.2971
6. F Q0SFL5 Probable NADH-specific resorcinol 4-hydroxylase 3.28e-03 NA NA 0.3888
6. F P80324 D-amino-acid oxidase 5.69e-02 NA NA 0.4155
6. F Q6G6B0 4,4'-diaponeurosporene oxygenase 9.46e-02 NA NA 0.3607
7. B Q8RI88 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2 1.81e-14 NA 6.41e-07 NA
7. B Q3IK39 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.99e-15 NA 3.09e-05 NA
7. B C3LSK0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.00e-15 NA 5.39e-05 NA
7. B A1W207 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.15e-14 NA 1.07e-05 NA
7. B B0JGQ4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.22e-15 NA 4.62e-05 NA
7. B A5IWD6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-15 NA 3.06e-08 NA
7. B Q2RN76 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.15e-13 NA 5.11e-08 NA
7. B Q38UF0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.88e-15 NA 1.85e-04 NA
7. B C0R430 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.22e-13 NA 7.69e-07 NA
7. B B1YQK2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.55e-14 NA 2.99e-06 NA
7. B A3M6R5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.39e-14 NA 7.07e-06 NA
7. B Q7W0T0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.44e-15 NA 0.001 NA
7. B A5GWP3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.33e-15 NA 6.67e-06 NA
7. B Q2J358 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.72e-13 NA 2.74e-06 NA
7. B Q5GS25 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.98e-13 NA 1.16e-06 NA
7. B P53070 Mitochondrial translation optimization protein 1 2.88e-13 NA 2.17e-05 NA
7. B B0K5N3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.22e-15 NA 3.85e-05 NA
7. B Q03D60 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.55e-15 NA 6.31e-06 NA
7. B Q2SR15 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 8.77e-15 NA 1.62e-10 NA
7. B A9M3R4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.99e-14 NA 0.001 NA
7. B A9WKL7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.23e-13 NA 5.08e-06 NA
7. B P0A6U3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.22e-15 NA 1.82e-06 NA
7. B Q181S8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.30e-14 NA 2.63e-06 NA
7. B Q9RCA8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.00e-15 NA 1.18e-06 NA
7. B Q2FUQ3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.22e-15 NA 3.23e-08 NA
7. B A8YYS0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.11e-15 NA 3.23e-08 NA
7. B Q7P0A6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.48e-14 NA 3.79e-06 NA
7. B Q1GXL9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.41e-14 NA 0.002 NA
7. B O13670 Protein MTO1 homolog, mitochondrial 1.20e-13 NA 2.55e-07 NA
7. B A9HE13 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.61e-14 NA 1.03e-07 NA
7. B P64229 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.11e-15 NA 3.06e-08 NA
7. B P0A3F1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.66e-15 NA 0.002 NA
7. B Q4FNR6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.91e-13 NA 1.28e-07 NA
7. B Q9Y2Z2 Protein MTO1 homolog, mitochondrial 7.70e-12 NA 0.008 NA
7. B P0DB34 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.22e-15 NA 6.82e-05 NA
7. B B0VLL2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.41e-14 NA 7.39e-06 NA
7. B Q20680 Protein MTO1 homolog, mitochondrial 2.44e-14 NA 9.77e-07 NA
7. B A8G7I0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.28e-14 NA 1.50e-05 NA
7. B O15229 Kynurenine 3-monooxygenase 1.16e-03 NA 0.003 NA
7. B A2BZ61 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.27e-14 NA 2.51e-07 NA
7. B Q7MGG9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.34e-14 NA 2.55e-05 NA
7. B A1UQU7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.39e-13 NA 1.96e-04 NA
7. B Q3SWH6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 7.33e-15 NA 5.07e-07 NA
7. B Q5KU58 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.61e-07 NA
7. B B4TN42 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 2.11e-06 NA
7. B P64231 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.55e-15 NA 3.06e-08 NA
7. B Q39KY9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.44e-14 NA 3.32e-06 NA
7. B A6U594 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.22e-15 NA 3.06e-08 NA
7. B B5BIP5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.66e-15 NA 1.17e-06 NA
7. B Q2GLA8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 5.22e-13 NA 3.83e-05 NA
7. B B4E581 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.59e-14 NA 2.19e-06 NA
7. B A2SMF1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.94e-14 NA 1.99e-05 NA
7. B Q1LHJ8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.57e-14 NA 8.67e-07 NA
7. B A8I266 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.48e-14 NA 5.54e-07 NA
7. B A1VIB1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.71e-14 NA 3.24e-05 NA
7. B Q57AJ7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.66e-13 NA 1.42e-06 NA
7. B B7L889 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 4.88e-15 NA 1.82e-06 NA
7. B Q5FS12 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.11e-14 NA 5.85e-07 NA
7. B A0K2X0 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.60e-14 NA 2.97e-06 NA
7. B Q98DZ1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.45e-13 NA 3.90e-07 NA
7. B Q8FY28 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.49e-13 NA 1.48e-06 NA
7. B Q46VW9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.94e-14 NA 5.38e-07 NA
7. B Q2L2T3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.82e-14 NA 4.55e-08 NA
7. B Q7W2I1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.00e-15 NA 0.001 NA
7. B Q2JI26 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.55e-15 NA 1.00e-05 NA
7. B A5G9V2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.55e-14 NA 3.93e-05 NA
7. B Q8EWN6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.33e-15 NA 1.40e-10 NA
7. B A9M9E4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 3.44e-14 NA 1.48e-06 NA
7. B Q91WN4 Kynurenine 3-monooxygenase 1.54e-03 NA 0.002 NA
7. B Q923Z3 Protein MTO1 homolog, mitochondrial 8.22e-13 NA 7.59e-06 NA
7. B A9IJ48 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 6.33e-15 NA 0.003 NA
7. B Q28VZ5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 9.58e-14 NA 1.89e-05 NA
7. B B8GRC9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.21e-14 NA 6.10e-06 NA
7. B Q88RX6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.23e-14 NA 4.01e-06 NA
7. B B0S3V1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.41e-14 NA 3.23e-07 NA
7. B Q21CM1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.64e-13 NA 1.44e-08 NA
7. B A2C5E1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.29e-14 NA 1.71e-06 NA
7. B Q03N65 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.47e-14 NA 1.30e-06 NA
7. B Q8XU65 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.25e-14 NA 2.36e-05 NA
7. B A5WBB4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2.47e-13 NA 1.86e-05 NA
7. B Q6G1K9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1.01e-14 NA 1.78e-04 NA