Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54797.1
JCVISYN3A_0435
Mannose-6-phosphate isomerase.
M. mycoides homolog: Q6MTB3.
TIGRfam Classification: 5=Equivalog.
Category: Nonessential.
Statistics
Total GO Annotation: 68
Unique PROST Go: 11
Unique BLAST Go: 1
Unique Foldseek Go: 38
Total Homologs: 109
Unique PROST Homologs: 11
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 79
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
O31646
(Mannose-6-phosphate isomerase ManA) with a FATCAT P-Value: 0 and RMSD of 1.76 angstrom. The sequence alignment identity is 40.5%.
Structural alignment shown in left. Query protein AVX54797.1 colored as red in alignment, homolog O31646 colored as blue.
Query protein AVX54797.1 is also shown in right top, homolog O31646 showed in right bottom. They are colored based on secondary structures.
AVX54797.1 MKI--LKLKPYFSKKIWGGNRLKEFGFDIKDNQNIGEAWVISAHENGMSYVISDDQYNNLSLKELFENHKDLFNNYKGC-YPLLVKIITAS-DYLSVQVH 96 O31646 MTTEPLFFKPVFKERIWGGTALADFGYTI-PSQRTGECWAFAAHQNGQS-VVQNGMYKGFTLSELWEHHRHLFGQLEGDRFPLLTKILDADQD-LSVQVH 97 AVX54797.1 PDDNYALSHHN-QLGKPESWYVIDANKDAELIYGHTAKNKKELIDLVNQNKWDQLLKKVKVKPNDFLYVAPGKVHAISPNLVIYELQRSSDITYRFYDYN 195 O31646 PNDEYANIHENGELGKTECWYIIDCQKDAEIIYGHNATTKEELTTMIERGEWDELLRRVKVKPGDFFYVPSGTVHAIGKGILALETQQNSDTTYRLYDYD 197 AVX54797.1 RIDKTTNKPRPLDIFNSIESTI-TPDIND-HIIHNAN-NKVFSS---D--YFSL--YVLECD-DLKEFEVDEKCDWLQLTIISGSG-YINDMY---FTKG 280 O31646 RKD-AEGKLRELHLKKSIE-VIEVPSIPERHTVHHEQIEDLLTTTLIECAYFSVGKWNLSGSASLKQ----QK-PFLLISVIEGEGRMISGEYVYPFKKG 290 AVX54797.1 ESAITINGID--KLIVKGKIKIIISWIKNND 309 O31646 DHMLLPYGLGEFKL--EGYAECIVSHL---- 315
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0000976 | transcription cis-regulatory region binding |
| 1. PBF | GO:0009298 | GDP-mannose biosynthetic process |
| 1. PBF | GO:0000032 | cell wall mannoprotein biosynthetic process |
| 1. PBF | GO:0004476 | mannose-6-phosphate isomerase activity |
| 1. PBF | GO:0008270 | zinc ion binding |
| 1. PBF | GO:0005975 | carbohydrate metabolic process |
| 1. PBF | GO:0031505 | fungal-type cell wall organization |
| 1. PBF | GO:0006486 | protein glycosylation |
| 2. PF | GO:0061611 | mannose to fructose-6-phosphate metabolic process |
| 2. PF | GO:0005829 | cytosol |
| 2. PF | GO:0047922 | gentisate 1,2-dioxygenase activity |
| 2. PF | GO:0006013 | mannose metabolic process |
| 4. PB | GO:0009793 | embryo development ending in seed dormancy |
| 4. PB | GO:0032025 | response to cobalt ion |
| 4. PB | GO:0010043 | response to zinc ion |
| 4. PB | GO:0045892 | negative regulation of transcription, DNA-templated |
| 4. PB | GO:0046686 | response to cadmium ion |
| 4. PB | GO:0033591 | response to L-ascorbic acid |
| 5. P | GO:0019853 | L-ascorbic acid biosynthetic process |
| 5. P | GO:0046680 | response to DDT |
| 5. P | GO:1901170 | naphthalene catabolic process |
| 5. P | GO:0043687 | post-translational protein modification |
| 5. P | GO:0030961 | peptidyl-arginine hydroxylation |
| 5. P | GO:0019309 | mannose catabolic process |
| 5. P | GO:0016706 | 2-oxoglutarate-dependent dioxygenase activity |
| 5. P | GO:0009646 | response to absence of light |
| 5. P | GO:0009242 | colanic acid biosynthetic process |
| 5. P | GO:0061619 | glycolytic process from mannose through fructose-6-phosphate |
| 5. P | GO:0009744 | response to sucrose |
| 6. F | GO:0034354 | 'de novo' NAD biosynthetic process from tryptophan |
| 6. F | GO:0008697 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase activity |
| 6. F | GO:0006569 | tryptophan catabolic process |
| 6. F | GO:0009435 | NAD biosynthetic process |
| 6. F | GO:0070207 | protein homotrimerization |
| 6. F | GO:0009243 | O antigen biosynthetic process |
| 6. F | GO:0009103 | lipopolysaccharide biosynthetic process |
| 6. F | GO:0019864 | IgG binding |
| 6. F | GO:0046564 | oxalate decarboxylase activity |
| 6. F | GO:0042216 | phenanthrene catabolic process |
| 6. F | GO:0006559 | L-phenylalanine catabolic process |
| 6. F | GO:0008198 | ferrous iron binding |
| 6. F | GO:0034214 | protein hexamerization |
| 6. F | GO:0008127 | quercetin 2,3-dioxygenase activity |
| 6. F | GO:0006570 | tyrosine metabolic process |
| 6. F | GO:0000334 | 3-hydroxyanthranilate 3,4-dioxygenase activity |
| 6. F | GO:0046872 | metal ion binding |
| 6. F | GO:0032923 | organic phosphonate biosynthetic process |
| 6. F | GO:0042735 | protein body |
| 6. F | GO:0033609 | oxalate metabolic process |
| 6. F | GO:0019863 | IgE binding |
| 6. F | GO:0045735 | nutrient reservoir activity |
| 6. F | GO:0048825 | cotyledon development |
| 6. F | GO:0018582 | 1-hydroxy-2-naphthoate 1,2-dioxygenase activity |
| 6. F | GO:0019439 | aromatic compound catabolic process |
| 6. F | GO:0005773 | vacuole |
| 6. F | GO:0045490 | pectin catabolic process |
| 6. F | GO:0043420 | anthranilate metabolic process |
| 6. F | GO:0004475 | mannose-1-phosphate guanylyltransferase activity |
| 6. F | GO:0046874 | quinolinate metabolic process |
| 6. F | GO:0043245 | extraorganismal space |
| 6. F | GO:0016702 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
| 6. F | GO:0048316 | seed development |
| 6. F | GO:0033095 | aleurone grain |
| 6. F | GO:0010431 | seed maturation |
| 6. F | GO:0005791 | rough endoplasmic reticulum |
| 6. F | GO:0019805 | quinolinate biosynthetic process |
| 6. F | GO:0004411 | homogentisate 1,2-dioxygenase activity |
| 7. B | GO:0009416 | response to light stimulus |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0004476 | mannose-6-phosphate isomerase activity |
| GO:0008270 | zinc ion binding |
| GO:0005975 | carbohydrate metabolic process |
| GO:0016853 | isomerase activity |
| GO:0046872 | metal ion binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | O31646 | Mannose-6-phosphate isomerase ManA | 0.00e+00 | 3.31e-64 | 1.81e-69 | 0.9206 |
| 1. PBF | P39841 | Putative mannose-6-phosphate isomerase YvyI | 0.00e+00 | 1.00e-59 | 4.46e-64 | 0.9179 |
| 1. PBF | Q59935 | Mannose-6-phosphate isomerase | 0.00e+00 | 4.61e-63 | 3.30e-68 | 0.9062 |
| 1. PBF | O05511 | Probable mannose-6-phosphate isomerase GmuF | 0.00e+00 | 9.21e-66 | 1.67e-55 | 0.9086 |
| 2. PF | Q76IQ2 | Mannose-6-phosphate isomerase | 1.40e-13 | 2.12e-11 | NA | 0.7387 |
| 2. PF | Q3SZI0 | Mannose-6-phosphate isomerase | 1.11e-13 | 6.00e-07 | NA | 0.7485 |
| 2. PF | Q8HXX2 | Mannose-6-phosphate isomerase | 1.72e-10 | 1.73e-06 | NA | 0.7519 |
| 2. PF | Q8J093 | Mannose-6-phosphate isomerase | 4.15e-13 | 2.71e-07 | NA | 0.7376 |
| 2. PF | Q9HFU4 | Mannose-6-phosphate isomerase | 9.39e-08 | 2.79e-08 | NA | 0.7503 |
| 2. PF | Q83KZ1 | Mannose-6-phosphate isomerase | 2.55e-15 | 1.88e-16 | NA | 0.7934 |
| 2. PF | A5A6K3 | Mannose-6-phosphate isomerase | 6.10e-10 | 8.88e-07 | NA | 0.7502 |
| 2. PF | Q66WM4 | Mannose-6-phosphate isomerase | 1.61e-13 | 1.47e-09 | NA | 0.7499 |
| 2. PF | Q9GP38 | Probable mannose-6-phosphate isomerase | 2.70e-14 | 1.09e-06 | NA | 0.7199 |
| 2. PF | P25081 | Mannose-6-phosphate isomerase | 1.55e-15 | 7.37e-16 | NA | 0.77 |
| 2. PF | Q75AB5 | Mannose-6-phosphate isomerase | 8.26e-14 | 9.61e-11 | NA | 0.7449 |
| 2. PF | Q870Y1 | Mannose-6-phosphate isomerase | 1.12e-13 | 2.92e-09 | NA | 0.7396 |
| 2. PF | P29951 | Mannose-6-phosphate isomerase | 5.34e-13 | 1.30e-07 | NA | 0.7583 |
| 4. PB | Q9M884 | Mannose-6-phosphate isomerase 1 | 4.72e-14 | 4.01e-10 | 1.33e-04 | NA |
| 4. PB | O43014 | Mannose-6-phosphate isomerase | 4.46e-14 | 9.62e-12 | 0.024 | NA |
| 5. P | P27431 | 50S ribosomal protein L16 3-hydroxylase | 4.03e-01 | 5.43e-03 | NA | NA |
| 5. P | P34949 | Mannose-6-phosphate isomerase | 7.33e-10 | 7.02e-07 | NA | NA |
| 5. P | O86041 | Gentisate 1,2-dioxygenase | 5.71e-03 | 1.57e-03 | NA | NA |
| 5. P | Q9FZH5 | Mannose-6-phosphate isomerase 2 | 1.10e-13 | 3.93e-08 | NA | NA |
| 5. P | Q54PA0 | Probable mannose-6-phosphate isomerase | 1.19e-12 | 1.05e-06 | NA | NA |
| 5. P | P34650 | Probable mannose-6-phosphate isomerase | 1.21e-14 | 2.09e-13 | NA | NA |
| 5. P | Q924M7 | Mannose-6-phosphate isomerase | 9.40e-10 | 3.41e-06 | NA | NA |
| 5. P | P34948 | Mannose-6-phosphate isomerase | 1.47e-13 | 1.33e-06 | NA | NA |
| 5. P | P00946 | Mannose-6-phosphate isomerase | 2.89e-15 | 9.73e-17 | NA | NA |
| 5. P | Q68FX1 | Mannose-6-phosphate isomerase | 9.86e-14 | 5.68e-06 | NA | NA |
| 5. P | P29952 | Mannose-6-phosphate isomerase | 6.17e-14 | 1.27e-09 | NA | NA |
| 6. F | P58114 | Pirin-like protein CC_3178 | 6.39e-06 | NA | NA | 0.4424 |
| 6. F | B0RVK6 | Xanthan biosynthesis protein XanB | 1.74e-02 | NA | NA | 0.5651 |
| 6. F | D4B179 | Oxalate decarboxylase ARB_02208 | 3.13e-03 | NA | NA | 0.3831 |
| 6. F | P42106 | Quercetin 2,3-dioxygenase | 4.21e-04 | NA | NA | 0.4203 |
| 6. F | P43238 | Allergen Ara h 1, clone P41B | 1.91e-02 | NA | NA | 0.3882 |
| 6. F | P05692 | Legumin J | 9.34e-03 | NA | NA | 0.3871 |
| 6. F | F5B8W1 | Conglutin beta 3 | 1.35e-02 | NA | NA | 0.4315 |
| 6. F | F5B8V6 | Conglutin alpha 1 | 8.21e-03 | NA | NA | 0.3514 |
| 6. F | Q9KSB4 | Putative dioxygenase VC_1345 | 3.84e-02 | NA | NA | 0.3893 |
| 6. F | F5B8V9 | Conglutin beta 1 | 1.53e-02 | NA | NA | 0.4488 |
| 6. F | P33523 | Cruciferin BnC1 | 3.77e-02 | NA | NA | 0.3453 |
| 6. F | P19084 | 11S globulin seed storage protein G3 | 5.03e-03 | NA | NA | 0.4142 |
| 6. F | P9WI84 | Putative quercetin 2,3-dioxygenase MT0190 | 3.55e-06 | NA | NA | 0.5008 |
| 6. F | Q43607 | Prunin 1 Pru du 6 | 1.45e-02 | NA | NA | 0.3978 |
| 6. F | F5B8W5 | Conglutin beta 7 | 1.66e-02 | NA | NA | 0.4224 |
| 6. F | F5B8W3 | Conglutin beta 5 | 1.86e-02 | NA | NA | 0.4213 |
| 6. F | Q0VCA8 | 3-hydroxyanthranilate 3,4-dioxygenase | 1.19e-03 | NA | NA | 0.3745 |
| 6. F | Q6EBC1 | Conglutin beta 2 | 2.33e-02 | NA | NA | 0.4119 |
| 6. F | P58112 | Pirin-like protein CC_0481 | 9.45e-06 | NA | NA | 0.455 |
| 6. F | Q8GZP6 | 11S globulin seed storage protein Ana o 2.0101 (Fragment) | 3.32e-05 | NA | NA | 0.3502 |
| 6. F | P65725 | Putative quercetin 2,3-dioxygenase Mb0187c | 3.49e-06 | NA | NA | 0.5025 |
| 6. F | A0A1L6K371 | 11S globulin | 1.05e-04 | NA | NA | 0.3832 |
| 6. F | P58115 | Pirin-like protein YhaK | 9.85e-08 | NA | NA | 0.5308 |
| 6. F | Q02498 | Cruciferin PGCRURSE5 | 4.46e-03 | NA | NA | 0.4034 |
| 6. F | Q7SIC2 | Quercetin 2,3-dioxygenase | 7.50e-06 | NA | NA | 0.4098 |
| 6. F | O34714 | Oxalate decarboxylase OxdC | 1.99e-03 | NA | NA | 0.4176 |
| 6. F | Q9HLU2 | Putative quercetin 2,3-dioxygenase Ta0133 | 1.12e-04 | NA | NA | 0.3932 |
| 6. F | Q9I4C8 | Putative quercetin 2,3-dioxygenase PA1210 | 8.24e-07 | NA | NA | 0.4881 |
| 6. F | Q9XHP0 | 11S globulin seed storage protein 2 | 7.19e-06 | NA | NA | 0.3794 |
| 6. F | P09800 | Legumin B | 6.93e-03 | NA | NA | 0.364 |
| 6. F | Q6P7I0 | 3-hydroxyanthranilate 3,4-dioxygenase | 1.42e-03 | NA | NA | 0.4044 |
| 6. F | A9A1T2 | Methylphosphonate synthase | 1.48e-02 | NA | NA | 0.3885 |
| 6. F | F5B8W2 | Conglutin beta 4 | 3.18e-02 | NA | NA | 0.4267 |
| 6. F | Q9XBR7 | Putative quercetin 2,3-dioxygenase ZMO1337 | 7.69e-07 | NA | NA | 0.581 |
| 6. F | A8FI32 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase | 2.59e-03 | NA | NA | 0.3242 |
| 6. F | O23880 | 13S globulin seed storage protein 2 | 5.23e-03 | NA | NA | 0.3683 |
| 6. F | Q9KKY1 | Putative quercetin 2,3-dioxygenase VC_A0969 | 1.21e-02 | NA | NA | 0.463 |
| 6. F | O24721 | 1-hydroxy-2-naphthoate 1,2-dioxygenasee | 2.07e-03 | NA | NA | 0.4014 |
| 6. F | Q9XFM4 | 13S globulin seed storage protein 3 | 4.12e-02 | NA | NA | 0.3625 |
| 6. F | P73623 | Putative quercetin 2,3-dioxygenase sll1773 | 8.17e-07 | NA | NA | 0.4887 |
| 6. F | P09801 | Vicilin C72 | 2.21e-02 | NA | NA | 0.415 |
| 6. F | E3SH28 | Prunin 1 Pru du 6.0101 | 1.30e-02 | NA | NA | 0.3854 |
| 6. F | B5KVH4 | 11S globulin seed storage protein 1 | 7.29e-05 | NA | NA | 0.3586 |
| 6. F | P05190 | Legumin type B | 3.69e-05 | NA | NA | 0.358 |
| 6. F | P14812 | 12S seed storage globulin 2 | 8.66e-03 | NA | NA | 0.3907 |
| 6. F | Q9S3U6 | Gentisate 1,2 dioxygenase 1 | 1.34e-02 | NA | NA | 0.3573 |
| 6. F | F5B8W4 | Conglutin beta 6 | 1.48e-02 | NA | NA | 0.4576 |
| 6. F | B8H5V5 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase | 1.42e-03 | NA | NA | 0.424 |
| 6. F | P33525 | Cruciferin CRU1 | 4.69e-02 | NA | NA | 0.3713 |
| 6. F | O23878 | 13S globulin seed storage protein 1 | 4.14e-02 | NA | NA | 0.3694 |
| 6. F | D4AKL6 | Probable oxalate decarboxylase ARB_04859 | 2.47e-03 | NA | NA | 0.3694 |
| 6. F | Q6DIZ0 | 3-hydroxyanthranilate 3,4-dioxygenase | 1.22e-03 | NA | NA | 0.4154 |
| 6. F | O34767 | Oxalate decarboxylase OxdD | 2.41e-03 | NA | NA | 0.3932 |
| 6. F | A7RIT9 | 3-hydroxyanthranilate 3,4-dioxygenase | 7.89e-04 | NA | NA | 0.4169 |
| 6. F | P08438 | Vicilin | 5.58e-03 | NA | NA | 0.4151 |
| 6. F | P33522 | Cruciferin CRU4 | 1.90e-05 | NA | NA | 0.3549 |
| 6. F | Q2TPW5 | 11S globulin seed storage protein Jug r 4 | 1.14e-02 | NA | NA | 0.3571 |
| 6. F | Q330M9 | Gentisate 1,2-dioxygenase | 5.27e-03 | NA | NA | 0.3708 |
| 6. F | Q60W34 | 3-hydroxyanthranilate 3,4-dioxygenase | 2.12e-03 | NA | NA | 0.4089 |
| 6. F | Q7X284 | Gentisate 1,2-dioxygenase | 3.40e-03 | NA | NA | 0.3287 |
| 6. F | P09799 | Vicilin GC72-A | 2.54e-02 | NA | NA | 0.3911 |
| 6. F | P43237 | Allergen Ara h 1, clone P17 | 1.81e-02 | NA | NA | 0.3903 |
| 6. F | F5B8W0 | Conglutin beta 2 | 3.15e-02 | NA | NA | 0.4359 |
| 6. F | Q9SEE4 | Pirin-like protein | 1.01e-05 | NA | NA | 0.4219 |
| 6. F | A0A222NNM9 | Cocosin 1 | 5.31e-03 | NA | NA | 0.4199 |
| 6. F | P13744 | 11S globulin subunit beta | 3.46e-03 | NA | NA | 0.3722 |
| 6. F | P58113 | Pirin-like protein CC_1473 | 1.51e-06 | NA | NA | 0.483 |
| 6. F | P0C7J3 | Xanthan biosynthesis protein XanB | 1.57e-03 | NA | NA | 0.5653 |
| 6. F | P26404 | Mannose-1-phosphate guanylyltransferase RfbM | 8.84e-03 | NA | NA | 0.4064 |
| 6. F | Q647H2 | Arachin Ahy-3 | 5.38e-03 | NA | NA | 0.4026 |
| 6. F | P33524 | Cruciferin BnC2 | 4.10e-02 | NA | NA | 0.3739 |
| 6. F | Q9I4D3 | Putative quercetin 2,3-dioxygenase PA1205 | 3.17e-05 | NA | NA | 0.4044 |
| 6. F | P12615 | 12S seed storage globulin 1 | 9.22e-03 | NA | NA | 0.3895 |
| 6. F | P11090 | Cruciferin | 4.28e-02 | NA | NA | 0.3599 |
| 6. F | Q97Y16 | Putative dioxygenase SSO1533 | 4.18e-02 | NA | NA | 0.3545 |
| 6. F | Q53HY0 | Conglutin beta 1 | 1.16e-02 | NA | NA | 0.411 |
| 6. F | Q9CKD7 | Putative quercetin 2,3-dioxygenase PM1685 | 7.67e-07 | NA | NA | 0.5849 |
| 6. F | P58116 | Quercetin 2,3-dioxygenase | 7.06e-07 | NA | NA | 0.5351 |
| 6. F | Q9I163 | Putative quercetin 2,3-dioxygenase PA2418 | 4.11e-05 | NA | NA | 0.4434 |