Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54802.1
JCVISYN3A_0441
Cysteine desulfurase.
M. mycoides homolog: Q6MTA7.
TIGRfam Classification: 3=Putative.
Category: Essential.
Statistics
Total GO Annotation: 277
Unique PROST Go: 152
Unique BLAST Go: 9
Unique Foldseek Go: 5
Total Homologs: 3766
Unique PROST Homologs: 2718
Unique BLAST Homologs: 10
Unique Foldseek Homologs: 57
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
A5DTF4
(Kynureninase) with a FATCAT P-Value: 0 and RMSD of 3.04 angstrom. The sequence alignment identity is 25.0%.
Structural alignment shown in left. Query protein AVX54802.1 colored as red in alignment, homolog A5DTF4 colored as blue.
Query protein AVX54802.1 is also shown in right top, homolog A5DTF4 showed in right bottom. They are colored based on secondary structures.
AVX54802.1 M-NDQFEKIKKQFPLLKKHPNLIYFDN-GATTLKPNSVINAQTNYLKNISTNPHSSDYKIGYQSLEIL-SNTRELVKNFINA----------NHTSEIIF 87 A5DTF4 MSSDKAKAFDAQFPTYKSEFQIPTFESLG---IQ-NSKYSPETNSI-----------YLCG-NSLGLMPRNTTELINRELQAWSSRGVEAHFNHS----H 80 AVX54802.1 TSGT-TQSINM-IAKGLINLI--NQDDEILITSLEHSSNLVPWI--WLKQK---TNAVI-KN---------LELTNDFGIDINKLDQLITPK--T--K-- 162 A5DTF4 PQGTDWVDIDLPLLPLLAPLVGAKQNEVAVMGSL--TSNLNALLIHFYKPKGKRTKILFEKQAFPSDYYAFLNIVQVFGYDASHLIQIEIPKGETYIKTE 178 AVX54802.1 -IISFAH-------------ISNTTGYINDVKKIIQKIRSINQNVIIVVDVAQSIAHFKVDVKDWDVDFIAFSAHKMY---GPFG--VGVLYG-KYQLLD 242 A5DTF4 TILDVFDKYEDEIAIVCLPGIQYYTGQFFDIAKITKHVKTSAPDVVVGWDLAHAVGNVPLSLHDWGVDFAAWCSYK-YLNAGP-GAIAGIFVNEKYTEQN 276 AVX54802.1 KLEPLN----LGG--GSSLTISRDFTSYTLKSLPEKLE--AGTLNISNI-------YGFKKAIEFILKIGINNICLYETKLKQYTR--QQI--KAN-HLE 322 A5DTF4 K--PENYKPRLAGWWGNN-------SSQRFQML-EKFDPIASALSYRQLNPSVLDCVALKSSLEIFNKVG-GMLSLRDKSL-AMTQFLQDILTKSNYYIE 364 AVX54802.1 ------NKITFYNLNNDSPLLLFNVNQINAQDISSFL-----D-VKYNITSR--SGAH-----CVRRLEDVIHIKSALRISFAIYNTTDE--ID--KLID 399 A5DTF4 QGETDVNKFGFKII---TPL---DPNQRGCQ-L-SLLFQPHRDEKKQNVMERVFEYLHQHAIICDERRPDVIRL-APL----PLYNTFEETRIGATRLLE 451 AVX54802.1 AL---KNTDKFLDIYF 412 A5DTF4 ALEAIK--D---D-YI 461
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0004760 | serine-pyruvate transaminase activity |
1. PBF | GO:0032047 | mitosome |
1. PBF | GO:0051536 | iron-sulfur cluster binding |
1. PBF | GO:0034354 | 'de novo' NAD biosynthetic process from tryptophan |
1. PBF | GO:0005886 | plasma membrane |
1. PBF | GO:0004123 | cystathionine gamma-lyase activity |
1. PBF | GO:0019441 | tryptophan catabolic process to kynurenine |
1. PBF | GO:0006520 | cellular amino acid metabolic process |
1. PBF | GO:0006569 | tryptophan catabolic process |
1. PBF | GO:0008483 | transaminase activity |
1. PBF | GO:0004400 | histidinol-phosphate transaminase activity |
1. PBF | GO:0019700 | organic phosphonate catabolic process |
1. PBF | GO:0044571 | [2Fe-2S] cluster assembly |
1. PBF | GO:0030170 | pyridoxal phosphate binding |
1. PBF | GO:0019265 | glycine biosynthetic process, by transamination of glyoxylate |
1. PBF | GO:0046872 | metal ion binding |
1. PBF | GO:0070903 | mitochondrial tRNA thio-modification |
1. PBF | GO:0097053 | L-kynurenine catabolic process |
1. PBF | GO:0006412 | translation |
1. PBF | GO:0009399 | nitrogen fixation |
1. PBF | GO:0009058 | biosynthetic process |
1. PBF | GO:0031071 | cysteine desulfurase activity |
1. PBF | GO:0047304 | 2-aminoethylphosphonate-pyruvate transaminase activity |
1. PBF | GO:0008270 | zinc ion binding |
1. PBF | GO:0030429 | kynureninase activity |
1. PBF | GO:0005737 | cytoplasm |
1. PBF | GO:0043766 | Sep-tRNA:Cys-tRNA synthase activity |
1. PBF | GO:0043420 | anthranilate metabolic process |
1. PBF | GO:0009000 | selenocysteine lyase activity |
1. PBF | GO:0047303 | glycine-oxaloacetate transaminase activity |
1. PBF | GO:0061981 | 3-hydroxykynureninase activity |
1. PBF | GO:0006534 | cysteine metabolic process |
1. PBF | GO:0045439 | isopenicillin-N epimerase activity |
1. PBF | GO:0004069 | L-aspartate:2-oxoglutarate aminotransferase activity |
1. PBF | GO:0051537 | 2 iron, 2 sulfur cluster binding |
1. PBF | GO:0008453 | alanine-glyoxylate transaminase activity |
1. PBF | GO:0019805 | quinolinate biosynthetic process |
1. PBF | GO:0050281 | serine-glyoxylate transaminase activity |
2. PF | GO:2001120 | methanofuran biosynthetic process |
2. PF | GO:0003677 | DNA binding |
2. PF | GO:0005960 | glycine cleavage complex |
2. PF | GO:0019464 | glycine decarboxylation via glycine cleavage system |
2. PF | GO:0000105 | histidine biosynthetic process |
2. PF | GO:0006103 | 2-oxoglutarate metabolic process |
2. PF | GO:0006531 | aspartate metabolic process |
2. PF | GO:0035999 | tetrahydrofolate interconversion |
2. PF | GO:0004125 | L-seryl-tRNASec selenium transferase activity |
2. PF | GO:0004837 | tyrosine decarboxylase activity |
2. PF | GO:0005777 | peroxisome |
2. PF | GO:0042853 | L-alanine catabolic process |
2. PF | GO:0019346 | transsulfuration |
2. PF | GO:0033853 | aspartate-prephenate aminotransferase activity |
2. PF | GO:0047300 | pyridoxamine-pyruvate transaminase activity |
2. PF | GO:0004121 | cystathionine beta-lyase activity |
2. PF | GO:0047315 | kynurenine-glyoxylate transaminase activity |
2. PF | GO:0004375 | glycine dehydrogenase (decarboxylating) activity |
2. PF | GO:0005634 | nucleus |
2. PF | GO:0006565 | L-serine catabolic process |
2. PF | GO:0046655 | folic acid metabolic process |
2. PF | GO:0019448 | L-cysteine catabolic process |
2. PF | GO:0016212 | kynurenine-oxoglutarate transaminase activity |
2. PF | GO:0050897 | cobalt ion binding |
2. PF | GO:0009116 | nucleoside metabolic process |
2. PF | GO:0046653 | tetrahydrofolate metabolic process |
2. PF | GO:0036137 | kynurenine aminotransferase activity |
2. PF | GO:0004068 | aspartate 1-decarboxylase activity |
2. PF | GO:0008732 | L-allo-threonine aldolase activity |
2. PF | GO:0016021 | integral component of membrane |
2. PF | GO:0006536 | glutamate metabolic process |
2. PF | GO:0019264 | glycine biosynthetic process from serine |
2. PF | GO:0015937 | coenzyme A biosynthetic process |
2. PF | GO:0016594 | glycine binding |
2. PF | GO:0004372 | glycine hydroxymethyltransferase activity |
2. PF | GO:0019752 | carboxylic acid metabolic process |
2. PF | GO:0047982 | homocysteine desulfhydrase activity |
2. PF | GO:0033854 | glutamate-prephenate aminotransferase activity |
2. PF | GO:0070905 | serine binding |
2. PF | GO:0018826 | methionine gamma-lyase activity |
2. PF | GO:0047804 | cysteine-S-conjugate beta-lyase activity |
2. PF | GO:0006532 | aspartate biosynthetic process |
2. PF | GO:0097056 | selenocysteinyl-tRNA(Sec) biosynthetic process |
2. PF | GO:0009436 | glyoxylate catabolic process |
2. PF | GO:0006533 | aspartate catabolic process |
2. PF | GO:0001514 | selenocysteine incorporation |
2. PF | GO:0006544 | glycine metabolic process |
2. PF | GO:0051009 | O-acetylhomoserine sulfhydrylase activity |
2. PF | GO:0019550 | glutamate catabolic process to aspartate |
3. BF | GO:0102867 | molybdenum cofactor sulfurtransferase activity |
3. BF | GO:0006727 | ommochrome biosynthetic process |
3. BF | GO:0030151 | molybdenum ion binding |
3. BF | GO:0016829 | lyase activity |
3. BF | GO:0006777 | Mo-molybdopterin cofactor biosynthetic process |
3. BF | GO:0032324 | molybdopterin cofactor biosynthetic process |
3. BF | GO:0008265 | Mo-molybdopterin cofactor sulfurase activity |
3. BF | GO:0000287 | magnesium ion binding |
3. BF | GO:0043545 | molybdopterin cofactor metabolic process |
4. PB | GO:1900408 | negative regulation of cellular response to oxidative stress |
4. PB | GO:0006790 | sulfur compound metabolic process |
4. PB | GO:1990221 | L-cysteine desulfurase complex |
4. PB | GO:1902494 | catalytic complex |
4. PB | GO:0016261 | selenocysteine catabolic process |
4. PB | GO:0102933 | GDP-4-dehydro-6-deoxy-D-mannose-4-aminotransferase activity |
4. PB | GO:0052704 | ergothioneine biosynthesis from histidine via gamma-glutamyl-hercynylcysteine sulfoxide |
4. PB | GO:1990412 | hercynylselenocysteine lyase activity (selenoneine-forming) |
4. PB | GO:0018283 | iron incorporation into metallo-sulfur cluster |
4. PB | GO:0005524 | ATP binding |
4. PB | GO:1990411 | hercynylcysteine sulfoxide lyase activity (ergothioneine-forming) |
4. PB | GO:0003824 | catalytic activity |
4. PB | GO:0070279 | vitamin B6 binding |
4. PB | GO:0001887 | selenium compound metabolic process |
4. PB | GO:0080130 | L-phenylalanine:2-oxoglutarate aminotransferase activity |
5. P | GO:0008890 | glycine C-acetyltransferase activity |
5. P | GO:0006563 | L-serine metabolic process |
5. P | GO:0009743 | response to carbohydrate |
5. P | GO:0006564 | L-serine biosynthetic process |
5. P | GO:0051902 | negative regulation of mitochondrial depolarization |
5. P | GO:0047310 | glutamine-scyllo-inositol transaminase activity |
5. P | GO:0009072 | aromatic amino acid family metabolic process |
5. P | GO:0102028 | cystathionine gamma-synthase activity (acts on O-phosphohomoserine) |
5. P | GO:0009243 | O antigen biosynthetic process |
5. P | GO:0009103 | lipopolysaccharide biosynthetic process |
5. P | GO:0019442 | tryptophan catabolic process to acetyl-CoA |
5. P | GO:0009446 | putrescine biosynthetic process |
5. P | GO:0006571 | tyrosine biosynthetic process |
5. P | GO:0004398 | histidine decarboxylase activity |
5. P | GO:0003870 | 5-aminolevulinate synthase activity |
5. P | GO:0062045 | L-lysine alpha-aminotransferase |
5. P | GO:0006527 | arginine catabolic process |
5. P | GO:0048472 | threonine-phosphate decarboxylase activity |
5. P | GO:0003961 | O-acetylhomoserine aminocarboxypropyltransferase activity |
5. P | GO:0006567 | threonine catabolic process |
5. P | GO:0005743 | mitochondrial inner membrane |
5. P | GO:0009835 | fruit ripening |
5. P | GO:0019545 | arginine catabolic process to succinate |
5. P | GO:0019344 | cysteine biosynthetic process |
5. P | GO:0042802 | identical protein binding |
5. P | GO:0004838 | L-tyrosine:2-oxoglutarate aminotransferase activity |
5. P | GO:0051384 | response to glucocorticoid |
5. P | GO:0009086 | methionine biosynthetic process |
5. P | GO:0043825 | succinylornithine transaminase activity |
5. P | GO:0005576 | extracellular region |
5. P | GO:0032259 | methylation |
5. P | GO:0044540 | L-cystine L-cysteine-lyase (deaminating) |
5. P | GO:0099620 | UDP-4-amino-4-deoxy-L-arabinose aminotransferase |
5. P | GO:0006591 | ornithine metabolic process |
5. P | GO:0050179 | phenylserine aldolase activity |
5. P | GO:0010285 | L,L-diaminopimelate aminotransferase activity |
5. P | GO:0047801 | L-cysteine transaminase activity |
5. P | GO:0008710 | 8-amino-7-oxononanoate synthase activity |
5. P | GO:0008615 | pyridoxine biosynthetic process |
5. P | GO:0019343 | cysteine biosynthetic process via cystathionine |
5. P | GO:0009102 | biotin biosynthetic process |
5. P | GO:0080097 | L-tryptophan:pyruvate aminotransferase activity |
5. P | GO:0033068 | macrolide biosynthetic process |
5. P | GO:0034516 | response to vitamin B6 |
5. P | GO:0047307 | diaminobutyrate-pyruvate transaminase activity |
5. P | GO:0046677 | response to antibiotic |
5. P | GO:0055129 | L-proline biosynthetic process |
5. P | GO:0047536 | 2-aminoadipate transaminase activity |
5. P | GO:0036469 | L-tryptophan decarboxylase activity |
5. P | GO:0009016 | succinyldiaminopimelate transaminase activity |
5. P | GO:0080146 | L-cysteine desulfhydrase activity |
5. P | GO:0008793 | aromatic-amino-acid:2-oxoglutarate aminotransferase activity |
5. P | GO:0009070 | serine family amino acid biosynthetic process |
5. P | GO:0080098 | L-tyrosine:pyruvate aminotransferase activity |
5. P | GO:0047463 | 2-aminohexano-6-lactam racemase activity |
5. P | GO:0019279 | L-methionine biosynthetic process from L-homoserine via cystathionine |
5. P | GO:0006538 | glutamate catabolic process |
5. P | GO:0000049 | tRNA binding |
5. P | GO:0006559 | L-phenylalanine catabolic process |
5. P | GO:0016223 | beta-alanine-pyruvate transaminase activity |
5. P | GO:0010588 | cotyledon vascular tissue pattern formation |
5. P | GO:0006570 | tyrosine metabolic process |
5. P | GO:0016847 | 1-aminocyclopropane-1-carboxylate synthase activity |
5. P | GO:0080100 | L-glutamine:2-oxoglutarate aminotransferase activity |
5. P | GO:0033359 | lysine biosynthetic process via diaminopimelate and N-succinyl-2-amino-6-ketopimelate |
5. P | GO:0071269 | L-homocysteine biosynthetic process |
5. P | GO:0009693 | ethylene biosynthetic process |
5. P | GO:0006545 | glycine biosynthetic process |
5. P | GO:0019179 | dTDP-4-amino-4,6-dideoxy-D-glucose transaminase activity |
5. P | GO:0050371 | tyrosine phenol-lyase activity |
5. P | GO:0019292 | tyrosine biosynthetic process from chorismate via 4-hydroxyphenylpyruvate |
5. P | GO:0019458 | methionine catabolic process via 2-oxobutanoate |
5. P | GO:0003962 | cystathionine gamma-synthase activity |
5. P | GO:1990267 | response to transition metal nanoparticle |
5. P | GO:0017000 | antibiotic biosynthetic process |
5. P | GO:0006525 | arginine metabolic process |
5. P | GO:0009094 | L-phenylalanine biosynthetic process |
5. P | GO:0047302 | UDP-2-acetamido-4-amino-2,4,6-trideoxyglucose transaminase activity |
5. P | GO:0004648 | O-phospho-L-serine:2-oxoglutarate aminotransferase activity |
5. P | GO:0010326 | methionine-oxo-acid transaminase activity |
5. P | GO:0033362 | lysine biosynthetic process via diaminopimelate, diaminopimelate-aminotransferase pathway |
5. P | GO:0019878 | lysine biosynthetic process via aminoadipic acid |
5. P | GO:0047297 | asparagine-oxo-acid transaminase activity |
5. P | GO:0006730 | one-carbon metabolic process |
5. P | GO:0060290 | transdifferentiation |
5. P | GO:1901605 | alpha-amino acid metabolic process |
5. P | GO:0071266 | 'de novo' L-methionine biosynthetic process |
5. P | GO:0016785 | selenotransferase activity |
5. P | GO:0005654 | nucleoplasm |
5. P | GO:0009245 | lipid A biosynthetic process |
5. P | GO:0050155 | ornithine(lysine) transaminase activity |
5. P | GO:0016846 | carbon-sulfur lyase activity |
5. P | GO:0010121 | arginine catabolic process to proline via ornithine |
5. P | GO:0019544 | arginine catabolic process to glutamate |
5. P | GO:0009252 | peptidoglycan biosynthetic process |
5. P | GO:0019518 | L-threonine catabolic process to glycine |
5. P | GO:0000271 | polysaccharide biosynthetic process |
5. P | GO:0004351 | glutamate decarboxylase activity |
5. P | GO:0045303 | diaminobutyrate-2-oxoglutarate transaminase activity |
5. P | GO:0006526 | arginine biosynthetic process |
5. P | GO:0016114 | terpenoid biosynthetic process |
5. P | GO:0033585 | L-phenylalanine biosynthetic process from chorismate via phenylpyruvate |
5. P | GO:0046724 | oxalic acid secretion |
5. P | GO:0006593 | ornithine catabolic process |
5. P | GO:0006572 | tyrosine catabolic process |
5. P | GO:0004793 | threonine aldolase activity |
5. P | GO:0051301 | cell division |
5. P | GO:0008360 | regulation of cell shape |
5. P | GO:0031406 | carboxylic acid binding |
5. P | GO:0044524 | protein sulfhydration |
5. P | GO:0070189 | kynurenine metabolic process |
5. P | GO:0033512 | L-lysine catabolic process to acetyl-CoA via saccharopine |
5. P | GO:0005794 | Golgi apparatus |
5. P | GO:0102705 | serine decarboxylase activity |
5. P | GO:0019272 | L-alanine biosynthetic process from pyruvate |
5. P | GO:0004021 | L-alanine:2-oxoglutarate aminotransferase activity |
5. P | GO:0009074 | aromatic amino acid family catabolic process |
5. P | GO:0009042 | valine-pyruvate transaminase activity |
5. P | GO:0005783 | endoplasmic reticulum |
5. P | GO:0032966 | negative regulation of collagen biosynthetic process |
5. P | GO:0043648 | dicarboxylic acid metabolic process |
5. P | GO:0006779 | porphyrin-containing compound biosynthetic process |
5. P | GO:0098621 | phosphoseryl-selenocysteinyl-tRNA selenium transferase activity |
5. P | GO:0009034 | tryptophanase activity |
5. P | GO:1901997 | negative regulation of indoleacetic acid biosynthetic process via tryptophan |
5. P | GO:0047654 | alliin lyase activity |
5. P | GO:0051289 | protein homotetramerization |
5. P | GO:0019450 | L-cysteine catabolic process to pyruvate |
5. P | GO:0006114 | glycerol biosynthetic process |
5. P | GO:0055089 | fatty acid homeostasis |
5. P | GO:0009507 | chloroplast |
5. P | GO:0019551 | glutamate catabolic process to 2-oxoglutarate |
5. P | GO:0071268 | homocysteine biosynthetic process |
5. P | GO:0042286 | glutamate-1-semialdehyde 2,1-aminomutase activity |
5. P | GO:0004015 | adenosylmethionine-8-amino-7-oxononanoate transaminase activity |
5. P | GO:0047312 | L-phenylalanine:pyruvate aminotransferase activity |
5. P | GO:0080099 | L-methionine:2-oxoglutarate aminotransferase activity |
5. P | GO:0019180 | dTDP-4-amino-4,6-dideoxygalactose transaminase activity |
5. P | GO:0009073 | aromatic amino acid family biosynthetic process |
5. P | GO:0006782 | protoporphyrinogen IX biosynthetic process |
5. P | GO:1904482 | cellular response to tetrahydrofolate |
5. P | GO:0071555 | cell wall organization |
5. P | GO:0008110 | L-histidine:2-oxoglutarate aminotransferase activity |
5. P | GO:0016765 | transferase activity, transferring alkyl or aryl (other than methyl) groups |
5. P | GO:1904831 | positive regulation of aortic smooth muscle cell differentiation |
5. P | GO:0004587 | ornithine-oxo-acid transaminase activity |
5. P | GO:0016020 | membrane |
5. P | GO:0003992 | N2-acetyl-L-ornithine:2-oxoglutarate 5-aminotransferase activity |
5. P | GO:0050362 | L-tryptophan:2-oxoglutarate aminotransferase activity |
5. P | GO:0046487 | glyoxylate metabolic process |
5. P | GO:0009641 | shade avoidance |
5. P | GO:0018272 | protein-pyridoxal-5-phosphate linkage via peptidyl-N6-pyridoxal phosphate-L-lysine |
6. F | GO:0033806 | fluorothreonine transaldolase activity |
6. F | GO:0009095 | aromatic amino acid family biosynthetic process, prephenate pathway |
6. F | GO:0047688 | aspartate 4-decarboxylase activity |
6. F | GO:0004782 | sulfinoalanine decarboxylase activity |
6. F | GO:0015908 | fatty acid transport |
7. B | GO:0016740 | transferase activity |
7. B | GO:0016226 | iron-sulfur cluster assembly |
7. B | GO:0031162 | sulfur incorporation into metallo-sulfur cluster |
7. B | GO:0018315 | molybdenum incorporation into molybdenum-molybdopterin complex |
7. B | GO:1903257 | selenoneine biosynthetic process |
7. B | GO:0046296 | glycolate catabolic process |
7. B | GO:0000096 | sulfur amino acid metabolic process |
7. B | GO:0018131 | oxazole or thiazole biosynthetic process |
7. B | GO:0052699 | ergothioneine biosynthetic process |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0003824 | catalytic activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | B5FR85 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8045 |
1. PBF | A7Z614 | Histidinol-phosphate aminotransferase | 2.77e-10 | 8.98e-07 | 0.037 | 0.6768 |
1. PBF | B7NTV6 | Cysteine desulfurase | 0.00e+00 | 4.35e-57 | 1.33e-78 | 0.9411 |
1. PBF | Q9PLP0 | Probable cysteine desulfurase | 0.00e+00 | 5.65e-57 | 1.72e-52 | 0.9185 |
1. PBF | Q9X191 | Probable cysteine desulfurase | 0.00e+00 | 6.12e-62 | 1.04e-59 | 0.9031 |
1. PBF | B6JKF2 | Cysteine desulfurase IscS | 0.00e+00 | 3.30e-31 | 3.87e-19 | 0.8336 |
1. PBF | B1XB05 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8075 |
1. PBF | A4WDB1 | Cysteine desulfurase IscS | 0.00e+00 | 9.48e-29 | 1.55e-23 | 0.8042 |
1. PBF | A9N1X5 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8039 |
1. PBF | P16421 | Soluble hydrogenase 42 kDa subunit | 0.00e+00 | 3.24e-13 | 3.31e-04 | 0.7071 |
1. PBF | C5BEU5 | Cysteine desulfurase IscS | 0.00e+00 | 1.40e-29 | 2.72e-25 | 0.8014 |
1. PBF | C1DE68 | Cysteine desulfurase IscS | 0.00e+00 | 6.08e-30 | 3.22e-24 | 0.8087 |
1. PBF | P99177 | Probable cysteine desulfurase | 0.00e+00 | 3.98e-58 | 2.43e-89 | 0.9326 |
1. PBF | Q4ZX34 | Cysteine desulfurase IscS | 0.00e+00 | 5.87e-31 | 7.49e-26 | 0.7904 |
1. PBF | Q5F8X4 | Cysteine desulfurase IscS | 0.00e+00 | 1.14e-27 | 5.39e-24 | 0.7936 |
1. PBF | A7FWJ9 | Cysteine desulfurase IscS | 0.00e+00 | 4.08e-26 | 2.53e-23 | 0.83 |
1. PBF | A8GSG4 | Cysteine desulfurase IscS | 0.00e+00 | 1.04e-31 | 2.12e-25 | 0.7775 |
1. PBF | Q87S28 | Cysteine desulfurase IscS | 0.00e+00 | 1.51e-30 | 3.82e-31 | 0.7981 |
1. PBF | B5XNJ7 | Cysteine desulfurase IscS | 0.00e+00 | 7.25e-30 | 2.18e-26 | 0.8038 |
1. PBF | P05344 | Cysteine desulfurase | 0.00e+00 | 1.86e-22 | 1.46e-20 | 0.8214 |
1. PBF | Q02RW8 | Cysteine desulfurase IscS | 0.00e+00 | 1.70e-30 | 6.93e-24 | 0.7879 |
1. PBF | A7MU48 | Cysteine desulfurase IscS | 0.00e+00 | 4.28e-30 | 7.59e-32 | 0.7982 |
1. PBF | Q887A1 | Cysteine desulfurase IscS | 0.00e+00 | 3.17e-31 | 2.86e-25 | 0.7867 |
1. PBF | Q9Z408 | Probable cysteine desulfurase | 0.00e+00 | 2.26e-57 | 1.76e-64 | 0.937 |
1. PBF | Q8DEY7 | Cysteine desulfurase IscS | 0.00e+00 | 9.30e-29 | 1.80e-30 | 0.8066 |
1. PBF | A1B8Z3 | L-aspartate--glyoxylate aminotransferase | 0.00e+00 | 4.16e-12 | 0.002 | 0.725 |
1. PBF | A8A336 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8075 |
1. PBF | A4SP14 | Cysteine desulfurase IscS | 0.00e+00 | 6.97e-29 | 2.46e-21 | 0.811 |
1. PBF | B2K5J4 | Cysteine desulfurase | 0.00e+00 | 1.61e-59 | 1.57e-80 | 0.9571 |
1. PBF | Q9KDJ6 | Putative cysteine desulfurase NifS | 0.00e+00 | 5.87e-31 | 1.16e-08 | 0.8424 |
1. PBF | B5RD12 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8042 |
1. PBF | B8D8F9 | Cysteine desulfurase IscS | 0.00e+00 | 5.69e-32 | 2.85e-28 | 0.8051 |
1. PBF | B4T0S2 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8044 |
1. PBF | Q48M05 | Cysteine desulfurase IscS | 0.00e+00 | 5.87e-31 | 7.49e-26 | 0.79 |
1. PBF | Q8D2J7 | Cysteine desulfurase | 0.00e+00 | 1.33e-63 | 6.53e-69 | 0.9529 |
1. PBF | O51886 | Cysteine desulfurase IscS | 0.00e+00 | 7.25e-30 | 2.27e-28 | 0.8002 |
1. PBF | B7MYG3 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8077 |
1. PBF | B7MIM0 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8082 |
1. PBF | C0PYK7 | Cysteine desulfurase IscS | 0.00e+00 | 5.97e-30 | 2.12e-27 | 0.8043 |
1. PBF | C4L7K2 | Cysteine desulfurase IscS | 0.00e+00 | 2.92e-28 | 1.41e-24 | 0.8088 |
1. PBF | Q8NXH0 | Probable cysteine desulfurase | 0.00e+00 | 4.92e-58 | 5.34e-89 | 0.9336 |
1. PBF | B0YLW6 | Cysteine desulfurase, mitosomal | 0.00e+00 | 4.09e-22 | 2.48e-29 | 0.7935 |
1. PBF | Q7CQN5 | Cysteine desulfurase | 0.00e+00 | 2.48e-58 | 2.62e-78 | 0.9391 |
1. PBF | B1LNI6 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8076 |
1. PBF | A4XY43 | Cysteine desulfurase IscS | 0.00e+00 | 1.74e-30 | 1.59e-26 | 0.8034 |
1. PBF | B5Z4B3 | Cysteine desulfurase | 0.00e+00 | 9.01e-58 | 1.98e-78 | 0.9473 |
1. PBF | B7N6B7 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8098 |
1. PBF | P9WQ70 | Iscs-like cysteine desulfurase | 0.00e+00 | 3.22e-28 | 6.81e-12 | 0.817 |
1. PBF | P05341 | Cysteine desulfurase NifS | 0.00e+00 | 1.25e-22 | 1.46e-18 | 0.8138 |
1. PBF | B7M0N5 | Cysteine desulfurase | 0.00e+00 | 5.32e-58 | 1.33e-78 | 0.9474 |
1. PBF | Q8EEU9 | Cysteine desulfurase IscS | 0.00e+00 | 3.25e-30 | 6.15e-30 | 0.8109 |
1. PBF | B5FIM3 | Cysteine desulfurase | 0.00e+00 | 6.85e-60 | 4.82e-78 | 0.9295 |
1. PBF | B1JDR3 | Cysteine desulfurase IscS | 0.00e+00 | 1.36e-28 | 5.40e-27 | 0.8078 |
1. PBF | A9M029 | Cysteine desulfurase IscS | 0.00e+00 | 1.88e-26 | 8.68e-26 | 0.7982 |
1. PBF | B6I5A2 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8072 |
1. PBF | P42253 | Uncharacterized aminotransferase YcbU | 0.00e+00 | 8.68e-22 | 3.37e-09 | 0.8566 |
1. PBF | Q57337 | Cysteine desulfurase IscS | 0.00e+00 | 1.30e-26 | 2.40e-25 | 0.7977 |
1. PBF | Q486Z0 | Cysteine desulfurase IscS | 0.00e+00 | 2.02e-26 | 1.23e-30 | 0.8076 |
1. PBF | A8F204 | Cysteine desulfurase IscS | 0.00e+00 | 1.93e-31 | 4.57e-26 | 0.7897 |
1. PBF | Q9PQ36 | Probable cysteine desulfurase | 0.00e+00 | 9.36e-72 | 1.08e-85 | 0.956 |
1. PBF | Q5RDE7 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 3.49e-11 | 2.69e-26 | 0.8179 |
1. PBF | P9WQ68 | Probable cysteine desulfurase | 0.00e+00 | 1.39e-53 | 2.68e-66 | 0.9061 |
1. PBF | Q9ZD60 | Cysteine desulfurase IscS | 0.00e+00 | 2.65e-32 | 1.24e-25 | 0.8053 |
1. PBF | B4TGK9 | Cysteine desulfurase | 0.00e+00 | 2.48e-58 | 2.62e-78 | 0.9296 |
1. PBF | Q3IFI3 | Cysteine desulfurase IscS | 0.00e+00 | 1.05e-29 | 1.63e-28 | 0.8072 |
1. PBF | Q8Z4N0 | Cysteine desulfurase IscS | 0.00e+00 | 2.95e-30 | 6.70e-27 | 0.8039 |
1. PBF | O31269 | Cysteine desulfurase IscS | 0.00e+00 | 3.99e-29 | 6.54e-24 | 0.8049 |
1. PBF | A8A0M6 | Cysteine desulfurase | 0.00e+00 | 7.14e-59 | 1.02e-78 | 0.9409 |
1. PBF | A1SUI4 | Cysteine desulfurase IscS | 0.00e+00 | 3.81e-30 | 4.64e-25 | 0.8021 |
1. PBF | B1LE56 | Cysteine desulfurase | 0.00e+00 | 9.01e-58 | 3.63e-79 | 0.9411 |
1. PBF | A8XKT0 | Kynureninase | 0.00e+00 | 7.67e-09 | 0.010 | 0.7191 |
1. PBF | P57795 | Cysteine desulfurase IscS | 0.00e+00 | 8.38e-31 | 1.33e-26 | 0.8209 |
1. PBF | Q49690 | Probable cysteine desulfurase 2 | 0.00e+00 | 4.56e-53 | 8.29e-63 | 0.9088 |
1. PBF | Q8XF77 | Cysteine desulfurase | 0.00e+00 | 2.48e-58 | 2.62e-78 | 0.9295 |
1. PBF | B0TNY1 | Cysteine desulfurase IscS | 0.00e+00 | 2.95e-30 | 5.28e-24 | 0.8102 |
1. PBF | Q9X1C0 | Serine-pyruvate aminotransferase | 0.00e+00 | 2.52e-12 | 7.08e-05 | 0.7304 |
1. PBF | A8H2M6 | Cysteine desulfurase IscS | 0.00e+00 | 1.32e-30 | 1.00e-24 | 0.8093 |
1. PBF | O34599 | Putative cysteine desulfurase IscS 1 | 0.00e+00 | 6.10e-26 | 2.41e-15 | 0.8288 |
1. PBF | A7ZPX4 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8103 |
1. PBF | Q9KPQ7 | Probable cysteine desulfurase | 0.00e+00 | 2.54e-65 | 9.35e-81 | 0.9438 |
1. PBF | A9MHJ4 | Cysteine desulfurase IscS | 0.00e+00 | 1.07e-29 | 3.49e-26 | 0.8043 |
1. PBF | P57803 | Cysteine desulfurase IscS | 0.00e+00 | 1.92e-28 | 1.07e-25 | 0.7998 |
1. PBF | A6V0U8 | Cysteine desulfurase IscS | 0.00e+00 | 1.34e-30 | 8.68e-25 | 0.7979 |
1. PBF | A8AH80 | Cysteine desulfurase | 0.00e+00 | 5.33e-59 | 2.63e-80 | 0.9473 |
1. PBF | A4TIP2 | Cysteine desulfurase | 0.00e+00 | 7.42e-60 | 5.66e-81 | 0.9576 |
1. PBF | A1S544 | Cysteine desulfurase IscS | 0.00e+00 | 7.11e-30 | 1.37e-28 | 0.7997 |
1. PBF | Q57476 | Probable cysteine desulfurase | 0.00e+00 | 2.62e-25 | 1.57e-76 | 0.9314 |
1. PBF | A3D577 | Cysteine desulfurase IscS | 0.00e+00 | 2.13e-31 | 2.29e-27 | 0.8114 |
1. PBF | A8FXA5 | Cysteine desulfurase IscS | 0.00e+00 | 8.47e-30 | 2.02e-27 | 0.8101 |
1. PBF | Q9XAD5 | Probable cysteine desulfurase | 0.00e+00 | 3.09e-52 | 2.63e-78 | 0.9173 |
1. PBF | B2TXV5 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8083 |
1. PBF | B6IBB9 | Cysteine desulfurase | 0.00e+00 | 6.93e-58 | 1.96e-78 | 0.941 |
1. PBF | B0VNW2 | Cysteine desulfurase IscS | 0.00e+00 | 6.08e-30 | 6.58e-23 | 0.8064 |
1. PBF | A6WNY5 | Cysteine desulfurase IscS | 0.00e+00 | 2.55e-31 | 1.88e-27 | 0.8115 |
1. PBF | A0KXJ0 | Cysteine desulfurase IscS | 0.00e+00 | 3.96e-30 | 3.06e-29 | 0.81 |
1. PBF | P63518 | Probable cysteine desulfurase | 0.00e+00 | 3.98e-58 | 2.43e-89 | 0.9335 |
1. PBF | Q9EXP2 | Cysteine desulfurase | 0.00e+00 | 9.30e-52 | 1.48e-72 | 0.944 |
1. PBF | A2VDS1 | Selenocysteine lyase | 0.00e+00 | 3.21e-34 | 1.99e-25 | 0.7846 |
1. PBF | B0VD51 | Cysteine desulfurase IscS | 0.00e+00 | 7.01e-31 | 2.82e-23 | 0.8051 |
1. PBF | Q1RHY6 | Cysteine desulfurase IscS | 0.00e+00 | 9.62e-31 | 1.54e-23 | 0.8012 |
1. PBF | A5I4Z9 | Cysteine desulfurase IscS | 0.00e+00 | 4.08e-26 | 2.53e-23 | 0.829 |
1. PBF | P37030 | Cysteine desulfurase | 0.00e+00 | 3.55e-24 | 1.14e-22 | 0.8168 |
1. PBF | P70727 | Cysteine desulfurase | 0.00e+00 | 3.88e-20 | 2.06e-10 | 0.7991 |
1. PBF | C6DKM6 | Cysteine desulfurase | 0.00e+00 | 1.13e-63 | 6.34e-85 | 0.953 |
1. PBF | A6TAE4 | Cysteine desulfurase | 0.00e+00 | 1.53e-52 | 1.42e-76 | 0.9473 |
1. PBF | C4K1Z7 | Cysteine desulfurase IscS | 0.00e+00 | 2.50e-31 | 2.73e-25 | 0.7848 |
1. PBF | A4VNY2 | Cysteine desulfurase IscS | 0.00e+00 | 2.52e-30 | 1.10e-25 | 0.8022 |
1. PBF | P63517 | Probable cysteine desulfurase | 0.00e+00 | 1.39e-53 | 2.68e-66 | 0.9146 |
1. PBF | P57989 | Probable cysteine desulfurase | 0.00e+00 | 6.77e-44 | 9.92e-66 | 0.9215 |
1. PBF | Q12P83 | Cysteine desulfurase IscS | 0.00e+00 | 4.91e-31 | 2.14e-29 | 0.8012 |
1. PBF | P55819 | Serine--glyoxylate aminotransferase | 0.00e+00 | 6.54e-11 | 9.16e-08 | 0.6762 |
1. PBF | B4TDB6 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.804 |
1. PBF | O32164 | Cysteine desulfurase SufS | 0.00e+00 | 3.68e-58 | 8.88e-90 | 0.9492 |
1. PBF | Q9CMI7 | Histidinol-phosphate aminotransferase 2 | 2.12e-10 | 2.34e-06 | 0.012 | 0.6782 |
1. PBF | P18549 | Isopenicillin N epimerase | 0.00e+00 | 3.40e-36 | 1.28e-19 | 0.8149 |
1. PBF | B4RMB8 | Cysteine desulfurase IscS | 0.00e+00 | 1.14e-27 | 5.39e-24 | 0.7938 |
1. PBF | Q0T1Y9 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8102 |
1. PBF | Q0TEV5 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8082 |
1. PBF | B1XFY8 | Cysteine desulfurase | 0.00e+00 | 8.33e-58 | 5.45e-79 | 0.941 |
1. PBF | P9WQ66 | Uncharacterized protein MT3887 | 0.00e+00 | 1.45e-36 | 1.01e-13 | 0.8561 |
1. PBF | Q52069 | Cysteine desulfurase | 0.00e+00 | 2.31e-23 | 5.96e-23 | 0.8011 |
1. PBF | O84693 | Probable cysteine desulfurase | 0.00e+00 | 8.71e-62 | 7.18e-57 | 0.919 |
1. PBF | B8DZS1 | Cysteine desulfurase IscS | 0.00e+00 | 1.94e-24 | 1.24e-25 | 0.822 |
1. PBF | B0KPH6 | Cysteine desulfurase IscS | 0.00e+00 | 3.42e-29 | 9.65e-27 | 0.8077 |
1. PBF | Q7ADI4 | Cysteine desulfurase | 0.00e+00 | 9.01e-58 | 1.98e-78 | 0.9473 |
1. PBF | Q6GB11 | Probable cysteine desulfurase | 0.00e+00 | 4.92e-58 | 5.34e-89 | 0.9335 |
1. PBF | Q1IEJ2 | Cysteine desulfurase IscS | 0.00e+00 | 8.61e-29 | 1.29e-27 | 0.8074 |
1. PBF | O34874 | Putative cysteine desulfurase IscS 2 | 0.00e+00 | 2.09e-33 | 2.59e-15 | 0.8569 |
1. PBF | P75298 | Probable cysteine desulfurase | 0.00e+00 | 5.47e-66 | 3.39e-66 | 0.9225 |
1. PBF | B7M7N3 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.81 |
1. PBF | B5QVS9 | Cysteine desulfurase | 0.00e+00 | 2.48e-58 | 2.62e-78 | 0.9391 |
1. PBF | Q0HVP4 | Cysteine desulfurase IscS | 0.00e+00 | 3.96e-30 | 3.06e-29 | 0.8097 |
1. PBF | Q5HQQ0 | Probable cysteine desulfurase | 0.00e+00 | 5.99e-60 | 5.01e-86 | 0.9337 |
1. PBF | Q9K7A0 | Probable cysteine desulfurase | 0.00e+00 | 3.15e-60 | 1.24e-87 | 0.9481 |
1. PBF | Q9PDA6 | Probable cysteine desulfurase | 0.00e+00 | 1.30e-44 | 3.11e-72 | 0.9367 |
1. PBF | A6TCF1 | Cysteine desulfurase IscS | 0.00e+00 | 2.62e-30 | 9.55e-27 | 0.8015 |
1. PBF | A5UAA8 | Cysteine desulfurase IscS | 0.00e+00 | 1.53e-26 | 1.14e-25 | 0.7976 |
1. PBF | P31672 | NifS/IcsS protein homolog | 0.00e+00 | 2.52e-30 | 4.70e-18 | 0.847 |
1. PBF | Q8ZN40 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8042 |
1. PBF | B7US19 | Cysteine desulfurase | 0.00e+00 | 8.55e-58 | 1.21e-78 | 0.9473 |
1. PBF | O30052 | Cysteine desulfurase IscS 1 | 0.00e+00 | 1.46e-31 | 1.46e-24 | 0.8373 |
1. PBF | A9N142 | Cysteine desulfurase | 0.00e+00 | 2.61e-58 | 3.07e-78 | 0.939 |
1. PBF | Q68WP6 | Cysteine desulfurase IscS | 0.00e+00 | 2.08e-32 | 1.43e-25 | 0.8055 |
1. PBF | Q89A19 | Cysteine desulfurase IscS | 0.00e+00 | 7.69e-32 | 9.74e-27 | 0.8083 |
1. PBF | A3QFD5 | Cysteine desulfurase IscS | 0.00e+00 | 1.68e-28 | 6.63e-29 | 0.8096 |
1. PBF | Q55793 | Probable cysteine desulfurase | 0.00e+00 | 2.64e-57 | 5.22e-74 | 0.9288 |
1. PBF | B8NM72 | Cysteine desulfurase-like protein ustD | 0.00e+00 | 2.98e-26 | 1.75e-24 | 0.8561 |
1. PBF | Q03046 | Isopenicillin N epimerase | 0.00e+00 | 2.99e-31 | 3.68e-14 | 0.8378 |
1. PBF | Q6GIH2 | Probable cysteine desulfurase | 0.00e+00 | 4.92e-58 | 5.34e-89 | 0.9334 |
1. PBF | B8CMW5 | Cysteine desulfurase IscS | 0.00e+00 | 2.20e-28 | 1.84e-25 | 0.7948 |
1. PBF | A7MGX8 | Cysteine desulfurase IscS | 0.00e+00 | 4.57e-29 | 2.00e-26 | 0.8044 |
1. PBF | B2VI32 | Cysteine desulfurase IscS | 0.00e+00 | 1.77e-33 | 5.27e-25 | 0.8159 |
1. PBF | Q60C64 | Cysteine desulfurase IscS | 0.00e+00 | 3.21e-27 | 1.75e-23 | 0.7941 |
1. PBF | A8GDU4 | Cysteine desulfurase | 0.00e+00 | 2.61e-58 | 1.54e-81 | 0.9468 |
1. PBF | O27442 | Probable cysteine desulfurase | 0.00e+00 | 2.61e-42 | 7.97e-69 | 0.9301 |
1. PBF | P94479 | Uncharacterized protein YnbB | 3.04e-06 | 7.73e-08 | 0.006 | 0.459 |
1. PBF | B5R5A2 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8043 |
1. PBF | B2HZI5 | Cysteine desulfurase IscS | 0.00e+00 | 7.01e-31 | 2.82e-23 | 0.8059 |
1. PBF | B7MV59 | Cysteine desulfurase | 0.00e+00 | 5.05e-58 | 4.17e-79 | 0.9488 |
1. PBF | Q57LG9 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8041 |
1. PBF | B1HPR6 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.56e-11 | 0.006 | 0.7596 |
1. PBF | Q5PNG1 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.804 |
1. PBF | Q1C761 | Cysteine desulfurase | 0.00e+00 | 7.42e-60 | 5.66e-81 | 0.9563 |
1. PBF | B4TUT5 | Cysteine desulfurase | 0.00e+00 | 2.74e-59 | 1.21e-77 | 0.9296 |
1. PBF | A5UGI1 | Cysteine desulfurase IscS | 0.00e+00 | 1.30e-26 | 2.40e-25 | 0.7976 |
1. PBF | A1KUK1 | Cysteine desulfurase IscS | 0.00e+00 | 4.72e-26 | 2.89e-25 | 0.7978 |
1. PBF | Q44482 | Cysteine desulfurase 2 | 0.00e+00 | 6.28e-22 | 5.48e-22 | 0.8215 |
1. PBF | Q65RS7 | Cysteine desulfurase IscS | 0.00e+00 | 2.81e-28 | 4.00e-29 | 0.8029 |
1. PBF | B2U2I4 | Cysteine desulfurase | 0.00e+00 | 2.06e-58 | 1.72e-78 | 0.9474 |
1. PBF | C3PNQ8 | Cysteine desulfurase IscS | 0.00e+00 | 5.25e-32 | 6.96e-26 | 0.7847 |
1. PBF | Q66A22 | Cysteine desulfurase | 0.00e+00 | 1.61e-59 | 1.57e-80 | 0.9562 |
1. PBF | Q7N224 | Cysteine desulfurase IscS | 0.00e+00 | 1.43e-29 | 1.66e-30 | 0.8042 |
1. PBF | P23120 | Cysteine desulfurase | 0.00e+00 | 1.42e-17 | 4.35e-12 | 0.8061 |
1. PBF | Q6D625 | Cysteine desulfurase | 0.00e+00 | 3.05e-59 | 4.59e-85 | 0.9414 |
1. PBF | B8F356 | Cysteine desulfurase IscS | 0.00e+00 | 1.51e-26 | 5.20e-28 | 0.8041 |
1. PBF | A2QJI5 | Kynureninase 2 | 0.00e+00 | 2.45e-11 | 0.003 | 0.7174 |
1. PBF | Q4K6T8 | Cysteine desulfurase IscS | 0.00e+00 | 3.32e-30 | 5.49e-25 | 0.8023 |
1. PBF | P0A6B9 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8102 |
1. PBF | Q57PR2 | Cysteine desulfurase | 0.00e+00 | 6.49e-60 | 5.79e-78 | 0.9295 |
1. PBF | Q44507 | Cysteine desulfurase 1 | 0.00e+00 | 9.94e-22 | 2.83e-27 | 0.8237 |
1. PBF | Q9JTX0 | Cysteine desulfurase IscS | 0.00e+00 | 2.30e-26 | 3.09e-25 | 0.7977 |
1. PBF | B1JJ48 | Cysteine desulfurase | 0.00e+00 | 7.42e-60 | 5.66e-81 | 0.9564 |
1. PBF | Q2GGJ4 | Cysteine desulfurase IscS | 0.00e+00 | 4.92e-33 | 1.85e-25 | 0.789 |
1. PBF | B5BAW6 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8039 |
1. PBF | A9QZC9 | Cysteine desulfurase | 0.00e+00 | 2.53e-59 | 2.20e-81 | 0.9564 |
1. PBF | A8EYH9 | Cysteine desulfurase IscS | 0.00e+00 | 1.23e-32 | 1.32e-24 | 0.8063 |
1. PBF | A8GHY3 | Cysteine desulfurase IscS | 0.00e+00 | 6.61e-28 | 4.75e-25 | 0.8042 |
1. PBF | Q7MNG2 | Cysteine desulfurase IscS | 0.00e+00 | 5.75e-29 | 2.09e-30 | 0.8065 |
1. PBF | Q9Z7L5 | Probable cysteine desulfurase | 0.00e+00 | 4.02e-69 | 2.21e-60 | 0.928 |
1. PBF | B8D8B6 | Cysteine desulfurase IscS | 0.00e+00 | 5.69e-32 | 2.85e-28 | 0.805 |
1. PBF | Q49420 | Probable cysteine desulfurase | 0.00e+00 | 5.69e-65 | 3.71e-64 | 0.9287 |
1. PBF | B7LQ96 | Cysteine desulfurase | 0.00e+00 | 1.50e-58 | 8.11e-79 | 0.941 |
1. PBF | A9L3R0 | Cysteine desulfurase IscS | 0.00e+00 | 2.55e-31 | 1.88e-27 | 0.8116 |
1. PBF | O25008 | Cysteine desulfurase IscS | 0.00e+00 | 2.65e-31 | 4.37e-19 | 0.8317 |
1. PBF | B4T4R6 | Cysteine desulfurase | 0.00e+00 | 2.48e-58 | 2.62e-78 | 0.9444 |
1. PBF | A7MF59 | Cysteine desulfurase | 0.00e+00 | 1.73e-56 | 9.14e-77 | 0.9486 |
1. PBF | B7UWH7 | Cysteine desulfurase IscS | 0.00e+00 | 2.07e-30 | 7.28e-24 | 0.7864 |
1. PBF | B7LDC2 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.81 |
1. PBF | Q8SQS2 | Cysteine desulfurase, mitosomal | 0.00e+00 | 2.90e-23 | 1.29e-21 | 0.8031 |
1. PBF | A1ABL8 | Cysteine desulfurase | 0.00e+00 | 5.05e-58 | 4.17e-79 | 0.9488 |
1. PBF | A4Y7D7 | Cysteine desulfurase IscS | 0.00e+00 | 1.45e-30 | 3.48e-29 | 0.8015 |
1. PBF | Q9KTY2 | Cysteine desulfurase IscS | 0.00e+00 | 9.16e-30 | 2.41e-30 | 0.8077 |
1. PBF | P87187 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 4.79e-02 | 6.74e-24 | 0.7979 |
1. PBF | Q7VMA9 | Cysteine desulfurase IscS | 0.00e+00 | 1.40e-26 | 1.13e-30 | 0.7989 |
1. PBF | A0A1C3YKE0 | Aminotransferase-like protein FGM3 | 0.00e+00 | 2.07e-38 | 1.87e-27 | 0.8691 |
1. PBF | Q9HXX3 | Probable cysteine desulfurase | 0.00e+00 | 8.36e-63 | 2.95e-61 | 0.9411 |
1. PBF | Q6CDM0 | Kynureninase | 0.00e+00 | 1.51e-18 | 0.007 | 0.7373 |
1. PBF | B7H3H0 | Cysteine desulfurase IscS | 0.00e+00 | 7.01e-31 | 2.82e-23 | 0.8059 |
1. PBF | Q8FH54 | Cysteine desulfurase | 0.00e+00 | 8.55e-58 | 1.21e-78 | 0.9474 |
1. PBF | Q9HXI8 | Cysteine desulfurase IscS | 0.00e+00 | 1.70e-30 | 6.93e-24 | 0.7983 |
1. PBF | B7I5Q3 | Cysteine desulfurase IscS | 0.00e+00 | 7.01e-31 | 2.82e-23 | 0.8056 |
1. PBF | A5CWM6 | Cysteine desulfurase IscS | 0.00e+00 | 4.04e-30 | 2.23e-23 | 0.7969 |
1. PBF | O08374 | Serine--glyoxylate aminotransferase | 0.00e+00 | 5.75e-10 | 0.010 | 0.6858 |
1. PBF | Q1CIJ6 | Cysteine desulfurase | 0.00e+00 | 7.42e-60 | 5.66e-81 | 0.9563 |
1. PBF | Q9V242 | Probable cysteine desulfurase | 0.00e+00 | 8.41e-52 | 3.40e-73 | 0.9351 |
1. PBF | D4GYV5 | Cysteine desulfurase | 0.00e+00 | 1.40e-41 | 3.09e-73 | 0.919 |
1. PBF | Q5HHH0 | Probable cysteine desulfurase | 0.00e+00 | 4.92e-58 | 5.34e-89 | 0.9335 |
1. PBF | B8JC53 | Cysteine desulfurase IscS | 0.00e+00 | 4.12e-28 | 2.57e-25 | 0.8133 |
1. PBF | P14776 | Soluble hydrogenase, small subunit | 0.00e+00 | 3.54e-11 | 5.48e-05 | 0.7345 |
1. PBF | B7UGX6 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8102 |
1. PBF | A4W9R3 | Cysteine desulfurase | 0.00e+00 | 3.18e-57 | 2.67e-81 | 0.9355 |
1. PBF | P55690 | Cysteine desulfurase | 0.00e+00 | 1.80e-27 | 2.96e-24 | 0.824 |
1. PBF | B1IWD1 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8095 |
1. PBF | C6DBJ1 | Cysteine desulfurase IscS | 0.00e+00 | 1.02e-28 | 2.00e-26 | 0.8041 |
1. PBF | Q321D9 | Cysteine desulfurase | 0.00e+00 | 2.06e-58 | 1.72e-78 | 0.9473 |
1. PBF | Q3Z233 | Cysteine desulfurase | 0.00e+00 | 6.07e-58 | 1.55e-79 | 0.9473 |
1. PBF | Q9ZML2 | Cysteine desulfurase IscS | 0.00e+00 | 8.67e-32 | 3.68e-20 | 0.8337 |
1. PBF | A8GNU0 | Cysteine desulfurase IscS | 0.00e+00 | 2.31e-31 | 5.72e-25 | 0.7858 |
1. PBF | Q9JYY0 | Cysteine desulfurase IscS | 0.00e+00 | 6.36e-28 | 3.69e-24 | 0.797 |
1. PBF | B4EZU8 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 3.61e-27 | 0.8077 |
1. PBF | A5VYS4 | Cysteine desulfurase IscS | 0.00e+00 | 4.15e-29 | 2.43e-27 | 0.8094 |
1. PBF | Q6D259 | Cysteine desulfurase IscS | 0.00e+00 | 9.52e-30 | 1.06e-25 | 0.8051 |
1. PBF | A1AWM1 | Cysteine desulfurase IscS | 0.00e+00 | 3.60e-28 | 5.76e-22 | 0.7911 |
1. PBF | P14909 | Aspartate aminotransferase | 2.28e-08 | 1.22e-02 | 0.048 | 0.5911 |
1. PBF | B5XQH2 | Cysteine desulfurase | 0.00e+00 | 1.19e-53 | 4.33e-78 | 0.9436 |
1. PBF | B7N516 | Cysteine desulfurase | 0.00e+00 | 1.52e-57 | 5.22e-79 | 0.941 |
1. PBF | B2US50 | Cysteine desulfurase IscS | 0.00e+00 | 1.08e-31 | 8.50e-20 | 0.8384 |
1. PBF | O83623 | Probable cysteine desulfurase | 0.00e+00 | 1.23e-62 | 8.15e-57 | 0.9305 |
1. PBF | C4ZXA5 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8073 |
1. PBF | C3LT01 | Cysteine desulfurase IscS | 0.00e+00 | 8.64e-30 | 1.45e-30 | 0.8076 |
1. PBF | Q080P6 | Cysteine desulfurase IscS | 0.00e+00 | 1.74e-30 | 2.22e-28 | 0.8076 |
1. PBF | Q43884 | Cysteine desulfurase | 0.00e+00 | 9.94e-22 | 2.83e-27 | 0.8292 |
1. PBF | B5Z104 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8081 |
1. PBF | Q0THE9 | Cysteine desulfurase | 0.00e+00 | 3.26e-57 | 5.17e-79 | 0.9473 |
1. PBF | B7VJS6 | Cysteine desulfurase IscS | 0.00e+00 | 2.92e-28 | 3.52e-31 | 0.8067 |
1. PBF | B7LKA9 | Cysteine desulfurase IscS | 0.00e+00 | 6.58e-30 | 1.46e-25 | 0.8065 |
1. PBF | B0UVL5 | Cysteine desulfurase IscS | 0.00e+00 | 1.49e-27 | 1.40e-24 | 0.7976 |
1. PBF | A8GWB2 | Cysteine desulfurase IscS | 0.00e+00 | 3.25e-30 | 3.80e-24 | 0.8106 |
1. PBF | P0A6C0 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.808 |
1. PBF | Q88PK8 | Cysteine desulfurase IscS | 0.00e+00 | 4.15e-29 | 2.43e-27 | 0.8097 |
1. PBF | Q8D0M6 | Cysteine desulfurase | 0.00e+00 | 7.42e-60 | 5.66e-81 | 0.9563 |
1. PBF | Q9Z5X5 | Cysteine desulfurase | 0.00e+00 | 1.64e-18 | 3.53e-22 | 0.8076 |
1. PBF | Q1RBB6 | Cysteine desulfurase | 0.00e+00 | 5.05e-58 | 4.17e-79 | 0.948 |
1. PBF | Q9HMM6 | Probable cysteine desulfurase | 0.00e+00 | 7.28e-50 | 3.59e-73 | 0.9331 |
1. PBF | Q4UL77 | Cysteine desulfurase IscS | 0.00e+00 | 1.35e-31 | 5.95e-27 | 0.7831 |
1. PBF | Q5U4Q9 | Selenocysteine lyase | 0.00e+00 | 3.91e-29 | 2.86e-21 | 0.8075 |
1. PBF | B4TRX5 | Cysteine desulfurase IscS | 0.00e+00 | 7.25e-30 | 6.45e-27 | 0.8045 |
1. PBF | A7ZME5 | Cysteine desulfurase | 0.00e+00 | 2.79e-57 | 6.34e-77 | 0.941 |
1. PBF | O29689 | Cysteine desulfurase IscS 2 | 0.00e+00 | 1.29e-30 | 8.84e-23 | 0.8328 |
1. PBF | B7NRH9 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8098 |
1. PBF | Q6LU62 | Cysteine desulfurase IscS | 0.00e+00 | 1.77e-29 | 4.15e-28 | 0.8049 |
1. PBF | B5F1C0 | Cysteine desulfurase IscS | 0.00e+00 | 6.20e-30 | 6.64e-27 | 0.8043 |
1. PBF | B0BXX6 | Cysteine desulfurase IscS | 0.00e+00 | 1.04e-31 | 2.12e-25 | 0.7777 |
1. PBF | B4UCP2 | Cysteine desulfurase IscS | 0.00e+00 | 4.98e-28 | 2.80e-25 | 0.8134 |
1. PBF | Q4WPN0 | Kynureninase 2 | 0.00e+00 | 8.05e-11 | 0.002 | 0.678 |
1. PBF | Q87DJ2 | Probable cysteine desulfurase | 0.00e+00 | 5.77e-43 | 6.79e-70 | 0.9366 |
1. PBF | Q2INI7 | Cysteine desulfurase IscS | 0.00e+00 | 4.79e-28 | 1.06e-25 | 0.8132 |
1. PBF | B5RAT4 | Cysteine desulfurase | 0.00e+00 | 6.75e-58 | 2.38e-78 | 0.9401 |
1. PBF | Q7UAH4 | Cysteine desulfurase | 0.00e+00 | 3.35e-57 | 7.49e-78 | 0.9411 |
1. PBF | A1RJ52 | Cysteine desulfurase IscS | 0.00e+00 | 1.45e-30 | 3.48e-29 | 0.8015 |
1. PBF | Q1H361 | Cysteine desulfurase IscS | 0.00e+00 | 2.25e-27 | 1.26e-25 | 0.8028 |
1. PBF | Q47EN5 | Cysteine desulfurase IscS | 0.00e+00 | 9.30e-29 | 3.74e-22 | 0.7987 |
1. PBF | Q66IQ6 | Selenocysteine lyase | 0.00e+00 | 2.50e-34 | 6.94e-19 | 0.7891 |
1. PBF | A7H804 | Cysteine desulfurase IscS | 0.00e+00 | 3.22e-28 | 4.94e-24 | 0.8063 |
1. PBF | B1KNI3 | Cysteine desulfurase IscS | 0.00e+00 | 1.95e-30 | 8.24e-27 | 0.8095 |
1. PBF | P0A6B8 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | 0.8084 |
1. PBF | A6VMN7 | Cysteine desulfurase IscS | 0.00e+00 | 1.95e-26 | 1.06e-27 | 0.8009 |
1. PBF | C3K1M5 | Cysteine desulfurase IscS | 0.00e+00 | 2.52e-30 | 5.49e-25 | 0.8022 |
1. PBF | P38033 | Putative cysteine desulfurase NifS | 0.00e+00 | 4.70e-28 | 3.09e-16 | 0.811 |
1. PBF | P57657 | Cysteine desulfurase IscS | 0.00e+00 | 5.69e-32 | 2.85e-28 | 0.8053 |
1. PBF | Q92HP1 | Cysteine desulfurase IscS | 0.00e+00 | 1.27e-31 | 2.45e-25 | 0.7848 |
1. PBF | Q9YAB6 | Probable cysteine desulfurase | 0.00e+00 | 2.63e-55 | 6.83e-57 | 0.9104 |
1. PBF | A5DTF4 | Kynureninase | 0.00e+00 | 6.15e-17 | 0.001 | 0.7417 |
1. PBF | A9MEP3 | Cysteine desulfurase | 0.00e+00 | 1.14e-61 | 7.99e-78 | 0.93 |
1. PBF | B7MA32 | Cysteine desulfurase | 0.00e+00 | 5.05e-58 | 4.17e-79 | 0.9481 |
1. PBF | C1FTC4 | Cysteine desulfurase IscS | 0.00e+00 | 3.33e-26 | 8.63e-23 | 0.8315 |
1. PBF | B5F7C4 | Cysteine desulfurase | 0.00e+00 | 3.58e-58 | 5.55e-78 | 0.9296 |
1. PBF | B7L5N2 | Cysteine desulfurase | 0.00e+00 | 5.05e-58 | 4.17e-79 | 0.9488 |
1. PBF | P57794 | Cysteine desulfurase | 0.00e+00 | 7.09e-24 | 2.68e-21 | 0.8138 |
1. PBF | Q3K7A5 | Cysteine desulfurase IscS | 0.00e+00 | 2.95e-30 | 1.13e-26 | 0.8093 |
1. PBF | Q7N3U5 | Cysteine desulfurase | 0.00e+00 | 7.42e-60 | 2.32e-81 | 0.9387 |
1. PBF | C4ZYE2 | Cysteine desulfurase | 0.00e+00 | 8.33e-58 | 5.45e-79 | 0.941 |
1. PBF | A0KJ32 | Cysteine desulfurase IscS | 0.00e+00 | 3.28e-28 | 3.00e-22 | 0.8042 |
1. PBF | B8E9D2 | Cysteine desulfurase IscS | 0.00e+00 | 7.01e-31 | 3.27e-27 | 0.8118 |
1. PBF | O54055 | Cysteine desulfurase IscS | 0.00e+00 | 3.32e-25 | 3.92e-16 | 0.8125 |
1. PBF | B1IQ76 | Cysteine desulfurase | 0.00e+00 | 2.10e-59 | 6.45e-78 | 0.941 |
1. PBF | Q0HJF4 | Cysteine desulfurase IscS | 0.00e+00 | 4.12e-30 | 6.44e-29 | 0.8099 |
1. PBF | P12623 | Cysteine desulfurase | 0.00e+00 | 1.06e-21 | 5.82e-27 | 0.8257 |
1. PBF | A5F3G4 | Cysteine desulfurase IscS | 0.00e+00 | 9.16e-30 | 2.41e-30 | 0.8076 |
1. PBF | Q07177 | Cysteine desulfurase | 0.00e+00 | 9.13e-26 | 7.74e-13 | 0.841 |
1. PBF | Q0I1L2 | Cysteine desulfurase IscS | 0.00e+00 | 1.38e-27 | 1.45e-24 | 0.7976 |
1. PBF | A7FHJ2 | Cysteine desulfurase | 0.00e+00 | 2.53e-59 | 5.06e-79 | 0.9503 |
1. PBF | Q8CTA4 | Probable cysteine desulfurase | 0.00e+00 | 6.67e-60 | 4.55e-86 | 0.9337 |
1. PBF | Q01179 | Cysteine desulfurase | 0.00e+00 | 1.43e-27 | 8.41e-25 | 0.842 |
1. PBF | O51111 | Probable cysteine desulfurase | 0.00e+00 | 7.14e-57 | 4.22e-74 | 0.9282 |
2. PF | A6LAM2 | Histidinol-phosphate aminotransferase | 9.20e-08 | 7.03e-10 | NA | 0.6173 |
2. PF | Q0TBL4 | L-seryl-tRNA(Sec) selenium transferase | 7.99e-06 | 1.52e-02 | NA | 0.4416 |
2. PF | Q64U78 | Serine hydroxymethyltransferase | 1.34e-09 | 5.63e-07 | NA | 0.5722 |
2. PF | Q9UWT5 | Serine hydroxymethyltransferase | 6.85e-10 | 1.44e-11 | NA | 0.6158 |
2. PF | A6VP23 | Serine hydroxymethyltransferase | 3.41e-10 | 1.86e-07 | NA | 0.6655 |
2. PF | A1SY89 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.04e-11 | NA | 0.7672 |
2. PF | Q5QZ49 | Histidinol-phosphate aminotransferase 1 | 5.08e-10 | 1.12e-05 | NA | 0.6588 |
2. PF | Q49XY0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.61e-08 | 1.32e-06 | NA | 0.673 |
2. PF | O59347 | Serine hydroxymethyltransferase | 3.32e-10 | 2.45e-11 | NA | 0.6613 |
2. PF | B7HNY9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.35e-07 | 1.53e-05 | NA | 0.6807 |
2. PF | B8DC01 | Histidinol-phosphate aminotransferase | 6.49e-10 | 1.04e-06 | NA | 0.6034 |
2. PF | C0QKX3 | Serine hydroxymethyltransferase | 3.56e-10 | 6.34e-08 | NA | 0.661 |
2. PF | Q0I555 | Serine hydroxymethyltransferase | 2.57e-10 | 6.34e-08 | NA | 0.646 |
2. PF | Q0BMN1 | Serine hydroxymethyltransferase | 4.34e-10 | 8.79e-07 | NA | 0.6643 |
2. PF | B6J4T8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.63e-07 | 4.92e-07 | NA | 0.6904 |
2. PF | Q750P5 | Kynureninase | 0.00e+00 | 1.31e-18 | NA | 0.7221 |
2. PF | Q2FSD2 | Probable L-tyrosine/L-aspartate decarboxylase | 2.65e-12 | 2.97e-06 | NA | 0.7206 |
2. PF | Q83B09 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.24e-07 | 4.65e-07 | NA | 0.6906 |
2. PF | Q2FTY4 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 2 | 6.77e-11 | 9.86e-10 | NA | 0.6326 |
2. PF | Q1INU0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.92e-08 | 3.88e-09 | NA | 0.6637 |
2. PF | Q5X8W3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.22e-15 | 1.10e-08 | NA | 0.6728 |
2. PF | Q6GGG4 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.61e-10 | 1.65e-05 | NA | 0.6622 |
2. PF | B4SWS3 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.56e-10 | NA | 0.7533 |
2. PF | Q5L9Q0 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.05e-12 | NA | 0.7585 |
2. PF | O67740 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.47e-08 | 1.67e-06 | NA | 0.6606 |
2. PF | B8FT31 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.80e-11 | 1.42e-08 | NA | 0.6533 |
2. PF | B0R349 | Probable L-aspartate decarboxylase | 0.00e+00 | 6.05e-11 | NA | 0.758 |
2. PF | O57709 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.47e-07 | 3.71e-07 | NA | 0.6636 |
2. PF | Q1CDA2 | L-seryl-tRNA(Sec) selenium transferase | 7.99e-06 | 4.87e-02 | NA | 0.4427 |
2. PF | B5XMW1 | L-seryl-tRNA(Sec) selenium transferase | 9.15e-06 | 1.34e-02 | NA | 0.4405 |
2. PF | C3MWN2 | Serine hydroxymethyltransferase | 3.31e-10 | 2.35e-12 | NA | 0.6438 |
2. PF | C1FTF1 | Serine hydroxymethyltransferase | 2.75e-10 | 6.65e-08 | NA | 0.6782 |
2. PF | Q8PXA5 | Probable L-tyrosine/L-aspartate decarboxylase | 7.81e-11 | 8.28e-10 | NA | 0.7025 |
2. PF | Q8NWD0 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.77e-10 | 1.48e-05 | NA | 0.6598 |
2. PF | A6U207 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.88e-08 | 3.31e-06 | NA | 0.678 |
2. PF | Q2P3K2 | Histidinol-phosphate aminotransferase | 1.61e-11 | 8.97e-09 | NA | 0.6349 |
2. PF | A1A1V0 | Serine hydroxymethyltransferase | 9.69e-10 | 1.35e-08 | NA | 0.6765 |
2. PF | Q4UU41 | Histidinol-phosphate aminotransferase | 3.31e-08 | 1.05e-09 | NA | 0.6416 |
2. PF | B6J2H6 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.89e-07 | 2.28e-07 | NA | 0.6918 |
2. PF | A7GPY3 | Kynureninase | 0.00e+00 | 2.99e-18 | NA | 0.7458 |
2. PF | O67193 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.07e-07 | 2.99e-08 | NA | 0.6354 |
2. PF | C0M6L7 | Serine hydroxymethyltransferase | 5.19e-10 | 1.48e-07 | NA | 0.6275 |
2. PF | P96060 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 5.90e-10 | NA | 0.7449 |
2. PF | A6U206 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 7.01e-10 | 8.40e-06 | NA | 0.6484 |
2. PF | A7HDC9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.81e-09 | 1.20e-06 | NA | 0.6419 |
2. PF | B1HSN5 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.80e-07 | 2.89e-05 | NA | 0.6766 |
2. PF | Q9K936 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.81e-10 | 5.26e-06 | NA | 0.6572 |
2. PF | Q88QJ8 | L-seryl-tRNA(Sec) selenium transferase | 1.19e-05 | 2.61e-02 | NA | 0.4627 |
2. PF | A3CWM4 | Probable L-tyrosine/L-aspartate decarboxylase | 2.24e-12 | 4.74e-08 | NA | 0.7368 |
2. PF | B4F0S0 | L-seryl-tRNA(Sec) selenium transferase | 7.31e-06 | 2.18e-02 | NA | 0.4443 |
2. PF | Q4J937 | Serine hydroxymethyltransferase | 3.27e-10 | 2.83e-10 | NA | 0.627 |
2. PF | A1TYW8 | Serine hydroxymethyltransferase | 6.69e-10 | 5.46e-09 | NA | 0.6571 |
2. PF | B2GAT4 | Serine hydroxymethyltransferase | 2.98e-10 | 3.80e-07 | NA | 0.6565 |
2. PF | A6L2V8 | Histidinol-phosphate aminotransferase | 7.46e-08 | 1.23e-09 | NA | 0.6062 |
2. PF | Q3K9Y3 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.35e-10 | NA | 0.7189 |
2. PF | Q13YI7 | 2-aminoethylphosphonate--pyruvate transaminase 1 | 2.22e-16 | 9.77e-11 | NA | 0.6469 |
2. PF | Q9UZD5 | Probable L-aspartate decarboxylase | 5.04e-13 | 6.62e-11 | NA | 0.7096 |
2. PF | A9VH10 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.45e-07 | 2.45e-05 | NA | 0.6798 |
2. PF | Q8U039 | Serine hydroxymethyltransferase | 2.69e-10 | 7.54e-11 | NA | 0.6786 |
2. PF | Q736W3 | Kynureninase | 0.00e+00 | 5.11e-18 | NA | 0.7309 |
2. PF | Q0T1W9 | Serine hydroxymethyltransferase | 2.73e-10 | 1.69e-08 | NA | 0.6536 |
2. PF | C3NE25 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.50e-07 | 1.06e-07 | NA | 0.6663 |
2. PF | A5VXT7 | L-seryl-tRNA(Sec) selenium transferase | 1.15e-05 | 2.09e-02 | NA | 0.4571 |
2. PF | C3LKQ2 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.30e-07 | 1.68e-05 | NA | 0.6853 |
2. PF | A0AK37 | Histidinol-phosphate aminotransferase | 1.11e-09 | 1.20e-06 | NA | 0.6295 |
2. PF | B6YVY6 | Serine hydroxymethyltransferase | 6.00e-10 | 4.04e-11 | NA | 0.6453 |
2. PF | P0CO52 | Kynureninase | 0.00e+00 | 1.60e-15 | NA | 0.6856 |
2. PF | P52878 | Phosphoserine aminotransferase | 1.96e-13 | 4.84e-09 | NA | 0.6697 |
2. PF | Q8NTT4 | Probable phenylalanine aminotransferase | 1.60e-09 | 8.99e-08 | NA | 0.654 |
2. PF | Q02BS4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.38e-10 | 2.96e-08 | NA | 0.6192 |
2. PF | Q8K9P2 | Serine hydroxymethyltransferase | 2.91e-10 | 2.28e-08 | NA | 0.6153 |
2. PF | Q9HPK0 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.54e-10 | 4.35e-07 | NA | 0.6385 |
2. PF | B0K742 | Serine hydroxymethyltransferase | 1.66e-10 | 2.47e-07 | NA | 0.6237 |
2. PF | C3NGT4 | Serine hydroxymethyltransferase | 6.34e-10 | 2.26e-12 | NA | 0.6425 |
2. PF | B3R0G5 | Serine hydroxymethyltransferase | 3.24e-10 | 1.43e-07 | NA | 0.6594 |
2. PF | Q2T3K6 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.26e-12 | NA | 0.726 |
2. PF | Q3JH97 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 3.27e-11 | NA | 0.7354 |
2. PF | B2JLS3 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 2.52e-11 | NA | 0.7416 |
2. PF | O58489 | Aspartate aminotransferase | 1.01e-08 | 5.79e-06 | NA | 0.6079 |
2. PF | Q8PM33 | Kynureninase | 0.00e+00 | 2.90e-13 | NA | 0.7611 |
2. PF | Q55128 | Aspartate aminotransferase | 1.18e-08 | 3.98e-06 | NA | 0.5641 |
2. PF | Q9YAH7 | Serine hydroxymethyltransferase | 2.81e-10 | 5.67e-11 | NA | 0.6782 |
2. PF | Q2T437 | Serine hydroxymethyltransferase 2 | 5.42e-10 | 4.49e-07 | NA | 0.6722 |
2. PF | Q46DU3 | Probable L-tyrosine/L-aspartate decarboxylase | 8.80e-13 | 2.83e-10 | NA | 0.7042 |
2. PF | Q3ZXL8 | Histidinol-phosphate aminotransferase | 1.23e-10 | 1.91e-10 | NA | 0.6797 |
2. PF | P47634 | Serine hydroxymethyltransferase | 4.45e-14 | 8.13e-07 | NA | 0.6223 |
2. PF | C1L2Q6 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.66e-07 | 4.38e-06 | NA | 0.6597 |
2. PF | A4FWW1 | Histidinol-phosphate aminotransferase | 4.23e-08 | 8.29e-08 | NA | 0.641 |
2. PF | A0M287 | Histidinol-phosphate aminotransferase | 5.05e-08 | 5.88e-09 | NA | 0.5879 |
2. PF | Q62CM5 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 4.04e-11 | NA | 0.7188 |
2. PF | C5A7J1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.17e-09 | 3.35e-07 | NA | 0.6642 |
2. PF | A9MWZ9 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 5.68e-10 | NA | 0.7551 |
2. PF | Q5WV43 | Histidinol-phosphate aminotransferase 2 | 3.78e-10 | 6.22e-07 | NA | 0.6593 |
2. PF | B7L708 | L-seryl-tRNA(Sec) selenium transferase | 7.28e-06 | 1.91e-02 | NA | 0.4448 |
2. PF | C1KWM5 | Histidinol-phosphate aminotransferase | 5.56e-08 | 1.82e-06 | NA | 0.6577 |
2. PF | P55683 | Histidinol-phosphate aminotransferase | 1.92e-08 | 1.05e-08 | NA | 0.6377 |
2. PF | Q8CMM0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.02e-08 | 3.46e-06 | NA | 0.6855 |
2. PF | Q0UZK0 | Kynureninase 2 | 0.00e+00 | 4.23e-09 | NA | 0.7508 |
2. PF | B7J2G3 | Serine hydroxymethyltransferase | 1.43e-09 | 7.03e-10 | NA | 0.6428 |
2. PF | A3P2G7 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 3.27e-11 | NA | 0.746 |
2. PF | B7HH81 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 4.28e-09 | NA | 0.7686 |
2. PF | A7NB66 | Serine hydroxymethyltransferase | 3.98e-10 | 8.79e-07 | NA | 0.6212 |
2. PF | Q311Z4 | Histidinol-phosphate aminotransferase | 7.58e-10 | 1.74e-06 | NA | 0.6288 |
2. PF | Q5HFM3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.09e-08 | 5.91e-06 | NA | 0.6862 |
2. PF | A7FWM6 | Serine hydroxymethyltransferase | 1.93e-10 | 4.41e-08 | NA | 0.6738 |
2. PF | P58891 | Histidinol-phosphate aminotransferase | 1.04e-05 | 2.17e-10 | NA | 0.6548 |
2. PF | P64219 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.49e-10 | 8.40e-06 | NA | 0.666 |
2. PF | Q972A2 | Aspartate aminotransferase | 1.35e-08 | 8.50e-04 | NA | 0.5874 |
2. PF | Q2SFI7 | Serine hydroxymethyltransferase 1 | 7.15e-10 | 6.96e-07 | NA | 0.6467 |
2. PF | Q0W486 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 2 | 8.44e-11 | 4.91e-08 | NA | 0.6825 |
2. PF | Q5SKW7 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 1.03e-07 | 8.65e-09 | NA | 0.6746 |
2. PF | Q72DA0 | Histidinol-phosphate aminotransferase | 7.78e-10 | 6.55e-05 | NA | 0.6519 |
2. PF | A5F049 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.96e-11 | NA | 0.7482 |
2. PF | A4TMW4 | Serine hydroxymethyltransferase | 3.82e-10 | 3.07e-08 | NA | 0.657 |
2. PF | Q64RE8 | Histidinol-phosphate aminotransferase | 1.24e-07 | 1.30e-08 | NA | 0.6285 |
2. PF | Q3B2I7 | Serine hydroxymethyltransferase | 1.61e-09 | 6.27e-08 | NA | 0.6727 |
2. PF | A6WF55 | Serine hydroxymethyltransferase | 3.51e-10 | 1.54e-08 | NA | 0.6646 |
2. PF | B0U3B2 | Histidinol-phosphate aminotransferase | 1.84e-08 | 1.52e-08 | NA | 0.6235 |
2. PF | Q24TH5 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.53e-11 | 8.35e-09 | NA | 0.6464 |
2. PF | Q8TUQ9 | Probable L-tyrosine/L-aspartate decarboxylase | 0.00e+00 | 2.62e-09 | NA | 0.7117 |
2. PF | Q5DGJ1 | Kynureninase | 0.00e+00 | 2.85e-18 | NA | 0.7125 |
2. PF | A0A0D2YG02 | Sulfhydrylase FUB7 | 7.14e-08 | 2.34e-06 | NA | 0.5191 |
2. PF | B9IXL7 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.38e-07 | 1.53e-05 | NA | 0.6761 |
2. PF | Q8J0B2 | Sulfhydrylase-like protein lolC1 | 1.47e-07 | 2.41e-03 | NA | 0.5127 |
2. PF | Q97ZI8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 8.72e-09 | 2.57e-08 | NA | 0.6645 |
2. PF | Q12XS4 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 1 | 9.80e-11 | 2.39e-08 | NA | 0.6705 |
2. PF | B5BDA1 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 5.33e-10 | NA | 0.7579 |
2. PF | Q1BQZ3 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 7.58e-10 | NA | 0.7087 |
2. PF | Q5HP13 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.19e-08 | 3.46e-06 | NA | 0.6857 |
2. PF | Q9UXT1 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.24e-07 | 2.28e-07 | NA | 0.6774 |
2. PF | Q3AQ15 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.46e-07 | 1.38e-06 | NA | 0.6791 |
2. PF | B1ZZW8 | Serine hydroxymethyltransferase | 3.24e-10 | 2.61e-06 | NA | 0.6569 |
2. PF | A8MEG7 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 8.16e-07 | 3.70e-05 | NA | 0.6635 |
2. PF | A6QH79 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 7.14e-10 | 8.95e-06 | NA | 0.6644 |
2. PF | C3NHN8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.52e-07 | 1.03e-07 | NA | 0.6466 |
2. PF | B2FL97 | Kynureninase | 0.00e+00 | 3.98e-11 | NA | 0.7741 |
2. PF | A2S233 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 4.04e-11 | NA | 0.7345 |
2. PF | A0B9M9 | Probable L-tyrosine/L-aspartate decarboxylase | 3.87e-13 | 1.44e-11 | NA | 0.6986 |
2. PF | Q2N886 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.10e-08 | 1.68e-06 | NA | 0.6854 |
2. PF | A7NAH8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.60e-07 | 9.99e-10 | NA | 0.6487 |
2. PF | Q0BN71 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.98e-10 | 1.09e-09 | NA | 0.6517 |
2. PF | Q972C1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.68e-09 | 4.06e-06 | NA | 0.6284 |
2. PF | O07051 | L-allo-threonine aldolase | 4.51e-14 | 1.33e-10 | NA | 0.7211 |
2. PF | B9LZW4 | L-seryl-tRNA(Sec) selenium transferase | 2.07e-06 | 7.24e-03 | NA | 0.4401 |
2. PF | A7Z6M2 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.76e-10 | 4.43e-06 | NA | 0.6593 |
2. PF | Q0SYB5 | L-seryl-tRNA(Sec) selenium transferase | 9.28e-06 | 2.82e-02 | NA | 0.4232 |
2. PF | Q971K4 | Serine hydroxymethyltransferase | 3.78e-10 | 5.02e-12 | NA | 0.6577 |
2. PF | Q81CK0 | Kynureninase | 0.00e+00 | 7.34e-18 | NA | 0.7407 |
2. PF | O27188 | Probable L-tyrosine/L-aspartate decarboxylase | 2.98e-14 | 4.18e-09 | NA | 0.7464 |
2. PF | Q5QWQ9 | Histidinol-phosphate aminotransferase 2 | 2.95e-09 | 2.56e-10 | NA | 0.607 |
2. PF | Q46E46 | Histidinol-phosphate aminotransferase | 4.81e-10 | 2.41e-09 | NA | 0.6636 |
2. PF | C3P4E3 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 2.69e-09 | NA | 0.731 |
2. PF | Q63MV1 | Serine hydroxymethyltransferase 2 | 5.28e-10 | 6.96e-07 | NA | 0.6697 |
2. PF | B7HK48 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.60e-08 | NA | 0.7644 |
2. PF | B6I3G5 | L-seryl-tRNA(Sec) selenium transferase | 7.30e-06 | 1.91e-02 | NA | 0.4408 |
2. PF | A0Q7C5 | Serine hydroxymethyltransferase | 4.28e-10 | 4.30e-07 | NA | 0.6293 |
2. PF | B3EEC8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.95e-07 | 1.12e-05 | NA | 0.6702 |
2. PF | A7I9Z8 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 2 | 1.23e-10 | 1.64e-10 | NA | 0.64 |
2. PF | Q9HII2 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.83e-08 | 4.31e-08 | NA | 0.661 |
2. PF | Q6L1F6 | Serine hydroxymethyltransferase | 6.32e-10 | 9.77e-11 | NA | 0.6554 |
2. PF | Q39ZL4 | L-seryl-tRNA(Sec) selenium transferase | 1.34e-06 | 7.44e-03 | NA | 0.4577 |
2. PF | Q4L6N6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.73e-08 | 9.39e-07 | NA | 0.6902 |
2. PF | B7MFF5 | L-seryl-tRNA(Sec) selenium transferase | 7.27e-06 | 2.80e-02 | NA | 0.4374 |
2. PF | B1J347 | L-seryl-tRNA(Sec) selenium transferase | 1.18e-05 | 1.21e-02 | NA | 0.4634 |
2. PF | Q4L6N5 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 8.07e-10 | 2.92e-05 | NA | 0.664 |
2. PF | A5W695 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 2.17e-10 | NA | 0.7448 |
2. PF | A4IZK6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.87e-10 | 7.40e-10 | NA | 0.6506 |
2. PF | A5FR29 | Histidinol-phosphate aminotransferase | 5.22e-09 | 3.30e-10 | NA | 0.6603 |
2. PF | Q1C3H9 | L-seryl-tRNA(Sec) selenium transferase | 8.33e-06 | 4.87e-02 | NA | 0.4452 |
2. PF | A7X2R9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.90e-10 | 8.40e-06 | NA | 0.6472 |
2. PF | Q87I03 | Serine hydroxymethyltransferase 2 | 5.96e-10 | 3.97e-07 | NA | 0.6212 |
2. PF | Q1QMB9 | Serine hydroxymethyltransferase | 1.03e-09 | 6.22e-07 | NA | 0.6242 |
2. PF | A1BJA7 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.61e-07 | 5.54e-06 | NA | 0.6506 |
2. PF | Q9UXT0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 8.11e-09 | 4.55e-07 | NA | 0.6549 |
2. PF | A4J2F9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.90e-10 | 1.53e-06 | NA | 0.6994 |
2. PF | Q9ZBY8 | Putative phenylalanine aminotransferase | 7.64e-10 | 3.28e-07 | NA | 0.6482 |
2. PF | Q9A5B6 | Histidinol-phosphate aminotransferase 2 | 8.81e-10 | 1.69e-03 | NA | 0.6161 |
2. PF | A0REX2 | Kynureninase | 0.00e+00 | 1.89e-18 | NA | 0.7313 |
2. PF | Q81G81 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.52e-09 | NA | 0.7733 |
2. PF | A0RBE9 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 6.63e-09 | NA | 0.7585 |
2. PF | Q3JGP5 | Serine hydroxymethyltransferase 2 | 4.44e-10 | 6.96e-07 | NA | 0.6694 |
2. PF | B6JGH9 | Serine hydroxymethyltransferase | 8.60e-10 | 3.31e-06 | NA | 0.6377 |
2. PF | Q2IQD6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.85e-09 | 8.41e-07 | NA | 0.6361 |
2. PF | Q97C05 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.24e-08 | 2.79e-09 | NA | 0.6811 |
2. PF | P99168 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.96e-10 | 8.40e-06 | NA | 0.66 |
2. PF | Q81M08 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.41e-07 | 1.68e-05 | NA | 0.6757 |
2. PF | Q3Z879 | Histidinol-phosphate aminotransferase | 6.82e-11 | 1.98e-09 | NA | 0.6686 |
2. PF | Q5X0A6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.77e-15 | 1.79e-09 | NA | 0.6754 |
2. PF | B7JMU9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.41e-07 | 1.68e-05 | NA | 0.6757 |
2. PF | Q1IFP3 | L-seryl-tRNA(Sec) selenium transferase | 1.22e-05 | 1.42e-02 | NA | 0.4648 |
2. PF | A2STQ3 | Probable L-tyrosine/L-aspartate decarboxylase | 5.85e-12 | 3.45e-08 | NA | 0.7235 |
2. PF | Q9RYH5 | Kynureninase | 0.00e+00 | 6.79e-18 | NA | 0.7265 |
2. PF | A7GMM0 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 7.49e-10 | NA | 0.7538 |
2. PF | Q4J915 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.26e-09 | 4.60e-07 | NA | 0.6668 |
2. PF | O28275 | Probable L-aspartate decarboxylase | 4.53e-13 | 2.69e-11 | NA | 0.7307 |
2. PF | Q5WGR9 | Histidinol-phosphate aminotransferase | 5.22e-10 | 1.09e-08 | NA | 0.6451 |
2. PF | Q6HHX7 | Kynureninase | 0.00e+00 | 7.73e-19 | NA | 0.7685 |
2. PF | Q3JEN8 | Histidinol-phosphate aminotransferase 1 | 8.13e-10 | 9.75e-08 | NA | 0.6489 |
2. PF | Q92UV9 | 2-aminoethylphosphonate--pyruvate transaminase | 5.55e-16 | 8.94e-12 | NA | 0.6467 |
2. PF | Q92XS8 | Serine hydroxymethyltransferase 2 | 5.30e-10 | 8.19e-08 | NA | 0.6852 |
2. PF | Q8PX17 | Histidinol-phosphate aminotransferase | 4.95e-10 | 1.40e-08 | NA | 0.6549 |
2. PF | P64217 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.19e-08 | 3.31e-06 | NA | 0.6787 |
2. PF | A3MS37 | Serine hydroxymethyltransferase | 3.77e-10 | 4.31e-11 | NA | 0.6709 |
2. PF | A7HCR6 | Histidinol-phosphate aminotransferase | 1.01e-08 | 7.73e-08 | NA | 0.6742 |
2. PF | O07587 | Putative aspartate aminotransferase YhdR | 3.05e-08 | 1.16e-07 | NA | 0.5651 |
2. PF | A7SCH8 | Kynureninase | 0.00e+00 | 3.84e-12 | NA | 0.7277 |
2. PF | Q6ARJ7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.67e-08 | 2.34e-06 | NA | 0.638 |
2. PF | Q0W253 | Histidinol-phosphate aminotransferase | 3.74e-10 | 2.03e-09 | NA | 0.6679 |
2. PF | A3MCV7 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 4.04e-11 | NA | 0.7485 |
2. PF | Q9X0Y2 | Aspartate aminotransferase | 1.13e-08 | 2.10e-06 | NA | 0.6066 |
2. PF | A9VKQ3 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.08e-09 | NA | 0.7444 |
2. PF | B1KXQ5 | Serine hydroxymethyltransferase | 1.59e-10 | 6.72e-08 | NA | 0.6742 |
2. PF | Q0AVH9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.74e-07 | 2.78e-06 | NA | 0.6824 |
2. PF | Q02635 | Aspartate/prephenate aminotransferase | 1.01e-08 | 3.15e-04 | NA | 0.5754 |
2. PF | Q3J9K8 | Serine hydroxymethyltransferase | 6.30e-10 | 2.64e-07 | NA | 0.6349 |
2. PF | Q46NS0 | 2-aminoethylphosphonate--pyruvate transaminase 2 | 1.11e-16 | 2.81e-12 | NA | 0.729 |
2. PF | Q3BUF6 | Histidinol-phosphate aminotransferase | 2.04e-06 | 6.21e-11 | NA | 0.6507 |
2. PF | Q97CQ5 | Serine hydroxymethyltransferase | 3.79e-10 | 1.44e-11 | NA | 0.6473 |
2. PF | A0RIK9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.29e-07 | 1.14e-05 | NA | 0.675 |
2. PF | A9VHP9 | Kynureninase | 0.00e+00 | 4.37e-18 | NA | 0.7572 |
2. PF | B7IN19 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.23e-09 | NA | 0.7676 |
2. PF | A5IT63 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 7.07e-10 | 8.40e-06 | NA | 0.6649 |
2. PF | Q2NHY7 | Probable L-tyrosine/L-aspartate decarboxylase | 7.09e-14 | 5.97e-10 | NA | 0.7119 |
2. PF | B9IUR6 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 8.76e-09 | NA | 0.7666 |
2. PF | A4VFW8 | L-seryl-tRNA(Sec) selenium transferase | 4.91e-06 | 1.98e-02 | NA | 0.4603 |
2. PF | P0CO53 | Kynureninase | 0.00e+00 | 2.06e-15 | NA | 0.7472 |
2. PF | P58319 | Low specificity L-threonine aldolase | 1.33e-13 | 6.67e-13 | NA | 0.7286 |
2. PF | Q1AY33 | Histidinol-phosphate aminotransferase | 1.42e-12 | 4.25e-07 | NA | 0.664 |
2. PF | Q03A26 | Serine hydroxymethyltransferase | 1.36e-10 | 5.08e-08 | NA | 0.6321 |
2. PF | Q8TNI1 | Phosphoserine aminotransferase | 2.60e-13 | 5.45e-08 | NA | 0.6701 |
2. PF | Q2FGI6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.83e-08 | 5.79e-06 | NA | 0.6786 |
2. PF | Q49XX9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.77e-10 | 2.55e-06 | NA | 0.6594 |
2. PF | Q88YN9 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 2.62e-11 | NA | 0.7589 |
2. PF | O58679 | L-aspartate/L-glutamate decarboxylase | 2.76e-13 | 2.62e-10 | NA | 0.7025 |
2. PF | Q6ABU3 | Putative phenylalanine aminotransferase | 9.54e-10 | 1.20e-07 | NA | 0.6422 |
2. PF | A3N6H3 | Kynureninase | 0.00e+00 | 1.73e-20 | NA | 0.7576 |
2. PF | A6UTL8 | Histidinol-phosphate aminotransferase | 1.13e-09 | 4.97e-07 | NA | 0.6731 |
2. PF | Q62M98 | Kynureninase | 0.00e+00 | 2.14e-20 | NA | 0.7552 |
2. PF | Q1RGV0 | Probable aspartate/prephenate aminotransferase | 9.69e-09 | 3.32e-03 | NA | 0.5777 |
2. PF | B8GDM7 | Probable L-tyrosine/L-aspartate decarboxylase | 2.81e-12 | 6.08e-07 | NA | 0.7316 |
2. PF | Q8U1P6 | Probable L-aspartate decarboxylase | 4.78e-12 | 2.33e-08 | NA | 0.6982 |
2. PF | B6YT12 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.38e-07 | 4.82e-06 | NA | 0.6897 |
2. PF | Q9PBC6 | Histidinol-phosphate aminotransferase | 2.10e-08 | 1.61e-08 | NA | 0.6463 |
2. PF | Q31V36 | L-seryl-tRNA(Sec) selenium transferase | 7.96e-06 | 1.58e-02 | NA | 0.4409 |
2. PF | A8FEJ6 | Histidinol-phosphate aminotransferase | 2.50e-10 | 4.02e-06 | NA | 0.6744 |
2. PF | Q8Y7D3 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.88e-10 | 6.51e-06 | NA | 0.6685 |
2. PF | A0AIF1 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.08e-10 | 4.72e-06 | NA | 0.6627 |
2. PF | Q73KL7 | L-methionine gamma-lyase | 2.45e-09 | 4.24e-06 | NA | 0.5935 |
2. PF | B8JDY8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.36e-09 | 1.86e-06 | NA | 0.6528 |
2. PF | Q65I37 | Histidinol-phosphate aminotransferase | 2.84e-10 | 8.22e-07 | NA | 0.6689 |
2. PF | Q39AP8 | 2-aminoethylphosphonate--pyruvate transaminase 1 | 1.11e-16 | 2.62e-09 | NA | 0.7102 |
2. PF | P62029 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.32e-07 | 6.17e-06 | NA | 0.6807 |
2. PF | A5EKI3 | Serine hydroxymethyltransferase | 8.20e-10 | 4.35e-07 | NA | 0.6421 |
2. PF | B9DNN6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.01e-08 | 7.97e-06 | NA | 0.6856 |
2. PF | B0RUZ9 | Kynureninase | 0.00e+00 | 3.43e-14 | NA | 0.7498 |
2. PF | Q46UV8 | 2-aminoethylphosphonate--pyruvate transaminase 1 | 1.11e-16 | 3.70e-10 | NA | 0.695 |
2. PF | A6UPL6 | Histidinol-phosphate aminotransferase | 4.85e-08 | 1.92e-06 | NA | 0.6656 |
2. PF | Q30SC1 | L-seryl-tRNA(Sec) selenium transferase | 2.07e-06 | 1.37e-02 | NA | 0.4359 |
2. PF | B5FKT6 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 7.87e-10 | NA | 0.7577 |
2. PF | C4KHW7 | Serine hydroxymethyltransferase | 3.38e-10 | 2.81e-12 | NA | 0.6242 |
2. PF | Q5X8W5 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.18e-07 | 1.13e-07 | NA | 0.6925 |
2. PF | Q987C8 | Histidinol-phosphate aminotransferase 1 | 1.86e-09 | 4.11e-06 | NA | 0.5633 |
2. PF | Q9YA18 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.88e-08 | 7.35e-07 | NA | 0.6178 |
2. PF | Q0VLA8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.20e-08 | 1.71e-07 | NA | 0.6528 |
2. PF | Q9ZLA7 | Uncharacterized aminotransferase jhp_0673 | 0.00e+00 | 4.50e-09 | NA | 0.7099 |
2. PF | C1ERU8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.29e-07 | 1.68e-05 | NA | 0.6761 |
2. PF | B2U5A3 | L-seryl-tRNA(Sec) selenium transferase | 7.19e-06 | 1.52e-02 | NA | 0.4424 |
2. PF | A9KC20 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.66e-07 | 4.65e-07 | NA | 0.6928 |
2. PF | Q0TP32 | Serine hydroxymethyltransferase | 1.11e-10 | 4.72e-09 | NA | 0.6641 |
2. PF | A4QAL4 | Putative phenylalanine aminotransferase | 1.01e-09 | 2.39e-07 | NA | 0.6197 |
2. PF | A5VIP9 | Serine hydroxymethyltransferase | 5.44e-10 | 7.38e-08 | NA | 0.6274 |
2. PF | A4SCK8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.46e-07 | 1.82e-06 | NA | 0.6853 |
2. PF | Q6G930 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.89e-08 | 1.87e-05 | NA | 0.6789 |
2. PF | A8G7W0 | L-seryl-tRNA(Sec) selenium transferase | 5.09e-05 | 4.59e-02 | NA | 0.4354 |
2. PF | Q7UNH1 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.74e-07 | 1.16e-07 | NA | 0.6742 |
2. PF | P08907 | Aspartate aminotransferase, mitochondrial | 1.96e-05 | 1.91e-02 | NA | 0.478 |
2. PF | A3DNK0 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.42e-07 | 6.43e-07 | NA | 0.6748 |
2. PF | O30056 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 2 | 5.00e-15 | 1.03e-18 | NA | 0.7166 |
2. PF | B1Z0T3 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 8.81e-10 | NA | 0.7038 |
2. PF | B1KJJ9 | Serine hydroxymethyltransferase | 7.70e-10 | 5.60e-09 | NA | 0.6036 |
2. PF | Q0IG34 | 3-hydroxykynurenine transaminase | 1.11e-16 | 2.38e-13 | NA | 0.7024 |
2. PF | C3P8D3 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.28e-07 | 1.68e-05 | NA | 0.6761 |
2. PF | Q64PZ3 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 2.16e-13 | NA | 0.7594 |
2. PF | Q5H039 | Kynureninase | 0.00e+00 | 2.53e-14 | NA | 0.7539 |
2. PF | Q88UE6 | Histidinol-phosphate aminotransferase | 1.45e-10 | 1.29e-06 | NA | 0.6568 |
2. PF | Q9V1B2 | Serine hydroxymethyltransferase | 3.76e-10 | 1.58e-11 | NA | 0.6698 |
2. PF | Q5JJ82 | L-aspartate decarboxylase | 3.07e-13 | 1.71e-08 | NA | 0.689 |
2. PF | Q57SD3 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 4.20e-10 | NA | 0.7541 |
2. PF | P62030 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 1.41e-07 | 7.76e-09 | NA | 0.6747 |
2. PF | Q03QY0 | Serine hydroxymethyltransferase | 2.27e-10 | 3.29e-08 | NA | 0.6385 |
2. PF | C3N5G2 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.98e-07 | 7.60e-07 | NA | 0.6946 |
2. PF | Q2SHM3 | 2-aminoethylphosphonate--pyruvate transaminase | 2.22e-16 | 3.11e-11 | NA | 0.716 |
2. PF | A6L4N0 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 5.06e-13 | NA | 0.7379 |
2. PF | Q1GRZ2 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.16e-10 | 3.20e-07 | NA | 0.6219 |
2. PF | C3NE26 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.36e-07 | 7.60e-07 | NA | 0.69 |
2. PF | A1W0Z5 | L-seryl-tRNA(Sec) selenium transferase | 3.24e-06 | 1.55e-02 | NA | 0.4627 |
2. PF | A5FMM4 | Kynureninase | 0.00e+00 | 1.73e-15 | NA | 0.7463 |
2. PF | Q8Z9Y1 | L-seryl-tRNA(Sec) selenium transferase | 8.62e-06 | 4.87e-02 | NA | 0.4471 |
2. PF | Q2YCK3 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.60e-07 | 3.07e-06 | NA | 0.6876 |
2. PF | C3LAM8 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 2.69e-09 | NA | 0.731 |
2. PF | A6GY79 | Histidinol-phosphate aminotransferase | 1.24e-12 | 1.64e-10 | NA | 0.6154 |
2. PF | B6J8Q9 | Serine hydroxymethyltransferase | 4.02e-10 | 2.10e-06 | NA | 0.663 |
2. PF | A6UVV2 | Serine hydroxymethyltransferase | 2.84e-10 | 5.75e-10 | NA | 0.6551 |
2. PF | O25436 | Uncharacterized aminotransferase HP_0736 | 1.11e-16 | 8.05e-09 | NA | 0.7167 |
2. PF | A5UMW4 | Serine hydroxymethyltransferase | 3.13e-10 | 8.37e-11 | NA | 0.6743 |
2. PF | P34894 | Serine hydroxymethyltransferase | 3.27e-10 | 2.36e-08 | NA | 0.6347 |
2. PF | Q30YL7 | Serine hydroxymethyltransferase | 3.08e-10 | 2.79e-08 | NA | 0.6275 |
2. PF | B8G933 | Serine hydroxymethyltransferase | 1.71e-10 | 9.93e-07 | NA | 0.6364 |
2. PF | C3N5G1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.50e-07 | 8.00e-08 | NA | 0.6655 |
2. PF | B5QTH9 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 7.87e-10 | NA | 0.7479 |
2. PF | Q0W498 | Probable L-tyrosine/L-aspartate decarboxylase | 0.00e+00 | 8.65e-09 | NA | 0.7221 |
2. PF | B3PBD6 | Serine hydroxymethyltransferase | 1.01e-09 | 6.80e-07 | NA | 0.6509 |
2. PF | Q11VM5 | Histidinol-phosphate aminotransferase | 1.20e-07 | 5.02e-09 | NA | 0.6271 |
2. PF | Q11NZ7 | Serine hydroxymethyltransferase | 1.49e-09 | 4.26e-08 | NA | 0.6225 |
2. PF | Q5WX92 | Histidinol-phosphate aminotransferase 1 | 2.75e-13 | 1.84e-10 | NA | 0.6256 |
2. PF | Q5NHN8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.13e-10 | 7.40e-10 | NA | 0.6497 |
2. PF | P31030 | Serine--pyruvate aminotransferase | 0.00e+00 | 1.60e-14 | NA | 0.7253 |
2. PF | B1KJM4 | Kynureninase | 0.00e+00 | 5.20e-18 | NA | 0.7434 |
2. PF | Q9I434 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 2.87e-11 | NA | 0.7231 |
2. PF | P44527 | Cystathionine beta-lyase | 4.33e-06 | 9.08e-07 | NA | 0.6014 |
2. PF | Q8ABA8 | Histidinol-phosphate aminotransferase | 7.73e-07 | 3.31e-09 | NA | 0.6249 |
2. PF | C4KH27 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 9.35e-09 | 1.03e-07 | NA | 0.6309 |
2. PF | Q5HFM4 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 7.05e-10 | 8.95e-06 | NA | 0.6596 |
2. PF | Q2A498 | Serine hydroxymethyltransferase | 4.37e-10 | 8.79e-07 | NA | 0.6493 |
2. PF | A2BM73 | Serine hydroxymethyltransferase | 4.33e-10 | 3.52e-13 | NA | 0.6481 |
2. PF | C3MPT6 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.75e-07 | 7.60e-07 | NA | 0.692 |
2. PF | Q87JL4 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 8.92e-10 | NA | 0.7522 |
2. PF | B7IXL2 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.36e-07 | 2.45e-05 | NA | 0.675 |
2. PF | C3MUU8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.45e-07 | 1.03e-07 | NA | 0.6624 |
2. PF | B2FPM0 | Histidinol-phosphate aminotransferase | 7.94e-07 | 3.65e-09 | NA | 0.618 |
2. PF | P0A822 | L-seryl-tRNA(Sec) selenium transferase | 8.28e-06 | 1.91e-02 | NA | 0.4443 |
2. PF | O27433 | Serine hydroxymethyltransferase | 2.14e-10 | 9.82e-12 | NA | 0.6635 |
2. PF | B3RBH4 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.01e-09 | NA | 0.6998 |
2. PF | Q6HLM0 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 2.69e-09 | NA | 0.7376 |
2. PF | Q13P97 | 2-aminoethylphosphonate--pyruvate transaminase 2 | 1.11e-16 | 8.48e-11 | NA | 0.7134 |
2. PF | B6J4T7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.66e-15 | 8.49e-10 | NA | 0.6771 |
2. PF | B4S5Y9 | Serine hydroxymethyltransferase | 1.78e-09 | 6.57e-08 | NA | 0.6485 |
2. PF | B3ER62 | Serine hydroxymethyltransferase | 1.04e-09 | 6.13e-08 | NA | 0.6361 |
2. PF | A7ZTD9 | L-seryl-tRNA(Sec) selenium transferase | 8.27e-06 | 1.46e-02 | NA | 0.4366 |
2. PF | A8HZS2 | Histidinol-phosphate aminotransferase | 1.05e-13 | 1.99e-06 | NA | 0.6504 |
2. PF | Q7MF44 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 9.77e-11 | NA | 0.7575 |
2. PF | Q87RR2 | Serine hydroxymethyltransferase 1 | 3.19e-10 | 6.88e-09 | NA | 0.6629 |
2. PF | A0KJL8 | 2-aminoethylphosphonate--pyruvate transaminase | 2.22e-16 | 2.56e-13 | NA | 0.7225 |
2. PF | P50436 | Serine hydroxymethyltransferase | 2.27e-10 | 3.11e-11 | NA | 0.6809 |
2. PF | Q5FMC0 | Serine hydroxymethyltransferase | 2.74e-10 | 3.57e-08 | NA | 0.6252 |
2. PF | B5ELV3 | Serine hydroxymethyltransferase | 3.81e-10 | 2.97e-09 | NA | 0.6402 |
2. PF | Q5ZZ97 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.23e-07 | 8.58e-08 | NA | 0.687 |
2. PF | B2SGE5 | Serine hydroxymethyltransferase | 4.37e-10 | 1.20e-06 | NA | 0.6205 |
2. PF | A3N2L0 | L-seryl-tRNA(Sec) selenium transferase | 1.15e-05 | 1.88e-02 | NA | 0.4438 |
2. PF | Q6MEJ2 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.90e-11 | 2.10e-07 | NA | 0.6924 |
2. PF | B2UPR9 | Histidinol-phosphate aminotransferase | 6.30e-10 | 2.76e-08 | NA | 0.6746 |
2. PF | B9LKK8 | Serine hydroxymethyltransferase | 1.89e-10 | 7.52e-07 | NA | 0.6287 |
2. PF | Q2FGI7 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 7.01e-10 | 1.48e-05 | NA | 0.6479 |
2. PF | Q8DFC9 | Serine hydroxymethyltransferase 1 | 2.98e-10 | 2.86e-09 | NA | 0.6597 |
2. PF | Q81PP8 | Kynureninase | 0.00e+00 | 1.98e-18 | NA | 0.7418 |
2. PF | A9KC19 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.44e-15 | 8.49e-10 | NA | 0.6759 |
2. PF | Q97ZI9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.11e-07 | 4.52e-06 | NA | 0.6581 |
2. PF | B7NEP6 | L-seryl-tRNA(Sec) selenium transferase | 7.29e-06 | 1.59e-02 | NA | 0.4435 |
2. PF | A6L5K3 | Serine hydroxymethyltransferase | 1.29e-09 | 1.25e-06 | NA | 0.6173 |
2. PF | Q0VMH4 | Serine hydroxymethyltransferase | 7.40e-10 | 1.49e-09 | NA | 0.6341 |
2. PF | Q60BW4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 9.49e-09 | 1.04e-08 | NA | 0.6593 |
2. PF | Q6ABX6 | Putative phenylalanine aminotransferase | 7.01e-10 | 9.19e-07 | NA | 0.6268 |
2. PF | A0M4Y1 | Kynureninase | 0.00e+00 | 2.53e-14 | NA | 0.7581 |
2. PF | C0ZBW6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.57e-08 | 1.42e-05 | NA | 0.6879 |
2. PF | Q5ZU10 | Histidinol-phosphate aminotransferase 2 | 4.90e-10 | 1.06e-06 | NA | 0.628 |
2. PF | B3WDL0 | Serine hydroxymethyltransferase | 1.47e-10 | 5.08e-08 | NA | 0.6317 |
2. PF | A9NEA9 | Serine hydroxymethyltransferase | 4.21e-10 | 1.27e-07 | NA | 0.5977 |
2. PF | B7M3L6 | L-seryl-tRNA(Sec) selenium transferase | 7.80e-06 | 1.91e-02 | NA | 0.4448 |
2. PF | A1V194 | Kynureninase | 0.00e+00 | 2.14e-20 | NA | 0.7428 |
2. PF | Q634V8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.32e-07 | 1.68e-05 | NA | 0.6806 |
2. PF | Q88KT0 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.23e-10 | NA | 0.7487 |
2. PF | P64218 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.78e-08 | 3.31e-06 | NA | 0.68 |
2. PF | B6J2H7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.22e-15 | 8.49e-10 | NA | 0.6895 |
2. PF | B4T9C6 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.56e-10 | NA | 0.7531 |
2. PF | Q4J8X2 | Aspartate aminotransferase | 2.24e-07 | 1.82e-04 | NA | 0.5329 |
2. PF | Q6M1B4 | UPF0425 pyridoxal phosphate-dependent protein MMP0002 | 1.45e-07 | 2.07e-08 | NA | 0.52 |
2. PF | Q1ITW5 | Kynureninase | 0.00e+00 | 6.59e-15 | NA | 0.7231 |
2. PF | Q8EQB9 | Histidinol-phosphate aminotransferase 2 | 8.94e-10 | 2.58e-06 | NA | 0.6229 |
2. PF | A1RTI0 | Serine hydroxymethyltransferase | 4.05e-10 | 5.04e-11 | NA | 0.6634 |
2. PF | B5R6T2 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 8.18e-10 | NA | 0.7571 |
2. PF | Q8RLU1 | 2-aminoethylphosphonate--pyruvate transaminase (Fragment) | 1.67e-15 | 8.48e-11 | NA | 0.7671 |
2. PF | A4XAL2 | Kynureninase | 0.00e+00 | 6.14e-13 | NA | 0.7412 |
2. PF | Q6GGG3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.93e-08 | 2.30e-05 | NA | 0.6872 |
2. PF | C3LVL9 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.96e-11 | NA | 0.732 |
2. PF | A7FFW1 | Serine hydroxymethyltransferase | 3.39e-10 | 3.37e-08 | NA | 0.6616 |
2. PF | O57708 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.72e-09 | 3.24e-07 | NA | 0.6589 |
2. PF | Q81TE0 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 2.69e-09 | NA | 0.7513 |
2. PF | B5YW91 | L-seryl-tRNA(Sec) selenium transferase | 9.47e-06 | 1.91e-02 | NA | 0.4466 |
2. PF | A5I9T5 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.44e-15 | 1.84e-09 | NA | 0.6582 |
2. PF | Q9ZE56 | Probable aspartate/prephenate aminotransferase | 6.86e-09 | 3.44e-04 | NA | 0.5858 |
2. PF | A9NA77 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.88e-15 | 8.49e-10 | NA | 0.6703 |
2. PF | Q1I7U0 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 7.54e-11 | NA | 0.7401 |
2. PF | Q8TUE9 | Histidinol-phosphate aminotransferase | 5.22e-10 | 2.05e-09 | NA | 0.6374 |
2. PF | Q39BS5 | 2-aminoethylphosphonate--pyruvate transaminase 2 | 2.22e-16 | 7.16e-11 | NA | 0.705 |
2. PF | B2SIT8 | Kynureninase | 0.00e+00 | 2.07e-14 | NA | 0.7476 |
2. PF | B5YDB7 | Serine hydroxymethyltransferase | 2.50e-10 | 1.44e-06 | NA | 0.6458 |
2. PF | B1GYV8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.23e-08 | 1.13e-07 | NA | 0.6671 |
2. PF | B1YHD6 | Kynureninase | 0.00e+00 | 8.40e-20 | NA | 0.7939 |
2. PF | Q5V1B4 | Probable L-aspartate decarboxylase | 0.00e+00 | 1.22e-10 | NA | 0.7576 |
2. PF | Q8TZJ3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.12e-07 | 2.70e-07 | NA | 0.6556 |
2. PF | A9NA76 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.63e-07 | 4.65e-07 | NA | 0.692 |
2. PF | Q972C0 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.04e-07 | 1.75e-07 | NA | 0.7044 |
2. PF | B0RSL5 | Histidinol-phosphate aminotransferase | 3.21e-08 | 1.05e-09 | NA | 0.6309 |
2. PF | Q9HII1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.85e-08 | 2.50e-09 | NA | 0.6991 |
2. PF | P83788 | Kynureninase | 0.00e+00 | 9.80e-23 | NA | 0.7609 |
2. PF | Q5JF06 | Serine hydroxymethyltransferase | 3.83e-10 | 1.48e-11 | NA | 0.6818 |
2. PF | Q1DDU5 | Kynureninase | 0.00e+00 | 1.29e-14 | NA | 0.7356 |
2. PF | P26398 | Lipopolysaccharide biosynthesis protein RfbH | 2.77e-08 | 1.42e-05 | NA | 0.5982 |
2. PF | Q818M5 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.91e-07 | 2.35e-02 | NA | 0.6767 |
2. PF | A7MGY5 | Serine hydroxymethyltransferase | 2.76e-10 | 9.64e-08 | NA | 0.6548 |
2. PF | Q2A4V1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.32e-10 | 1.09e-09 | NA | 0.6483 |
2. PF | Q9A354 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 1.23e-06 | 1.35e-06 | NA | 0.6779 |
2. PF | Q65S79 | Histidinol-phosphate aminotransferase 1 | 3.22e-10 | 1.10e-06 | NA | 0.6675 |
2. PF | C0ZM44 | Putative phenylalanine aminotransferase | 8.98e-10 | 2.08e-07 | NA | 0.629 |
2. PF | B8E008 | Serine hydroxymethyltransferase | 2.28e-10 | 4.30e-07 | NA | 0.6522 |
2. PF | Q8TZ19 | Serine hydroxymethyltransferase | 2.11e-10 | 9.04e-10 | NA | 0.6327 |
2. PF | Q5HP14 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 9.06e-10 | 9.24e-06 | NA | 0.6831 |
2. PF | Q3YVV3 | L-seryl-tRNA(Sec) selenium transferase | 8.40e-06 | 1.48e-02 | NA | 0.4444 |
2. PF | Q9HPY5 | Serine hydroxymethyltransferase | 4.17e-10 | 7.84e-11 | NA | 0.6612 |
2. PF | A7GSN6 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.41e-10 | 2.80e-05 | NA | 0.6793 |
2. PF | B5EXH1 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.04e-10 | NA | 0.7484 |
2. PF | Q8CXE1 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.39e-07 | 6.94e-06 | NA | 0.6875 |
2. PF | B7JFQ9 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 2.69e-09 | NA | 0.7435 |
2. PF | P58892 | Histidinol-phosphate aminotransferase | 2.91e-08 | 6.61e-10 | NA | 0.6316 |
2. PF | B8F407 | Serine hydroxymethyltransferase | 2.97e-10 | 7.44e-07 | NA | 0.6513 |
2. PF | A5ULW4 | Probable L-tyrosine/L-aspartate decarboxylase | 1.12e-11 | 6.69e-10 | NA | 0.7126 |
2. PF | A5FFY0 | Histidinol-phosphate aminotransferase | 9.31e-08 | 3.98e-09 | NA | 0.5917 |
2. PF | Q3BV40 | Kynureninase | 0.00e+00 | 8.65e-14 | NA | 0.7456 |
2. PF | Q8D3M4 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.37e-10 | NA | 0.7395 |
2. PF | Q63E45 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 2.62e-09 | NA | 0.7492 |
2. PF | B4UGZ3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.81e-09 | 1.38e-06 | NA | 0.6568 |
2. PF | Q92A83 | Histidinol-phosphate aminotransferase | 1.08e-09 | 8.89e-07 | NA | 0.6541 |
2. PF | A6VGF6 | Histidinol-phosphate aminotransferase | 3.50e-08 | 4.30e-07 | NA | 0.6677 |
2. PF | Q7NBH8 | Serine hydroxymethyltransferase | 2.63e-14 | 1.46e-06 | NA | 0.6434 |
2. PF | Q122G2 | 2-aminoethylphosphonate--pyruvate transaminase 2 | 0.00e+00 | 5.04e-11 | NA | 0.6997 |
2. PF | B4STN8 | Histidinol-phosphate aminotransferase | 7.35e-07 | 9.38e-10 | NA | 0.6182 |
2. PF | B1IZK2 | L-seryl-tRNA(Sec) selenium transferase | 8.27e-06 | 1.91e-02 | NA | 0.4451 |
2. PF | A7GGI2 | Serine hydroxymethyltransferase | 2.67e-10 | 1.48e-07 | NA | 0.6729 |
2. PF | B8E2E7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.89e-08 | 1.79e-09 | NA | 0.6364 |
2. PF | Q057P9 | Serine hydroxymethyltransferase | 2.67e-10 | 1.41e-07 | NA | 0.6626 |
2. PF | Q128B2 | 2-aminoethylphosphonate--pyruvate transaminase 1 | 2.22e-16 | 2.55e-12 | NA | 0.7414 |
2. PF | C0ZBW7 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.16e-07 | 9.13e-05 | NA | 0.6762 |
2. PF | C3NEW0 | Serine hydroxymethyltransferase | 6.69e-10 | 3.68e-12 | NA | 0.6564 |
2. PF | Q68XV9 | Probable aspartate/prephenate aminotransferase | 7.41e-09 | 1.91e-04 | NA | 0.581 |
2. PF | Q8CMM1 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 9.01e-10 | 1.34e-05 | NA | 0.6757 |
2. PF | A9FQM4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.91e-11 | 4.41e-08 | NA | 0.6201 |
2. PF | B6JP11 | L-seryl-tRNA(Sec) selenium transferase | 1.30e-08 | 1.02e-13 | NA | 0.4354 |
2. PF | A6TFW2 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 5.45e-11 | NA | 0.7437 |
2. PF | Q9KLY7 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.96e-11 | NA | 0.7573 |
2. PF | P17731 | Histidinol-phosphate aminotransferase | 3.28e-10 | 1.86e-07 | NA | 0.6756 |
2. PF | A4YHA3 | Serine hydroxymethyltransferase | 2.62e-10 | 5.89e-13 | NA | 0.6627 |
2. PF | A4TGQ3 | L-seryl-tRNA(Sec) selenium transferase | 6.84e-06 | 4.87e-02 | NA | 0.4481 |
2. PF | Q481S6 | Serine hydroxymethyltransferase 2 | 5.82e-10 | 4.85e-08 | NA | 0.6155 |
2. PF | Q6HDT8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.32e-07 | 1.68e-05 | NA | 0.6804 |
2. PF | Q2P317 | Kynureninase | 0.00e+00 | 2.10e-14 | NA | 0.7416 |
2. PF | Q72CT0 | Serine hydroxymethyltransferase | 2.73e-10 | 3.35e-07 | NA | 0.6409 |
2. PF | Q5H0L0 | Histidinol-phosphate aminotransferase | 2.04e-11 | 8.97e-09 | NA | 0.6349 |
2. PF | Q83B08 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.22e-15 | 8.49e-10 | NA | 0.6808 |
2. PF | A6Q478 | Serine hydroxymethyltransferase | 3.14e-10 | 5.08e-05 | NA | 0.6295 |
2. PF | B1YA29 | Serine hydroxymethyltransferase | 5.85e-10 | 2.66e-09 | NA | 0.6297 |
2. PF | Q9HI38 | Serine hydroxymethyltransferase | 4.43e-10 | 1.28e-11 | NA | 0.6525 |
2. PF | Q3LSM4 | Alanine--glyoxylate aminotransferase | 0.00e+00 | 3.90e-14 | NA | 0.6991 |
2. PF | B1LK21 | L-seryl-tRNA(Sec) selenium transferase | 6.15e-06 | 2.59e-02 | NA | 0.4437 |
2. PF | Q3II23 | Serine hydroxymethyltransferase | 6.61e-10 | 2.23e-08 | NA | 0.6587 |
2. PF | Q92C04 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.80e-10 | 1.92e-06 | NA | 0.6735 |
2. PF | Q63NF6 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.06e-10 | NA | 0.7513 |
2. PF | Q8PAD2 | Kynureninase | 0.00e+00 | 3.84e-14 | NA | 0.7348 |
2. PF | Q0S962 | Putative phenylalanine aminotransferase | 9.30e-10 | 4.57e-08 | NA | 0.6534 |
2. PF | A8Z474 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.17e-08 | 1.48e-05 | NA | 0.6515 |
2. PF | B4SB96 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.61e-07 | 4.55e-07 | NA | 0.66 |
2. PF | P31029 | Serine--pyruvate aminotransferase, mitochondrial | 1.11e-16 | 1.89e-08 | NA | 0.6958 |
2. PF | B4TMB1 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.89e-10 | NA | 0.7571 |
2. PF | A3DNJ6 | Serine hydroxymethyltransferase | 5.74e-10 | 1.50e-11 | NA | 0.6557 |
2. PF | P41689 | Serine--pyruvate aminotransferase, mitochondrial | 1.11e-16 | 1.43e-08 | NA | 0.6912 |
2. PF | A3DNJ9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.11e-09 | 6.43e-07 | NA | 0.6764 |
2. PF | B4S3N4 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.79e-07 | 2.29e-06 | NA | 0.6765 |
2. PF | P54377 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.88e-10 | 1.90e-06 | NA | 0.6552 |
2. PF | Q6G931 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.50e-10 | 1.48e-05 | NA | 0.666 |
2. PF | A2S925 | Kynureninase | 0.00e+00 | 2.14e-20 | NA | 0.7548 |
2. PF | Q5PFR0 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 5.33e-10 | NA | 0.758 |
2. PF | Q3J846 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.91e-07 | 7.31e-09 | NA | 0.691 |
2. PF | Q9HSA3 | Probable L-aspartate decarboxylase | 0.00e+00 | 6.05e-11 | NA | 0.7552 |
2. PF | C5A2X8 | Probable L-aspartate decarboxylase | 1.48e-12 | 5.60e-09 | NA | 0.7032 |
2. PF | C1EM34 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.27e-09 | NA | 0.7589 |
2. PF | A9N8T8 | Serine hydroxymethyltransferase | 3.40e-10 | 1.13e-06 | NA | 0.662 |
2. PF | Q5X5X0 | Histidinol-phosphate aminotransferase 1 | 2.16e-13 | 1.23e-10 | NA | 0.6213 |
2. PF | Q7S332 | Kynureninase 1 | 0.00e+00 | 6.02e-09 | NA | 0.7492 |
2. PF | B5YFB8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.96e-08 | 3.74e-10 | NA | 0.6688 |
2. PF | C5A6G2 | Serine hydroxymethyltransferase | 6.10e-10 | 3.11e-11 | NA | 0.6651 |
2. PF | Q63AJ0 | Kynureninase | 0.00e+00 | 1.21e-18 | NA | 0.7393 |
2. PF | A4WGZ8 | Serine hydroxymethyltransferase | 3.64e-10 | 1.22e-09 | NA | 0.6592 |
2. PF | Q3JVD7 | Kynureninase | 0.00e+00 | 1.73e-20 | NA | 0.7531 |
2. PF | B0KIG1 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 2.65e-11 | NA | 0.7387 |
2. PF | Q5LAZ9 | Histidinol-phosphate aminotransferase | 3.46e-09 | 1.00e-08 | NA | 0.6067 |
2. PF | B5Y8G6 | Serine hydroxymethyltransferase | 2.97e-10 | 2.91e-06 | NA | 0.6616 |
2. PF | Q8KZ92 | Histidinol-phosphate aminotransferase | 2.51e-10 | 1.53e-07 | NA | 0.6716 |
2. PF | O30207 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 1 | 6.66e-16 | 2.07e-25 | NA | 0.6837 |
2. PF | A5IT64 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.31e-08 | 3.31e-06 | NA | 0.6802 |
2. PF | Q0JZT9 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.13e-09 | NA | 0.7048 |
2. PF | B2SFM3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.14e-10 | 8.49e-10 | NA | 0.6459 |
2. PF | Q7MN19 | Serine hydroxymethyltransferase 1 | 3.33e-10 | 2.86e-09 | NA | 0.6631 |
2. PF | A5I9T3 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.34e-07 | 3.41e-08 | NA | 0.6933 |
2. PF | Q8XTQ1 | Serine hydroxymethyltransferase 2 | 3.93e-10 | 4.35e-07 | NA | 0.6309 |
2. PF | B0KKB9 | L-seryl-tRNA(Sec) selenium transferase | 1.24e-05 | 7.30e-03 | NA | 0.4479 |
2. PF | Q8TV92 | Probable L-tyrosine/L-aspartate decarboxylase | 0.00e+00 | 7.21e-10 | NA | 0.6917 |
2. PF | A6TFJ1 | L-seryl-tRNA(Sec) selenium transferase | 7.84e-06 | 3.07e-02 | NA | 0.4509 |
2. PF | Q73BH8 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 9.19e-09 | NA | 0.7431 |
2. PF | B7HB98 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.36e-07 | 1.79e-05 | NA | 0.6796 |
2. PF | Q8ZYF9 | Serine hydroxymethyltransferase | 3.03e-10 | 3.94e-10 | NA | 0.6505 |
2. PF | Q0C0I5 | Serine hydroxymethyltransferase | 7.30e-10 | 6.04e-06 | NA | 0.6455 |
2. PF | B1VP97 | Putative phenylalanine aminotransferase | 7.41e-10 | 1.49e-07 | NA | 0.6125 |
2. PF | Q5WF32 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.90e-10 | 1.08e-06 | NA | 0.6636 |
2. PF | Q492D5 | Serine hydroxymethyltransferase | 2.68e-10 | 1.58e-07 | NA | 0.6437 |
2. PF | B8CJM7 | Serine hydroxymethyltransferase | 1.12e-09 | 5.88e-09 | NA | 0.6139 |
2. PF | Q930J0 | Histidinol-phosphate aminotransferase 3 | 8.14e-08 | 3.93e-05 | NA | 0.5874 |
2. PF | C3NHN7 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.47e-07 | 7.60e-07 | NA | 0.6769 |
2. PF | B1JBM5 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.19e-10 | NA | 0.7297 |
2. PF | B0K631 | Serine hydroxymethyltransferase | 1.66e-10 | 2.47e-07 | NA | 0.6245 |
2. PF | Q5V3D7 | Serine hydroxymethyltransferase | 3.68e-10 | 6.47e-09 | NA | 0.621 |
2. PF | Q4UT93 | Kynureninase | 0.00e+00 | 3.84e-14 | NA | 0.7541 |
2. PF | Q5Z3C0 | Putative phenylalanine aminotransferase | 9.92e-10 | 2.72e-06 | NA | 0.6731 |
2. PF | B9L5S9 | L-seryl-tRNA(Sec) selenium transferase | 4.26e-06 | 2.92e-03 | NA | 0.4324 |
2. PF | Q5ZW88 | Histidinol-phosphate aminotransferase 1 | 2.41e-13 | 4.04e-10 | NA | 0.6299 |
2. PF | B3QS77 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.67e-07 | 3.71e-07 | NA | 0.6501 |
2. PF | A7HLP1 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.46e-10 | 2.99e-07 | NA | 0.6905 |
2. PF | A1UZE5 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 4.04e-11 | NA | 0.7166 |
2. PF | A9AA96 | Histidinol-phosphate aminotransferase | 4.26e-08 | 8.89e-08 | NA | 0.6559 |
2. PF | B9KZ42 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.34e-11 | 2.50e-07 | NA | 0.6217 |
2. PF | A1VEW4 | Histidinol-phosphate aminotransferase | 6.38e-10 | 1.10e-04 | NA | 0.6607 |
2. PF | A7X2S0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.86e-08 | 3.31e-06 | NA | 0.6795 |
2. PF | P9WGI6 | Serine hydroxymethyltransferase 2 | 6.74e-10 | 1.13e-09 | NA | 0.6647 |
2. PF | Q8RSQ4 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.14e-10 | NA | 0.7388 |
2. PF | B2I5Y0 | Histidinol-phosphate aminotransferase | 1.69e-08 | 1.02e-08 | NA | 0.6226 |
2. PF | Q5SJ58 | O-acetyl-L-homoserine sulfhydrylase 2 | 3.36e-08 | 6.68e-03 | NA | 0.5575 |
2. PF | Q02JF1 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.93e-11 | NA | 0.715 |
2. PF | Q988B8 | Pyridoxamine--pyruvate transaminase | 0.00e+00 | 4.50e-15 | NA | 0.677 |
2. PF | A7IAB9 | Probable L-tyrosine/L-aspartate decarboxylase | 3.02e-12 | 3.41e-08 | NA | 0.7213 |
2. PF | Q4K9L8 | 2-aminoethylphosphonate--pyruvate transaminase | 0.00e+00 | 1.61e-10 | NA | 0.7334 |
2. PF | Q5RDP0 | Serine--pyruvate aminotransferase | 0.00e+00 | 6.75e-16 | NA | 0.7327 |
2. PF | Q98B00 | Histidinol-phosphate aminotransferase 3 | 3.03e-08 | 1.27e-08 | NA | 0.6622 |
2. PF | Q3SRV3 | Serine hydroxymethyltransferase | 8.51e-10 | 1.60e-07 | NA | 0.6055 |
2. PF | Q5ZZ95 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.77e-15 | 1.90e-09 | NA | 0.6734 |
2. PF | Q2RTB8 | Serine hydroxymethyltransferase 2 | 6.14e-10 | 5.56e-07 | NA | 0.6504 |
2. PF | Q5X0A8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.90e-07 | 1.16e-07 | NA | 0.6902 |
2. PF | A2SQB8 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 1 | 4.44e-16 | 5.99e-18 | NA | 0.7233 |
2. PF | Q5WKB5 | Kynureninase | 0.00e+00 | 4.62e-21 | NA | 0.7394 |
2. PF | Q63WP4 | Kynureninase | 0.00e+00 | 1.88e-20 | NA | 0.7487 |
2. PF | Q12U08 | Histidinol-phosphate aminotransferase | 1.33e-09 | 3.03e-08 | NA | 0.664 |
2. PF | C3MUU9 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.14e-07 | 7.60e-07 | NA | 0.6797 |
2. PF | Q2YSZ4 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 7.05e-10 | 6.44e-06 | NA | 0.6636 |
2. PF | A4J9B1 | Serine hydroxymethyltransferase | 2.28e-10 | 4.11e-08 | NA | 0.6366 |
2. PF | P61003 | Histidinol-phosphate aminotransferase | 4.35e-08 | 1.39e-07 | NA | 0.5936 |
2. PF | B8DFX8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.60e-07 | 5.60e-06 | NA | 0.6745 |
2. PF | Q328Y9 | L-seryl-tRNA(Sec) selenium transferase | 9.46e-06 | 2.85e-02 | NA | 0.4459 |
2. PF | B1YLN8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.10e-07 | 2.89e-05 | NA | 0.6659 |
2. PF | Q5MNH8 | Sulfhydrylase-like protein lolC2 | 9.64e-08 | 4.61e-03 | NA | 0.5052 |
2. PF | B7N237 | L-seryl-tRNA(Sec) selenium transferase | 8.51e-06 | 2.10e-02 | NA | 0.4376 |
2. PF | Q71Y90 | Histidinol-phosphate aminotransferase | 6.66e-10 | 1.29e-06 | NA | 0.6093 |
2. PF | Q2FLN5 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 1 | 5.55e-16 | 2.48e-26 | NA | 0.7158 |
2. PF | Q3A934 | Serine hydroxymethyltransferase | 2.63e-10 | 1.11e-05 | NA | 0.6724 |
2. PF | B9DK21 | Histidinol-phosphate aminotransferase | 1.17e-09 | 9.30e-09 | NA | 0.6553 |
2. PF | C3MQN2 | Serine hydroxymethyltransferase | 6.65e-10 | 5.30e-12 | NA | 0.6556 |
2. PF | A5I526 | Serine hydroxymethyltransferase | 2.99e-10 | 4.41e-08 | NA | 0.6734 |
2. PF | A3NGW6 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 3.40e-11 | NA | 0.7277 |
2. PF | A6H1P7 | Kynureninase | 0.00e+00 | 1.64e-16 | NA | 0.7476 |
2. PF | C3N6F2 | Serine hydroxymethyltransferase | 4.11e-10 | 2.26e-12 | NA | 0.6503 |
2. PF | A4IXD7 | Serine hydroxymethyltransferase | 4.39e-10 | 1.18e-06 | NA | 0.6203 |
2. PF | Q8FY98 | Histidinol-phosphate aminotransferase | 1.18e-13 | 3.45e-08 | NA | 0.6564 |
2. PF | Q7PRG3 | 3-hydroxykynurenine transaminase | 0.00e+00 | 1.31e-12 | NA | 0.6814 |
2. PF | Q667X1 | Serine hydroxymethyltransferase | 3.85e-10 | 3.07e-08 | NA | 0.6601 |
2. PF | Q8KAN3 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.00e-07 | 2.12e-06 | NA | 0.659 |
2. PF | Q5JGX6 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.13e-07 | 2.31e-06 | NA | 0.678 |
2. PF | A0L403 | Serine hydroxymethyltransferase | 5.32e-10 | 2.28e-07 | NA | 0.6362 |
2. PF | Q82FJ1 | Putative phenylalanine aminotransferase | 6.98e-10 | 5.26e-08 | NA | 0.6421 |
2. PF | A8EV04 | L-seryl-tRNA(Sec) selenium transferase | 1.33e-05 | 2.80e-02 | NA | 0.4491 |
2. PF | A0LMC0 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 1.70e-13 | NA | 0.7251 |
2. PF | Q8Y5X8 | Histidinol-phosphate aminotransferase | 6.39e-10 | 3.88e-07 | NA | 0.651 |
2. PF | Q83J28 | L-seryl-tRNA(Sec) selenium transferase | 7.35e-06 | 1.69e-02 | NA | 0.4417 |
2. PF | Q65HG1 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.53e-10 | 5.09e-06 | NA | 0.6563 |
2. PF | A9V3C0 | Kynureninase | 0.00e+00 | 3.27e-11 | NA | 0.7495 |
2. PF | A9AYB7 | Serine hydroxymethyltransferase | 1.29e-10 | 6.24e-06 | NA | 0.6259 |
2. PF | Q71ZX2 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.47e-07 | 4.98e-06 | NA | 0.6656 |
2. PF | Q2G781 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.48e-10 | 3.47e-07 | NA | 0.6162 |
2. PF | C1B997 | Putative phenylalanine aminotransferase | 3.48e-10 | 2.93e-09 | NA | 0.6407 |
2. PF | P61004 | Putative phenylalanine aminotransferase | 8.79e-10 | 1.88e-07 | NA | 0.6921 |
2. PF | Q0W3U6 | Serine hydroxymethyltransferase | 1.18e-10 | 2.77e-12 | NA | 0.5998 |
2. PF | C4ZXI2 | L-seryl-tRNA(Sec) selenium transferase | 7.30e-06 | 1.52e-02 | NA | 0.4376 |
2. PF | B7ULF0 | L-seryl-tRNA(Sec) selenium transferase | 7.34e-06 | 1.85e-02 | NA | 0.4423 |
2. PF | C0Q7V5 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 4.20e-10 | NA | 0.7528 |
2. PF | A3CVZ3 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 4.44e-16 | 2.65e-21 | NA | 0.7085 |
2. PF | P0A2E2 | Serine hydroxymethyltransferase 1 | 2.71e-10 | 4.47e-08 | NA | 0.655 |
2. PF | Q87C30 | Histidinol-phosphate aminotransferase | 1.90e-08 | 1.02e-08 | NA | 0.6197 |
2. PF | Q8PT12 | Phosphoserine aminotransferase | 1.58e-13 | 7.86e-09 | NA | 0.6665 |
2. PF | A4IT57 | Kynureninase | 0.00e+00 | 1.76e-20 | NA | 0.7774 |
2. PF | Q12VA2 | Probable L-tyrosine/L-aspartate decarboxylase | 3.26e-13 | 1.13e-10 | NA | 0.732 |
2. PF | Q8Z8W6 | 2-aminoethylphosphonate--pyruvate transaminase | 1.11e-16 | 5.68e-10 | NA | 0.7589 |
2. PF | Q06191 | Aspartate aminotransferase | 8.17e-09 | 9.43e-04 | NA | 0.5549 |
2. PF | Q1GET3 | Histidinol-phosphate aminotransferase | 1.01e-13 | 1.60e-07 | NA | 0.6808 |
2. PF | Q2NEA8 | Serine hydroxymethyltransferase | 1.22e-10 | 5.17e-11 | NA | 0.6663 |
2. PF | A3MHE2 | Kynureninase | 0.00e+00 | 2.14e-20 | NA | 0.7452 |
2. PF | B1GYV7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.55e-16 | 4.07e-08 | NA | 0.6729 |
2. PF | Q8TZJ2 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.14e-07 | 4.39e-07 | NA | 0.6871 |
2. PF | C5BS91 | Serine hydroxymethyltransferase | 1.13e-09 | 2.52e-07 | NA | 0.6676 |
2. PF | Q82WQ3 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.37e-07 | 1.21e-07 | NA | 0.6817 |
2. PF | O29406 | Serine hydroxymethyltransferase | 1.70e-10 | 2.25e-10 | NA | 0.6672 |
2. PF | A3NS56 | Kynureninase | 0.00e+00 | 1.73e-20 | NA | 0.7523 |
2. PF | A9R4E4 | L-seryl-tRNA(Sec) selenium transferase | 7.60e-06 | 4.79e-02 | NA | 0.4415 |
2. PF | Q60BW5 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.15e-07 | 1.04e-05 | NA | 0.6735 |
2. PF | Q4UND3 | Probable aspartate/prephenate aminotransferase | 1.34e-08 | 5.85e-04 | NA | 0.5741 |
2. PF | Q5X3Q5 | Histidinol-phosphate aminotransferase 2 | 4.70e-10 | 6.43e-07 | NA | 0.6571 |
2. PF | A4YHB7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.37e-09 | 5.45e-08 | NA | 0.6524 |
2. PF | B9LQJ1 | Serine hydroxymethyltransferase | 3.03e-10 | 8.25e-09 | NA | 0.5907 |
2. PF | Q14J40 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.37e-10 | 7.40e-10 | NA | 0.6508 |
2. PF | C4KH28 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.58e-07 | 7.60e-07 | NA | 0.6888 |
2. PF | B0R5Y6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.83e-09 | 4.36e-08 | NA | 0.6329 |
3. BF | P0DN31 | Cysteine desulfurase, mitochondrial | 0.00e+00 | NA | 9.45e-32 | 0.8044 |
3. BF | O60028 | Cysteine desulfurase, mitochondrial | 0.00e+00 | NA | 3.02e-28 | 0.7827 |
3. BF | Q16P90 | Molybdenum cofactor sulfurase 3 | 1.11e-16 | NA | 1.69e-12 | 0.804 |
3. BF | Q9N0E7 | Molybdenum cofactor sulfurase | 3.55e-15 | NA | 3.89e-11 | 0.823 |
3. BF | O32975 | Probable cysteine desulfurase 1 | 0.00e+00 | NA | 6.94e-65 | 0.9273 |
3. BF | B4N1V2 | Molybdenum cofactor sulfurase | 7.32e-09 | NA | 2.43e-06 | 0.7714 |
3. BF | Q8LGM7 | Molybdenum cofactor sulfurase | 0.00e+00 | NA | 2.36e-05 | 0.8374 |
3. BF | A8X493 | Molybdenum cofactor sulfurase | 1.67e-15 | NA | 3.85e-06 | 0.7607 |
3. BF | A2QIK9 | Molybdenum cofactor sulfurase | 2.22e-15 | NA | 8.36e-07 | 0.8188 |
3. BF | Q9KII6 | Probable cysteine desulfurase | 0.00e+00 | NA | 2.78e-67 | 0.9292 |
3. BF | P71379 | Putative csd-like protein HI_1343 | 0.00e+00 | NA | 4.36e-35 | 0.8813 |
3. BF | B3NY19 | Molybdenum cofactor sulfurase | 6.66e-16 | NA | 1.69e-05 | 0.8096 |
3. BF | Q8IU29 | Molybdenum cofactor sulfurase | 6.88e-15 | NA | 6.69e-15 | 0.8061 |
3. BF | B0WSW8 | Molybdenum cofactor sulfurase 1 | 1.67e-15 | NA | 9.22e-08 | 0.8114 |
3. BF | B4PYH5 | Molybdenum cofactor sulfurase | 4.44e-16 | NA | 2.99e-06 | 0.8055 |
3. BF | Q183T0 | Bifunctional phosphonoacetaldehyde hydrolase/aminoethylphosphonate transaminase | 2.55e-07 | NA | 0.002 | 0.6552 |
3. BF | Q16GH0 | Molybdenum cofactor sulfurase 1 | 0.00e+00 | NA | 1.10e-10 | 0.8081 |
3. BF | B3MZN7 | Molybdenum cofactor sulfurase | 1.33e-15 | NA | 5.61e-09 | 0.7493 |
4. PB | B0Y6H2 | Kynureninase 2 | 0.00e+00 | 8.05e-11 | 0.002 | NA |
4. PB | Q99P39 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 1.92e-12 | 5.15e-26 | NA |
4. PB | Q0CZX6 | Kynureninase 2 | 0.00e+00 | 5.98e-12 | 0.003 | NA |
4. PB | P77444 | Cysteine desulfurase | 0.00e+00 | 8.33e-58 | 5.45e-79 | NA |
4. PB | A0R5M7 | Probable hercynylcysteine sulfoxide lyase | 0.00e+00 | 1.11e-33 | 7.38e-09 | NA |
4. PB | Q54X04 | Probable cysteine desulfurase, mitochondrial | 0.00e+00 | 8.67e-13 | 3.51e-28 | NA |
4. PB | O74542 | Uncharacterized aminotransferase C777.03c | 0.00e+00 | 1.46e-31 | 2.54e-19 | NA |
4. PB | Q9JLI6 | Selenocysteine lyase | 0.00e+00 | 4.47e-37 | 1.04e-21 | NA |
4. PB | Q81C43 | Histidinol-phosphate aminotransferase 2 | 1.08e-07 | 4.97e-07 | 0.005 | NA |
4. PB | P87185 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 1.58e-03 | 3.85e-24 | NA |
4. PB | Q46925 | Cysteine desulfurase CsdA | 0.00e+00 | 9.86e-63 | 2.04e-78 | NA |
4. PB | Q6HHF6 | Histidinol-phosphate aminotransferase 2 | 9.68e-08 | 9.52e-08 | 0.001 | NA |
4. PB | P0A6B7 | Cysteine desulfurase IscS | 0.00e+00 | 2.29e-30 | 5.42e-26 | NA |
4. PB | Q59QC4 | Kynureninase | 0.00e+00 | 6.15e-17 | 0.010 | NA |
4. PB | Q736A5 | Histidinol-phosphate aminotransferase 2 | 2.10e-09 | 8.50e-07 | 0.004 | NA |
4. PB | Q82XE0 | Histidinol-phosphate aminotransferase 2 | 1.03e-09 | 6.15e-07 | 0.009 | NA |
4. PB | Q10089 | Uncharacterized protein C11D3.10 | 0.00e+00 | 6.53e-27 | 3.46e-20 | NA |
4. PB | P43567 | Alanine--glyoxylate aminotransferase 1 | 0.00e+00 | 2.23e-12 | 0.004 | NA |
4. PB | Q9Z1J3 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 1.73e-09 | 3.23e-26 | NA |
4. PB | P9WQ71 | IscS-like cysteine desulfurase | 0.00e+00 | 3.22e-28 | 6.81e-12 | NA |
4. PB | A1CWY1 | Kynureninase 2 | 0.00e+00 | 9.65e-11 | 0.001 | NA |
4. PB | A6UPN9 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 1.67e-15 | 1.33e-24 | 0.015 | NA |
4. PB | Q81P62 | Histidinol-phosphate aminotransferase 2 | 1.03e-07 | 8.04e-07 | 0.001 | NA |
4. PB | O49543 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 4.92e-13 | 7.42e-30 | NA |
4. PB | Q93WX6 | Cysteine desulfurase 1, chloroplastic | 0.00e+00 | 5.16e-16 | 3.15e-74 | NA |
4. PB | Q9Y697 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 4.85e-11 | 2.94e-26 | NA |
4. PB | Q2UJE8 | Kynureninase 2 | 0.00e+00 | 1.44e-11 | 0.012 | NA |
4. PB | Q63A05 | Histidinol-phosphate aminotransferase 2 | 2.53e-09 | 3.97e-07 | 0.002 | NA |
4. PB | A3LQD7 | Kynureninase | 0.00e+00 | 4.78e-16 | 0.006 | NA |
4. PB | C6C2Z3 | Aspartate aminotransferase | 4.48e-07 | 1.84e-04 | 0.008 | NA |
4. PB | H3ZPU1 | Aromatic-amino-acid aminotransferase 2 | 1.45e-08 | 1.97e-05 | 0.001 | NA |
4. PB | Q9VKD3 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 2.47e-09 | 9.75e-30 | NA |
4. PB | A1CHT0 | Kynureninase 2 | 0.00e+00 | 3.73e-11 | 0.023 | NA |
4. PB | P9WQ69 | Probable cysteine desulfurase | 0.00e+00 | 1.39e-53 | 2.68e-66 | NA |
4. PB | Q56YA5 | Serine--glyoxylate aminotransferase | 0.00e+00 | 5.38e-11 | 4.07e-06 | NA |
4. PB | O94431 | Hercynylcysteine sulfoxide lyase | 0.00e+00 | 3.42e-29 | 9.85e-06 | NA |
4. PB | Q96I15 | Selenocysteine lyase | 0.00e+00 | 9.85e-29 | 4.75e-23 | NA |
4. PB | Q60317 | Probable aspartate aminotransferase | 1.69e-10 | 2.32e-09 | 1.86e-07 | NA |
4. PB | P9WQ67 | Uncharacterized protein Rv3778c | 0.00e+00 | 1.45e-36 | 1.01e-13 | NA |
4. PB | A1C688 | Kynureninase 1 | 0.00e+00 | 1.41e-11 | 0.020 | NA |
4. PB | Q68FT9 | Selenocysteine lyase | 0.00e+00 | 5.09e-37 | 4.58e-21 | NA |
4. PB | Q9A9H3 | GDP-perosamine synthase | 1.20e-13 | 9.52e-04 | 0.003 | NA |
4. PB | P25374 | Cysteine desulfurase, mitochondrial | 0.00e+00 | 3.02e-02 | 4.19e-30 | NA |
5. P | Q8XB34 | Tryptophanase | 1.28e-08 | 2.36e-03 | NA | NA |
5. P | A6LKU9 | Serine hydroxymethyltransferase | 7.97e-10 | 1.33e-07 | NA | NA |
5. P | B0CL90 | Serine hydroxymethyltransferase | 3.99e-10 | 2.99e-07 | NA | NA |
5. P | Q2F5L3 | Serine hydroxymethyltransferase | 1.80e-09 | 2.77e-04 | NA | NA |
5. P | Q031D5 | Phosphoserine aminotransferase | 1.51e-14 | 4.31e-11 | NA | NA |
5. P | Q4KC84 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 2.17e-13 | 6.08e-04 | NA | NA |
5. P | Q8EM07 | Putative pyridoxal phosphate-dependent acyltransferase | 7.26e-11 | 5.44e-07 | NA | NA |
5. P | Q72RH8 | Acetylornithine aminotransferase | 2.94e-10 | 7.05e-03 | NA | NA |
5. P | O52552 | 3-amino-5-hydroxybenzoate synthase | 1.46e-12 | 6.27e-03 | NA | NA |
5. P | B8J3V0 | Putative 8-amino-7-oxononanoate synthase | 4.88e-15 | 3.31e-07 | NA | NA |
5. P | B9MAC8 | Serine hydroxymethyltransferase | 1.02e-10 | 1.44e-07 | NA | NA |
5. P | Q7U9J7 | Serine hydroxymethyltransferase | 6.03e-10 | 1.27e-07 | NA | NA |
5. P | Q38WJ7 | Serine hydroxymethyltransferase | 1.23e-10 | 6.80e-07 | NA | NA |
5. P | C1CYT8 | Serine hydroxymethyltransferase | 5.29e-10 | 1.33e-09 | NA | NA |
5. P | B0TA38 | LL-diaminopimelate aminotransferase | 1.76e-07 | 5.69e-04 | NA | NA |
5. P | A5DM91 | Kynureninase | 0.00e+00 | 1.27e-17 | NA | NA |
5. P | B8CYJ3 | Serine hydroxymethyltransferase | 2.52e-10 | 1.21e-06 | NA | NA |
5. P | P9WGB5 | O-succinylhomoserine sulfhydrylase | 1.98e-08 | 2.24e-04 | NA | NA |
5. P | Q820S0 | Phosphoserine aminotransferase | 1.07e-13 | 1.47e-09 | NA | NA |
5. P | Q6FUP6 | Serine hydroxymethyltransferase, cytosolic | 1.22e-06 | 7.95e-07 | NA | NA |
5. P | Q3KHZ1 | Histidinol-phosphate aminotransferase 1 | 2.08e-09 | 7.68e-10 | NA | NA |
5. P | Q9PDM2 | 8-amino-7-oxononanoate synthase | 4.13e-11 | 1.24e-08 | NA | NA |
5. P | Q1H003 | Serine hydroxymethyltransferase | 1.31e-10 | 6.96e-08 | NA | NA |
5. P | B0JUM0 | LL-diaminopimelate aminotransferase | 1.88e-07 | 3.27e-05 | NA | NA |
5. P | Q3YZ04 | Serine hydroxymethyltransferase | 2.59e-10 | 2.15e-08 | NA | NA |
5. P | Q39YP6 | Histidinol-phosphate aminotransferase | 2.90e-09 | 1.55e-10 | NA | NA |
5. P | O88986 | 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial | 9.14e-11 | 3.17e-03 | NA | NA |
5. P | A4JCH1 | Phosphoserine aminotransferase | 6.53e-14 | 1.06e-10 | NA | NA |
5. P | B2HTW5 | Histidinol-phosphate aminotransferase | 2.64e-09 | 6.49e-08 | NA | NA |
5. P | Q9A8J6 | Serine hydroxymethyltransferase | 2.91e-10 | 4.92e-07 | NA | NA |
5. P | Q2JTG5 | Histidinol-phosphate aminotransferase | 2.56e-10 | 1.36e-09 | NA | NA |
5. P | A9A1A0 | Glutamate-1-semialdehyde 2,1-aminomutase | 5.44e-14 | 4.78e-03 | NA | NA |
5. P | Q7MXW0 | Serine hydroxymethyltransferase | 1.88e-09 | 2.15e-07 | NA | NA |
5. P | B4RF16 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.31e-08 | 3.10e-07 | NA | NA |
5. P | A3DK17 | LL-diaminopimelate aminotransferase | 1.28e-07 | 1.42e-04 | NA | NA |
5. P | Q7VL09 | 8-amino-7-oxononanoate synthase | 1.07e-14 | 1.39e-05 | NA | NA |
5. P | B5F846 | Succinylornithine transaminase | 2.53e-14 | 1.74e-03 | NA | NA |
5. P | Q7N3Q5 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.43e-13 | 9.43e-04 | NA | NA |
5. P | C1DEQ3 | Serine hydroxymethyltransferase | 2.30e-10 | 2.67e-07 | NA | NA |
5. P | B7K0L9 | Putative 8-amino-7-oxononanoate synthase | 1.78e-15 | 9.60e-07 | NA | NA |
5. P | Q2FWE5 | Serine hydroxymethyltransferase | 1.92e-10 | 1.44e-06 | NA | NA |
5. P | A5UGY2 | Histidinol-phosphate aminotransferase | 1.61e-09 | 4.44e-09 | NA | NA |
5. P | Q7VSA0 | Ornithine aminotransferase | 1.17e-13 | 2.15e-03 | NA | NA |
5. P | Q8F6W9 | Histidinol-phosphate aminotransferase | 2.39e-09 | 2.52e-07 | NA | NA |
5. P | P09139 | Serine--pyruvate aminotransferase, mitochondrial | 1.11e-16 | 1.05e-06 | NA | NA |
5. P | Q6L739 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase | 4.84e-09 | 1.75e-05 | NA | NA |
5. P | B0B7W0 | LL-diaminopimelate aminotransferase | 7.24e-08 | 4.13e-09 | NA | NA |
5. P | Q31RK5 | Serine hydroxymethyltransferase | 3.54e-10 | 1.88e-06 | NA | NA |
5. P | Q8U9W3 | Histidinol-phosphate aminotransferase | 1.34e-13 | 2.70e-07 | NA | NA |
5. P | P74861 | Aromatic-amino-acid aminotransferase | 1.21e-06 | 1.89e-05 | NA | NA |
5. P | Q826W3 | L-methionine gamma-lyase | 4.64e-07 | 2.30e-05 | NA | NA |
5. P | Q6ADF0 | Serine hydroxymethyltransferase | 5.16e-10 | 2.00e-09 | NA | NA |
5. P | B4T9N5 | Histidinol-phosphate aminotransferase | 5.26e-08 | 1.22e-09 | NA | NA |
5. P | A0B8J6 | Serine hydroxymethyltransferase | 3.03e-10 | 2.61e-07 | NA | NA |
5. P | A8FDG9 | 8-amino-7-oxononanoate synthase | 9.99e-16 | 3.97e-07 | NA | NA |
5. P | Q0BTE6 | Serine hydroxymethyltransferase | 3.85e-10 | 5.85e-08 | NA | NA |
5. P | Q8CXE0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.38e-08 | 8.98e-07 | NA | NA |
5. P | Q04512 | 5-aminolevulinate synthase 1 | 2.73e-11 | 5.51e-05 | NA | NA |
5. P | A4WDC0 | Serine hydroxymethyltransferase | 2.52e-10 | 9.98e-08 | NA | NA |
5. P | P63569 | Acetylornithine aminotransferase | 7.38e-14 | 1.28e-02 | NA | NA |
5. P | A4G7M4 | Serine hydroxymethyltransferase | 1.40e-10 | 8.38e-08 | NA | NA |
5. P | P37303 | Low specificity L-threonine aldolase | 2.86e-13 | 2.47e-06 | NA | NA |
5. P | C1EL61 | Ornithine aminotransferase | 4.92e-14 | 4.47e-02 | NA | NA |
5. P | Q31PY6 | LL-diaminopimelate aminotransferase | 2.19e-07 | 5.13e-05 | NA | NA |
5. P | Q9ZJA7 | L-seryl-tRNA(Sec) selenium transferase | 1.44e-08 | 4.31e-15 | NA | NA |
5. P | Q07346 | Glutamate decarboxylase | 1.33e-15 | 5.04e-06 | NA | NA |
5. P | A8A6H0 | Tryptophanase | 1.29e-08 | 2.57e-03 | NA | NA |
5. P | Q607U4 | Serine hydroxymethyltransferase | 4.72e-10 | 4.47e-08 | NA | NA |
5. P | B7L853 | Tryptophanase | 4.51e-07 | 2.61e-03 | NA | NA |
5. P | A1KVF6 | Putative 8-amino-7-oxononanoate synthase | 4.30e-14 | 3.23e-05 | NA | NA |
5. P | P45487 | 8-amino-7-oxononanoate synthase | 1.58e-14 | 7.29e-08 | NA | NA |
5. P | Q0HV09 | Phosphoserine aminotransferase | 1.57e-09 | 5.26e-08 | NA | NA |
5. P | Q9LCS5 | Acetylornithine aminotransferase | 5.43e-13 | 3.72e-04 | NA | NA |
5. P | Q48DU7 | Serine hydroxymethyltransferase 1 | 2.44e-10 | 3.13e-07 | NA | NA |
5. P | A0PVN0 | Putative phenylalanine aminotransferase | 8.88e-10 | 7.64e-08 | NA | NA |
5. P | B7GY87 | Phosphoserine aminotransferase | 8.53e-14 | 4.36e-10 | NA | NA |
5. P | B2TVF4 | 8-amino-7-oxononanoate synthase | 2.20e-11 | 3.00e-06 | NA | NA |
5. P | Q8ZYW1 | Glutamate-1-semialdehyde 2,1-aminomutase | 5.27e-13 | 1.40e-02 | NA | NA |
5. P | Q5MNH3 | L-cysteine desulfhydrase-like protein lolT2 | 0.00e+00 | 5.79e-19 | NA | NA |
5. P | A7XRY8 | Aminotransferase tdiD | 2.70e-05 | 8.31e-07 | NA | NA |
5. P | Q8Z6F9 | Succinylornithine transaminase | 3.28e-14 | 2.41e-03 | NA | NA |
5. P | A4IQV4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.03e-08 | 6.96e-07 | NA | NA |
5. P | B8IBW2 | 8-amino-7-oxononanoate synthase | 9.91e-11 | 7.64e-06 | NA | NA |
5. P | P56099 | Histidinol-phosphate aminotransferase | 3.65e-07 | 4.44e-07 | NA | NA |
5. P | Q87BU0 | Phosphoserine aminotransferase | 1.37e-14 | 2.04e-13 | NA | NA |
5. P | Q2MFP2 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase | 3.58e-09 | 2.62e-04 | NA | NA |
5. P | Q129K3 | Serine hydroxymethyltransferase | 1.35e-10 | 5.08e-08 | NA | NA |
5. P | Q8TSS3 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 7.66e-15 | 8.64e-26 | NA | NA |
5. P | P60999 | Histidinol-phosphate aminotransferase | 4.77e-09 | 3.49e-06 | NA | NA |
5. P | P9WQ72 | Phosphoserine aminotransferase | 4.42e-08 | 1.72e-10 | NA | NA |
5. P | Q4QML4 | Tryptophanase | 4.58e-07 | 8.09e-05 | NA | NA |
5. P | B6J3H2 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.74e-13 | 8.06e-03 | NA | NA |
5. P | Q5HWE5 | Phosphoserine aminotransferase | 2.05e-13 | 6.45e-11 | NA | NA |
5. P | P80862 | Phosphoserine aminotransferase | 8.53e-14 | 2.66e-12 | NA | NA |
5. P | Q0AFT6 | Serine hydroxymethyltransferase | 2.02e-10 | 6.49e-08 | NA | NA |
5. P | C3L3I3 | L-seryl-tRNA(Sec) selenium transferase | 1.68e-06 | 1.35e-02 | NA | NA |
5. P | A9IJI3 | Phosphoserine aminotransferase | 1.99e-14 | 3.36e-11 | NA | NA |
5. P | Q66CI9 | Phosphoserine aminotransferase | 7.69e-14 | 2.01e-11 | NA | NA |
5. P | Q7W7H6 | Acetylornithine aminotransferase 1 | 8.16e-14 | 6.44e-04 | NA | NA |
5. P | A3D4A1 | Phosphoserine aminotransferase | 1.12e-09 | 1.07e-08 | NA | NA |
5. P | Q9CHW7 | Serine hydroxymethyltransferase | 3.03e-10 | 7.47e-08 | NA | NA |
5. P | Q31YU4 | Phosphoserine aminotransferase | 6.68e-14 | 8.28e-10 | NA | NA |
5. P | Q0ID68 | LL-diaminopimelate aminotransferase | 3.33e-07 | 5.58e-03 | NA | NA |
5. P | Q5V4K3 | Histidinol-phosphate aminotransferase | 3.07e-07 | 2.41e-09 | NA | NA |
5. P | Q2JS04 | LL-diaminopimelate aminotransferase | 3.25e-07 | 3.62e-05 | NA | NA |
5. P | Q8YMG7 | Histidinol-phosphate aminotransferase 2 | 1.82e-12 | 2.69e-10 | NA | NA |
5. P | A3NQS3 | 8-amino-7-oxononanoate synthase | 1.26e-10 | 1.86e-07 | NA | NA |
5. P | Q9S9U6 | 1-aminocyclopropane-1-carboxylate synthase 11 | 2.31e-05 | 1.11e-06 | NA | NA |
5. P | Q2MF12 | Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase | 1.16e-08 | 1.82e-03 | NA | NA |
5. P | Q9PDF2 | Acetylornithine aminotransferase | 1.42e-13 | 4.41e-03 | NA | NA |
5. P | B0VBU8 | Histidine decarboxylase | 4.18e-10 | 2.39e-12 | NA | NA |
5. P | Q5M0B4 | Serine hydroxymethyltransferase | 5.28e-10 | 8.78e-08 | NA | NA |
5. P | Q1MS11 | Serine hydroxymethyltransferase | 1.18e-10 | 5.69e-07 | NA | NA |
5. P | C3LFJ0 | Serine hydroxymethyltransferase | 2.05e-10 | 5.91e-08 | NA | NA |
5. P | Q53U08 | Neamine transaminase NeoN | 4.07e-12 | 9.38e-03 | NA | NA |
5. P | Q8Z542 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 8.90e-14 | 2.21e-03 | NA | NA |
5. P | Q8R887 | Serine hydroxymethyltransferase | 1.75e-10 | 7.69e-07 | NA | NA |
5. P | P45545 | Uncharacterized protein YhfS | 9.59e-09 | 2.85e-19 | NA | NA |
5. P | A7ZCF3 | Histidinol-phosphate aminotransferase | 1.49e-09 | 1.90e-07 | NA | NA |
5. P | B5Y9D4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.34e-08 | 5.13e-05 | NA | NA |
5. P | Q9Z831 | Serine hydroxymethyltransferase | 2.31e-09 | 3.94e-04 | NA | NA |
5. P | A2CC97 | LL-diaminopimelate aminotransferase | 2.97e-07 | 1.03e-03 | NA | NA |
5. P | A2REH5 | Serine hydroxymethyltransferase | 4.63e-10 | 6.20e-08 | NA | NA |
5. P | Q9HUI9 | Arginine--pyruvate transaminase AruH | 6.75e-09 | 2.31e-08 | NA | NA |
5. P | B8CX89 | LL-diaminopimelate aminotransferase | 1.85e-07 | 5.63e-07 | NA | NA |
5. P | Q3SLX9 | 8-amino-7-oxononanoate synthase | 6.30e-11 | 6.73e-07 | NA | NA |
5. P | P17735 | Tyrosine aminotransferase | 1.48e-07 | 4.07e-02 | NA | NA |
5. P | A2RIS0 | Serine hydroxymethyltransferase | 4.24e-10 | 4.85e-08 | NA | NA |
5. P | Q0W2L3 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 1 | 7.44e-15 | 2.06e-26 | NA | NA |
5. P | B2SS66 | 8-amino-7-oxononanoate synthase | 4.11e-11 | 6.88e-08 | NA | NA |
5. P | B0RMR1 | 8-amino-7-oxononanoate synthase | 3.53e-11 | 4.85e-08 | NA | NA |
5. P | Q57AR7 | Histidinol-phosphate aminotransferase | 1.46e-13 | 3.45e-08 | NA | NA |
5. P | A8YZZ5 | Histidinol-phosphate aminotransferase | 2.21e-09 | 9.53e-09 | NA | NA |
5. P | O34370 | Phosphoserine aminotransferase | 6.98e-14 | 2.40e-10 | NA | NA |
5. P | Q5GW07 | Serine hydroxymethyltransferase | 3.63e-10 | 5.82e-07 | NA | NA |
5. P | Q9I468 | Threonine-phosphate decarboxylase | 1.09e-06 | 9.90e-05 | NA | NA |
5. P | Q9JTX9 | Acetylornithine aminotransferase | 2.44e-14 | 2.83e-04 | NA | NA |
5. P | Q0TB00 | Tryptophanase | 4.27e-07 | 2.61e-03 | NA | NA |
5. P | P37821 | 1-aminocyclopropane-1-carboxylate synthase | 2.50e-05 | 1.11e-06 | NA | NA |
5. P | A5UN82 | LL-diaminopimelate aminotransferase | 1.06e-07 | 1.49e-04 | NA | NA |
5. P | Q742L2 | Putative phosphoserine aminotransferase | 4.56e-08 | 2.13e-09 | NA | NA |
5. P | P13254 | L-methionine gamma-lyase | 6.25e-09 | 1.26e-07 | NA | NA |
5. P | Q8G1F1 | Serine hydroxymethyltransferase | 3.60e-10 | 1.21e-06 | NA | NA |
5. P | Q638W1 | Phosphoserine aminotransferase | 4.06e-14 | 3.22e-12 | NA | NA |
5. P | A0QBI3 | Putative phosphoserine aminotransferase | 4.40e-08 | 1.58e-09 | NA | NA |
5. P | Q8CRN3 | Serine hydroxymethyltransferase | 1.76e-10 | 2.58e-07 | NA | NA |
5. P | A5WMQ5 | 8-amino-7-oxononanoate synthase | 2.21e-14 | 1.90e-07 | NA | NA |
5. P | Q66B21 | Succinylornithine transaminase | 5.43e-14 | 3.88e-03 | NA | NA |
5. P | Q02YW3 | Histidinol-phosphate aminotransferase | 2.72e-13 | 9.90e-11 | NA | NA |
5. P | Q6QVU4 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase | 3.04e-09 | 6.14e-04 | NA | NA |
5. P | A1UHK7 | Histidinol-phosphate aminotransferase | 4.65e-09 | 2.19e-06 | NA | NA |
5. P | A5GCZ8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.38e-11 | 1.65e-08 | NA | NA |
5. P | B0TT41 | Phosphoserine aminotransferase | 1.15e-13 | 9.38e-10 | NA | NA |
5. P | Q2YCK1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.55e-08 | 9.53e-09 | NA | NA |
5. P | Q2FY35 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.65e-10 | 1.48e-05 | NA | NA |
5. P | M1W859 | Probable aminotransferase tcpI | 1.42e-05 | 4.83e-03 | NA | NA |
5. P | Q8R8W4 | L-seryl-tRNA(Sec) selenium transferase | 3.90e-06 | 2.20e-02 | NA | NA |
5. P | Q39V87 | Serine hydroxymethyltransferase | 2.88e-10 | 2.33e-08 | NA | NA |
5. P | C3LBX0 | Ornithine aminotransferase | 4.69e-14 | 4.51e-02 | NA | NA |
5. P | B7V486 | 8-amino-7-oxononanoate synthase | 2.33e-15 | 6.57e-08 | NA | NA |
5. P | Q5M3A4 | Phosphoserine aminotransferase | 2.02e-14 | 1.02e-10 | NA | NA |
5. P | Q8FGZ9 | Succinylornithine transaminase | 2.43e-14 | 7.44e-03 | NA | NA |
5. P | P0A2E1 | Serine hydroxymethyltransferase | 2.71e-10 | 4.47e-08 | NA | NA |
5. P | B4TD37 | Phosphoserine aminotransferase | 3.02e-14 | 5.20e-10 | NA | NA |
5. P | Q72NJ3 | LL-diaminopimelate aminotransferase | 4.88e-07 | 8.34e-05 | NA | NA |
5. P | Q37001 | 1-aminocyclopropane-1-carboxylate synthase 5 | 2.68e-05 | 9.17e-04 | NA | NA |
5. P | A1WVM6 | 8-amino-7-oxononanoate synthase | 1.06e-11 | 1.98e-08 | NA | NA |
5. P | P72173 | Aspartate aminotransferase | 8.60e-06 | 5.68e-05 | NA | NA |
5. P | C5BDQ4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 6.74e-14 | 6.95e-04 | NA | NA |
5. P | Q9SK47 | Probable aminotransferase TAT3 | 4.80e-08 | 2.47e-05 | NA | NA |
5. P | B7NP97 | L-seryl-tRNA(Sec) selenium transferase | 8.34e-06 | 2.90e-02 | NA | NA |
5. P | A7IHE9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.63e-14 | 1.49e-08 | NA | NA |
5. P | Q7NL03 | Histidinol-phosphate aminotransferase | 2.49e-10 | 3.57e-09 | NA | NA |
5. P | Q02636 | Tyrosine aminotransferase | 3.46e-06 | 1.04e-04 | NA | NA |
5. P | Q65DW5 | Serine hydroxymethyltransferase | 2.56e-10 | 6.88e-07 | NA | NA |
5. P | Q8CUM9 | Acetylornithine aminotransferase | 2.07e-14 | 3.57e-03 | NA | NA |
5. P | O13427 | Low-specificity L-threonine aldolase | 2.59e-13 | 5.64e-08 | NA | NA |
5. P | Q6N693 | Serine hydroxymethyltransferase 1 | 6.55e-10 | 5.56e-07 | NA | NA |
5. P | D0ZLR3 | D-glucosaminate-6-phosphate ammonia lyase | 6.57e-06 | 2.73e-10 | NA | NA |
5. P | Q9SUR6 | Cystine lyase CORI3 | 3.46e-08 | 2.91e-04 | NA | NA |
5. P | B6IMT0 | Serine hydroxymethyltransferase | 3.11e-10 | 8.10e-08 | NA | NA |
5. P | Q88AD1 | Serine hydroxymethyltransferase 1 | 5.44e-10 | 5.82e-07 | NA | NA |
5. P | A7ZY32 | 8-amino-7-oxononanoate synthase | 1.99e-11 | 2.47e-06 | NA | NA |
5. P | B4TQU0 | 8-amino-7-oxononanoate synthase | 1.95e-11 | 3.67e-07 | NA | NA |
5. P | P50435 | Serine hydroxymethyltransferase | 4.09e-10 | 3.70e-08 | NA | NA |
5. P | Q9RW75 | [LysW]-aminoadipate semialdehyde transaminase | 1.92e-14 | 2.18e-02 | NA | NA |
5. P | B7GZJ8 | Histidine decarboxylase | 4.79e-10 | 2.39e-12 | NA | NA |
5. P | Q5JFU6 | Histidinol-phosphate aminotransferase | 3.50e-07 | 4.47e-10 | NA | NA |
5. P | Q8Z8H8 | Threonine-phosphate decarboxylase | 6.67e-10 | 2.21e-06 | NA | NA |
5. P | Q65236 | NifS-like protein | NA | 2.10e-07 | NA | NA |
5. P | B2J1W1 | Putative 8-amino-7-oxononanoate synthase | 8.88e-16 | 3.85e-06 | NA | NA |
5. P | Q8RDT4 | L-methionine gamma-lyase | 6.15e-09 | 1.88e-06 | NA | NA |
5. P | Q5QZ48 | Phosphoserine aminotransferase | 6.75e-14 | 5.14e-09 | NA | NA |
5. P | Q2NEQ0 | Histidinol-phosphate aminotransferase | 3.45e-10 | 1.13e-08 | NA | NA |
5. P | Q1CUX5 | Serine hydroxymethyltransferase | 3.39e-10 | 3.43e-07 | NA | NA |
5. P | S0DUX5 | Sulfhydrylase FUB7 | 8.38e-08 | 3.38e-06 | NA | NA |
5. P | Q9JYY4 | Acetylornithine aminotransferase | 2.80e-14 | 3.57e-04 | NA | NA |
5. P | B4RV95 | Serine hydroxymethyltransferase | 9.92e-10 | 2.31e-08 | NA | NA |
5. P | Q321P0 | Succinylornithine transaminase | 2.73e-14 | 6.98e-03 | NA | NA |
5. P | Q3ILA3 | Phosphoserine aminotransferase | 2.35e-14 | 1.20e-11 | NA | NA |
5. P | Q60HG7 | Cystathionine gamma-lyase | 4.97e-09 | 2.54e-04 | NA | NA |
5. P | Q7DBF3 | GDP-perosamine synthase | 2.95e-13 | 2.91e-04 | NA | NA |
5. P | Q6FEC7 | Histidinol-phosphate aminotransferase | 1.29e-09 | 2.96e-07 | NA | NA |
5. P | B0VLF5 | Serine hydroxymethyltransferase | 7.18e-10 | 3.30e-05 | NA | NA |
5. P | A9I292 | Serine hydroxymethyltransferase | 7.38e-11 | 1.12e-07 | NA | NA |
5. P | B6EJ89 | Histidinol-phosphate aminotransferase | 1.74e-09 | 1.70e-10 | NA | NA |
5. P | C6E916 | Histidinol-phosphate aminotransferase | 3.31e-13 | 6.40e-12 | NA | NA |
5. P | Q9WY56 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.19e-07 | 1.44e-06 | NA | NA |
5. P | B3E933 | LL-diaminopimelate aminotransferase | 1.83e-07 | 7.09e-04 | NA | NA |
5. P | Q9PII2 | Histidinol-phosphate aminotransferase | 7.79e-10 | 3.35e-09 | NA | NA |
5. P | A3PIA4 | Histidinol-phosphate aminotransferase | 6.81e-14 | 8.10e-08 | NA | NA |
5. P | Q885K0 | Acetylornithine aminotransferase 1 | 5.43e-14 | 1.22e-02 | NA | NA |
5. P | A7GN55 | Histidinol-phosphate aminotransferase | 1.79e-09 | 3.43e-07 | NA | NA |
5. P | A9ML15 | Histidinol-phosphate aminotransferase | 5.50e-08 | 8.49e-10 | NA | NA |
5. P | C0PWY3 | 8-amino-7-oxononanoate synthase | 1.98e-11 | 1.73e-07 | NA | NA |
5. P | Q62FC0 | Histidinol-phosphate aminotransferase 2 | 9.29e-10 | 1.13e-09 | NA | NA |
5. P | A0QHI1 | Histidinol-phosphate aminotransferase | 1.37e-08 | 7.60e-07 | NA | NA |
5. P | Q3Z9B9 | Serine hydroxymethyltransferase | 1.61e-10 | 7.67e-09 | NA | NA |
5. P | Q0TG66 | Histidinol-phosphate aminotransferase | 4.67e-08 | 2.29e-09 | NA | NA |
5. P | Q31CS4 | Serine hydroxymethyltransferase | 6.49e-10 | 2.41e-07 | NA | NA |
5. P | A1SEM0 | Phosphoserine aminotransferase | 4.38e-08 | 3.88e-11 | NA | NA |
5. P | Q8R5U4 | Putative threonine-phosphate decarboxylase | 3.90e-13 | 2.18e-07 | NA | NA |
5. P | P37536 | Uncharacterized protein YaaO | 1.46e-05 | 4.83e-03 | NA | NA |
5. P | B7M1G0 | Succinylornithine transaminase | 3.51e-14 | 1.05e-02 | NA | NA |
5. P | Q7WFD2 | Serine hydroxymethyltransferase 2 | 6.98e-11 | 1.33e-07 | NA | NA |
5. P | A9H311 | Histidinol-phosphate aminotransferase | 1.33e-09 | 1.81e-10 | NA | NA |
5. P | P39623 | Spore coat polysaccharide biosynthesis protein SpsC | 1.55e-13 | 1.19e-04 | NA | NA |
5. P | Q8D253 | Serine hydroxymethyltransferase | 4.30e-10 | 4.60e-07 | NA | NA |
5. P | Q740R7 | 8-amino-7-oxononanoate synthase | 1.49e-14 | 1.37e-08 | NA | NA |
5. P | A5IJ65 | Serine hydroxymethyltransferase | 8.49e-10 | 6.51e-07 | NA | NA |
5. P | Q9ZHE5 | Histidinol-phosphate aminotransferase | 3.84e-07 | 1.90e-07 | NA | NA |
5. P | B0SMI6 | Serine hydroxymethyltransferase | 2.15e-10 | 3.10e-06 | NA | NA |
5. P | P21885 | Arginine decarboxylase | 2.43e-09 | 1.15e-03 | NA | NA |
5. P | C1CRE4 | Serine hydroxymethyltransferase | 5.38e-10 | 3.53e-08 | NA | NA |
5. P | Q06953 | GDP-perosamine synthase | 2.43e-13 | 9.38e-03 | NA | NA |
5. P | Q2JLL9 | LL-diaminopimelate aminotransferase | 2.51e-07 | 4.40e-05 | NA | NA |
5. P | Q48CS2 | 8-amino-7-oxononanoate synthase | 2.00e-15 | 1.93e-08 | NA | NA |
5. P | Q0HL93 | Serine hydroxymethyltransferase | 3.43e-10 | 2.90e-09 | NA | NA |
5. P | Q1I3N7 | 8-amino-7-oxononanoate synthase | 1.22e-15 | 6.32e-09 | NA | NA |
5. P | Q72C59 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.34e-10 | 2.97e-09 | NA | NA |
5. P | B3CTZ1 | Serine hydroxymethyltransferase | 6.83e-14 | 4.93e-06 | NA | NA |
5. P | A7FXT6 | L-seryl-tRNA(Sec) selenium transferase | 2.16e-06 | 1.75e-02 | NA | NA |
5. P | B2HQ90 | 8-amino-7-oxononanoate synthase | 2.04e-14 | 2.03e-07 | NA | NA |
5. P | A4YD91 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.35e-12 | 1.07e-02 | NA | NA |
5. P | B7HNN4 | Putative 8-amino-7-oxononanoate synthase | 1.13e-10 | 1.00e-06 | NA | NA |
5. P | B2U3D0 | Succinylornithine transaminase | 2.51e-14 | 6.98e-03 | NA | NA |
5. P | Q7MAR0 | Serine hydroxymethyltransferase | 2.91e-10 | 5.79e-06 | NA | NA |
5. P | B5QWJ0 | Succinylornithine transaminase | 2.68e-14 | 5.89e-03 | NA | NA |
5. P | Q831F9 | Serine hydroxymethyltransferase | 2.96e-10 | 2.10e-08 | NA | NA |
5. P | B1JPW1 | Histidinol-phosphate aminotransferase | 8.58e-08 | 7.04e-08 | NA | NA |
5. P | A7Z9Q9 | Serine hydroxymethyltransferase | 1.99e-10 | 8.13e-07 | NA | NA |
5. P | B6EHX0 | Serine hydroxymethyltransferase | 3.16e-10 | 5.95e-09 | NA | NA |
5. P | C0QQE4 | Serine hydroxymethyltransferase | 2.19e-10 | 6.80e-07 | NA | NA |
5. P | Q2T1Q2 | 8-amino-7-oxononanoate synthase | 1.12e-10 | 7.35e-07 | NA | NA |
5. P | A4JIB5 | 8-amino-7-oxononanoate synthase | 8.67e-11 | 2.14e-06 | NA | NA |
5. P | Q5SHZ8 | 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase | 5.63e-11 | 3.00e-09 | NA | NA |
5. P | A3DBD5 | Putative 8-amino-7-oxononanoate synthase | 9.99e-16 | 6.20e-08 | NA | NA |
5. P | W7MS09 | Sulfhydrylase FUB7 | 6.39e-08 | 2.29e-06 | NA | NA |
5. P | Q9KCA8 | Histidinol-phosphate aminotransferase | 6.26e-10 | 9.52e-08 | NA | NA |
5. P | Q2ST43 | Serine hydroxymethyltransferase | 3.65e-10 | 3.40e-09 | NA | NA |
5. P | A0QYS9 | Acetylornithine aminotransferase | 3.85e-14 | 4.25e-03 | NA | NA |
5. P | Q2G087 | Histidinol-phosphate aminotransferase | 2.26e-09 | 9.53e-09 | NA | NA |
5. P | A7N6R9 | CAI-1 autoinducer synthase | 1.85e-10 | 1.27e-08 | NA | NA |
5. P | B2UBJ3 | 8-amino-7-oxononanoate synthase | 6.69e-11 | 1.91e-08 | NA | NA |
5. P | P61736 | L-seryl-tRNA(Sec) selenium transferase | 1.97e-06 | 3.74e-03 | NA | NA |
5. P | Q8NYM5 | Ornithine aminotransferase 1 | 3.21e-14 | 7.92e-03 | NA | NA |
5. P | B5RPU9 | Serine hydroxymethyltransferase | 1.14e-09 | 6.05e-11 | NA | NA |
5. P | Q253K9 | LL-diaminopimelate aminotransferase | 1.74e-07 | 6.80e-08 | NA | NA |
5. P | Q3KLR8 | Serine hydroxymethyltransferase | 1.16e-09 | 1.67e-03 | NA | NA |
5. P | B5QZL3 | Histidinol-phosphate aminotransferase | 5.12e-08 | 1.17e-09 | NA | NA |
5. P | C3P3K3 | Ornithine aminotransferase | 4.87e-14 | 4.51e-02 | NA | NA |
5. P | B0UN04 | Histidinol-phosphate aminotransferase | 2.77e-13 | 5.27e-09 | NA | NA |
5. P | Q1D2L9 | Phosphoserine aminotransferase | 2.55e-14 | 2.49e-13 | NA | NA |
5. P | A4VI36 | Serine hydroxymethyltransferase | 2.31e-10 | 1.28e-06 | NA | NA |
5. P | P31015 | Tryptophanase 2 | 3.29e-07 | 2.42e-04 | NA | NA |
5. P | B4U9L1 | Histidinol-phosphate aminotransferase | 5.26e-10 | 1.03e-10 | NA | NA |
5. P | O67857 | Histidinol-phosphate aminotransferase | 2.72e-10 | 6.77e-10 | NA | NA |
5. P | Q2FIR7 | Histidinol-phosphate aminotransferase | 2.04e-09 | 9.53e-09 | NA | NA |
5. P | B1Y500 | 8-amino-7-oxononanoate synthase | 1.32e-10 | 3.58e-05 | NA | NA |
5. P | Q46Y48 | Histidinol-phosphate aminotransferase 1 | 7.17e-10 | 7.02e-04 | NA | NA |
5. P | A6WNN5 | Phosphoserine aminotransferase | 7.87e-14 | 6.02e-09 | NA | NA |
5. P | B6J495 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.62e-13 | 5.83e-03 | NA | NA |
5. P | P55218 | O-succinylhomoserine sulfhydrylase | 7.20e-09 | 5.98e-06 | NA | NA |
5. P | A9A3Y9 | Serine hydroxymethyltransferase | 1.11e-10 | 1.55e-10 | NA | NA |
5. P | Q1CGX0 | Histidinol-phosphate aminotransferase | 8.67e-08 | 1.76e-08 | NA | NA |
5. P | A1AWS0 | Phosphoserine aminotransferase | 6.67e-14 | 2.14e-10 | NA | NA |
5. P | Q9PK04 | LL-diaminopimelate aminotransferase | 1.22e-07 | 4.61e-09 | NA | NA |
5. P | O07566 | 3-oxo-glucose-6-phosphate:glutamate aminotransferase | 5.49e-08 | 4.14e-03 | NA | NA |
5. P | Q9K0U0 | Putative 8-amino-7-oxononanoate synthase | 5.57e-14 | 1.61e-05 | NA | NA |
5. P | B7M560 | Tryptophanase | 3.05e-06 | 2.61e-03 | NA | NA |
5. P | Q980U5 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.29e-12 | 3.15e-02 | NA | NA |
5. P | Q9CLM3 | Histidinol-phosphate aminotransferase 1 | 1.72e-09 | 2.20e-08 | NA | NA |
5. P | B8D1D5 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.23e-11 | 1.06e-07 | NA | NA |
5. P | Q9PIH3 | Phosphoserine aminotransferase | 1.02e-13 | 8.59e-11 | NA | NA |
5. P | Q0VMD1 | 8-amino-7-oxononanoate synthase | 1.22e-15 | 3.35e-07 | NA | NA |
5. P | C1ATZ5 | Histidinol-phosphate aminotransferase | 6.51e-09 | 3.71e-07 | NA | NA |
5. P | Q88A97 | 8-amino-7-oxononanoate synthase | 2.66e-15 | 1.67e-08 | NA | NA |
5. P | Q59928 | Acetylornithine aminotransferase | 5.22e-14 | 4.41e-03 | NA | NA |
5. P | B5EAW7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.22e-09 | 7.87e-10 | NA | NA |
5. P | Q3SK85 | Histidinol-phosphate aminotransferase 1 | 2.77e-09 | 4.86e-07 | NA | NA |
5. P | B7UFR5 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.16e-13 | 7.58e-04 | NA | NA |
5. P | B8J637 | 8-amino-7-oxononanoate synthase | 3.55e-15 | 5.02e-08 | NA | NA |
5. P | B0U328 | Glutamate-1-semialdehyde 2,1-aminomutase | 7.03e-13 | 3.65e-02 | NA | NA |
5. P | A6VXM6 | Serine hydroxymethyltransferase | 2.84e-10 | 5.95e-07 | NA | NA |
5. P | A5CWI0 | Phosphoserine aminotransferase | 9.51e-14 | 1.35e-08 | NA | NA |
5. P | B7LJY7 | 8-amino-7-oxononanoate synthase | 4.82e-11 | 5.88e-07 | NA | NA |
5. P | A8AJ11 | 8-amino-7-oxononanoate synthase | 2.54e-11 | 2.10e-07 | NA | NA |
5. P | Q56232 | Aspartate/prephenate aminotransferase | 1.31e-08 | 7.72e-06 | NA | NA |
5. P | A0L7X6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.90e-10 | 6.71e-09 | NA | NA |
5. P | P59321 | Acetylornithine/succinyldiaminopimelate aminotransferase | 1.15e-13 | 6.10e-03 | NA | NA |
5. P | P44423 | Histidinol-phosphate aminotransferase 1 | 2.65e-09 | 7.64e-08 | NA | NA |
5. P | Q3AN03 | Serine hydroxymethyltransferase | 7.13e-10 | 4.55e-07 | NA | NA |
5. P | P9WPZ6 | Acetylornithine aminotransferase | 8.30e-14 | 1.28e-02 | NA | NA |
5. P | B5ELF7 | 8-amino-7-oxononanoate synthase | 1.07e-10 | 5.09e-07 | NA | NA |
5. P | Q19QT7 | Cystathionine gamma-lyase | NA | 3.93e-05 | NA | NA |
5. P | Q8D5Q4 | Tryptophanase | 5.00e-07 | 3.23e-03 | NA | NA |
5. P | B3EH28 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 8.58e-11 | 1.26e-07 | NA | NA |
5. P | O30418 | Glutamate decarboxylase | 1.78e-15 | 1.56e-07 | NA | NA |
5. P | A7HDY8 | Serine hydroxymethyltransferase | 2.37e-10 | 2.08e-07 | NA | NA |
5. P | B0U4K9 | Serine hydroxymethyltransferase | 5.75e-10 | 6.02e-07 | NA | NA |
5. P | P12995 | Adenosylmethionine-8-amino-7-oxononanoate aminotransferase | 4.76e-12 | 3.18e-02 | NA | NA |
5. P | C4LAE6 | Serine hydroxymethyltransferase | 3.62e-10 | 2.26e-09 | NA | NA |
5. P | B9KPH4 | Histidinol-phosphate aminotransferase | 6.86e-14 | 4.02e-08 | NA | NA |
5. P | P9WML4 | Putative phenylalanine aminotransferase | 1.30e-13 | 2.99e-07 | NA | NA |
5. P | Q2SBD5 | 8-amino-7-oxononanoate synthase | 2.55e-15 | 1.61e-06 | NA | NA |
5. P | B7MYI0 | Serine hydroxymethyltransferase | 2.82e-10 | 1.69e-08 | NA | NA |
5. P | A1S4B5 | Serine hydroxymethyltransferase | 3.20e-10 | 2.10e-09 | NA | NA |
5. P | B7GHD3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.09e-11 | 2.41e-07 | NA | NA |
5. P | B9KZ44 | Serine hydroxymethyltransferase | 1.68e-10 | 2.66e-05 | NA | NA |
5. P | P15263 | Pleiotropic regulatory protein | 1.07e-09 | 3.24e-04 | NA | NA |
5. P | Q5R691 | Aspartate aminotransferase, cytoplasmic | 2.08e-06 | 1.08e-04 | NA | NA |
5. P | Q4K4P6 | Serine hydroxymethyltransferase 2 | 4.89e-10 | 1.53e-06 | NA | NA |
5. P | Q3AAT6 | Histidinol-phosphate aminotransferase 2 | 8.38e-10 | 6.73e-07 | NA | NA |
5. P | Q6GKC1 | Ornithine aminotransferase 1 | 3.26e-14 | 1.16e-02 | NA | NA |
5. P | A6V2Q8 | Phosphoserine aminotransferase | 8.64e-14 | 4.39e-09 | NA | NA |
5. P | Q5NFJ3 | Serine hydroxymethyltransferase | 4.10e-10 | 1.18e-06 | NA | NA |
5. P | C6BUK3 | LL-diaminopimelate aminotransferase | 1.69e-07 | 2.59e-04 | NA | NA |
5. P | C5CF44 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 7.92e-10 | 1.86e-07 | NA | NA |
5. P | Q9MB95 | 1-aminocyclopropane-1-carboxylate synthase 1 | 1.61e-05 | 3.23e-03 | NA | NA |
5. P | Q89LG2 | Acetylornithine aminotransferase 2 | 3.14e-14 | 3.26e-03 | NA | NA |
5. P | P69910 | Glutamate decarboxylase beta | 1.49e-10 | 5.63e-07 | NA | NA |
5. P | A1JTV9 | Histidinol-phosphate aminotransferase | 8.35e-08 | 3.52e-09 | NA | NA |
5. P | Q9L1A4 | Acetylornithine aminotransferase | 4.88e-14 | 9.63e-03 | NA | NA |
5. P | B6YS43 | Serine hydroxymethyltransferase | 2.32e-09 | 6.05e-08 | NA | NA |
5. P | Q9SVM4 | Serine hydroxymethyltransferase 5 | 1.76e-09 | 2.52e-02 | NA | NA |
5. P | A6LP69 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 1.01e-09 | 1.27e-07 | NA | NA |
5. P | A6LUK9 | Serine hydroxymethyltransferase | 1.61e-10 | 2.86e-07 | NA | NA |
5. P | Q9AAL3 | Acetylornithine aminotransferase 1 | 2.91e-14 | 7.77e-05 | NA | NA |
5. P | Q83QT9 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.05e-13 | 1.08e-03 | NA | NA |
5. P | Q97ES6 | Histidinol-phosphate aminotransferase | 7.41e-10 | 3.79e-10 | NA | NA |
5. P | Q2YR81 | Histidinol-phosphate aminotransferase | 1.23e-13 | 3.45e-08 | NA | NA |
5. P | A8GUH4 | Serine hydroxymethyltransferase | 4.75e-10 | 1.02e-07 | NA | NA |
5. P | Q1REF4 | 8-amino-7-oxononanoate synthase | 2.17e-11 | 1.72e-06 | NA | NA |
5. P | P67725 | Histidinol-phosphate aminotransferase | 2.18e-09 | 9.53e-09 | NA | NA |
5. P | Q8FBV2 | Tryptophanase | 4.30e-07 | 2.89e-03 | NA | NA |
5. P | Q98QM2 | Serine hydroxymethyltransferase | 2.30e-10 | 1.77e-09 | NA | NA |
5. P | P0A825 | Serine hydroxymethyltransferase | 2.68e-10 | 1.69e-08 | NA | NA |
5. P | Q01912 | 1-aminocyclopropane-1-carboxylate synthase (Fragment) | 1.52e-05 | 8.43e-05 | NA | NA |
5. P | B1YV30 | Phosphoserine aminotransferase | 7.47e-14 | 6.06e-12 | NA | NA |
5. P | C3L181 | Serine hydroxymethyltransferase | 1.52e-10 | 6.72e-08 | NA | NA |
5. P | B7MGN4 | 8-amino-7-oxononanoate synthase | 2.22e-11 | 1.72e-06 | NA | NA |
5. P | P57202 | Histidinol-phosphate aminotransferase | 2.64e-07 | 3.45e-08 | NA | NA |
5. P | A6GXG2 | Serine hydroxymethyltransferase | 1.43e-09 | 5.27e-09 | NA | NA |
5. P | Q131B9 | Histidinol-phosphate aminotransferase | 1.21e-13 | 1.32e-08 | NA | NA |
5. P | Q03W65 | Phosphoserine aminotransferase | 4.02e-14 | 1.68e-13 | NA | NA |
5. P | A0QC23 | Serine hydroxymethyltransferase | 3.83e-10 | 5.95e-09 | NA | NA |
5. P | P77806 | Methionine aminotransferase | 9.03e-10 | 7.77e-05 | NA | NA |
5. P | A7GSE1 | Putative 8-amino-7-oxononanoate synthase | 1.28e-10 | 1.41e-07 | NA | NA |
5. P | B1KF45 | Phosphoserine aminotransferase | 1.33e-13 | 1.01e-08 | NA | NA |
5. P | P28578 | Histidine decarboxylase | 4.72e-10 | 9.52e-11 | NA | NA |
5. P | Q6AL81 | LL-diaminopimelate aminotransferase | NA | 2.12e-05 | NA | NA |
5. P | Q22067 | Aspartate aminotransferase, cytoplasmic | 1.86e-06 | 5.11e-04 | NA | NA |
5. P | Q9A3Q9 | Omega-aminotransferase | 1.99e-12 | 8.97e-03 | NA | NA |
5. P | Q8R9K5 | Tryptophanase | 1.65e-08 | 6.55e-05 | NA | NA |
5. P | A1T8U6 | 8-amino-7-oxononanoate synthase | 1.87e-14 | 1.63e-08 | NA | NA |
5. P | B5FQ49 | Phosphoserine aminotransferase | 2.82e-14 | 5.20e-10 | NA | NA |
5. P | Q8EEB1 | 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase | 4.99e-09 | 5.37e-04 | NA | NA |
5. P | P34898 | Serine hydroxymethyltransferase, cytosolic | 9.67e-07 | 4.36e-05 | NA | NA |
5. P | B8H4V4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.55e-10 | 1.24e-08 | NA | NA |
5. P | Q3SGX5 | Serine hydroxymethyltransferase | 1.44e-10 | 1.47e-08 | NA | NA |
5. P | Q8ZQQ7 | 8-amino-7-oxononanoate synthase | 6.15e-11 | 3.06e-07 | NA | NA |
5. P | Q9HTF1 | Low specificity L-threonine aldolase | 1.49e-12 | 8.21e-13 | NA | NA |
5. P | A0KB03 | 8-amino-7-oxononanoate synthase | 1.03e-10 | 2.63e-08 | NA | NA |
5. P | A8LK96 | Histidinol-phosphate aminotransferase | 1.71e-13 | 5.78e-08 | NA | NA |
5. P | Q9LGZ2 | Putative L-cysteine desulfhydrase 1 | 0.00e+00 | 3.22e-12 | NA | NA |
5. P | Q5HWF4 | Histidinol-phosphate aminotransferase | 7.70e-10 | 3.37e-08 | NA | NA |
5. P | Q7N8C9 | Tryptophanase | 3.08e-07 | 4.05e-05 | NA | NA |
5. P | P28011 | Aspartate aminotransferase 1 | 1.32e-06 | 5.38e-03 | NA | NA |
5. P | Q3ZXC8 | LL-diaminopimelate aminotransferase | 1.92e-07 | 2.29e-06 | NA | NA |
5. P | A7MJ02 | 8-amino-7-oxononanoate synthase | 5.25e-11 | 1.35e-07 | NA | NA |
5. P | Q68W07 | Serine hydroxymethyltransferase | 3.42e-10 | 2.19e-06 | NA | NA |
5. P | Q8DSV3 | Phosphoserine aminotransferase | 5.22e-15 | 1.16e-10 | NA | NA |
5. P | Q83PR1 | Glutamate decarboxylase alpha | 1.28e-10 | 2.64e-06 | NA | NA |
5. P | Q8EFB2 | Histidinol-phosphate aminotransferase | 1.24e-06 | 3.62e-02 | NA | NA |
5. P | P9WML5 | Putative phenylalanine aminotransferase | 1.57e-13 | 2.99e-07 | NA | NA |
5. P | Q1R8I4 | Serine hydroxymethyltransferase | 2.86e-10 | 1.69e-08 | NA | NA |
5. P | B3GYP5 | L-seryl-tRNA(Sec) selenium transferase | 1.15e-05 | 4.71e-02 | NA | NA |
5. P | A5GWH2 | Serine hydroxymethyltransferase | 3.98e-10 | 4.24e-06 | NA | NA |
5. P | B7J439 | Serine hydroxymethyltransferase | 3.52e-10 | 2.97e-09 | NA | NA |
5. P | A6L5A6 | Phosphoserine aminotransferase | 8.41e-13 | 1.74e-10 | NA | NA |
5. P | B8J189 | Serine hydroxymethyltransferase | 2.14e-10 | 2.58e-07 | NA | NA |
5. P | Q4QLD1 | Histidinol-phosphate aminotransferase 2 | 3.37e-10 | 5.60e-06 | NA | NA |
5. P | Q5NZF5 | 8-amino-7-oxononanoate synthase | 5.54e-11 | 4.61e-09 | NA | NA |
5. P | P9WQ86 | 8-amino-7-oxononanoate synthase 1 | 2.08e-14 | 1.90e-07 | NA | NA |
5. P | Q65ML1 | Putative 8-amino-7-oxononanoate synthase | 4.61e-11 | 9.86e-08 | NA | NA |
5. P | Q5X722 | Serine hydroxymethyltransferase | 4.64e-10 | 1.46e-07 | NA | NA |
5. P | Q2JT50 | Serine hydroxymethyltransferase | 8.95e-10 | 4.98e-06 | NA | NA |
5. P | Q03EK4 | Serine hydroxymethyltransferase | 2.74e-10 | 9.31e-08 | NA | NA |
5. P | Q8R5Q4 | Histidinol-phosphate aminotransferase | 6.23e-14 | 4.84e-09 | NA | NA |
5. P | Q0SYP7 | Tryptophanase | 4.16e-07 | 2.61e-03 | NA | NA |
5. P | Q9W3Z3 | Alanine--glyoxylate aminotransferase | 0.00e+00 | 4.34e-13 | NA | NA |
5. P | Q31YK4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.03e-13 | 1.02e-03 | NA | NA |
5. P | Q6GCU1 | Ornithine aminotransferase 1 | 3.29e-14 | 7.92e-03 | NA | NA |
5. P | P54767 | Glutamate decarboxylase | 1.22e-15 | 7.27e-07 | NA | NA |
5. P | A1ADA5 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.04e-13 | 1.23e-03 | NA | NA |
5. P | Q7WDN7 | Acetylornithine aminotransferase 2 | 6.47e-14 | 9.63e-03 | NA | NA |
5. P | B6I848 | Histidinol-phosphate aminotransferase | 6.81e-08 | 1.54e-09 | NA | NA |
5. P | B7IQW9 | Serine hydroxymethyltransferase | 2.09e-10 | 4.52e-08 | NA | NA |
5. P | Q4A0N2 | Ornithine aminotransferase 1 | 4.46e-14 | 9.98e-04 | NA | NA |
5. P | B4SZJ8 | 8-amino-7-oxononanoate synthase | 1.96e-11 | 1.75e-07 | NA | NA |
5. P | Q1QE01 | Serine hydroxymethyltransferase | 7.07e-10 | 1.32e-05 | NA | NA |
5. P | A5GIN1 | LL-diaminopimelate aminotransferase | 3.94e-07 | 3.32e-03 | NA | NA |
5. P | Q56581 | Histidine decarboxylase | 3.87e-10 | 4.09e-10 | NA | NA |
5. P | Q47XG4 | Serine hydroxymethyltransferase 3 | 4.97e-10 | 2.03e-07 | NA | NA |
5. P | B8DFX9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.31e-08 | 2.21e-06 | NA | NA |
5. P | P61005 | Putative phenylalanine aminotransferase | 1.02e-13 | 2.57e-08 | NA | NA |
5. P | P28734 | Aspartate aminotransferase, cytoplasmic | 1.23e-06 | 6.76e-04 | NA | NA |
5. P | Q39J72 | Serine hydroxymethyltransferase 3 | 1.46e-10 | 1.01e-08 | NA | NA |
5. P | Q8RLW0 | Phosphoserine aminotransferase | 6.29e-14 | 1.25e-11 | NA | NA |
5. P | A9R3C9 | 8-amino-7-oxononanoate synthase | 3.50e-11 | 1.31e-06 | NA | NA |
5. P | Q7VIJ3 | Histidinol-phosphate aminotransferase | 1.09e-09 | 6.20e-08 | NA | NA |
5. P | A8GPR4 | Serine hydroxymethyltransferase | 4.95e-10 | 1.00e-06 | NA | NA |
5. P | Q6YR37 | Serine hydroxymethyltransferase | 3.80e-10 | 1.58e-09 | NA | NA |
5. P | A2S7R1 | 8-amino-7-oxononanoate synthase | 1.09e-10 | 1.86e-07 | NA | NA |
5. P | Q7VTJ7 | Acetylornithine aminotransferase 1 | 1.67e-13 | 9.43e-04 | NA | NA |
5. P | A5IGI2 | Serine hydroxymethyltransferase | 4.76e-10 | 3.88e-07 | NA | NA |
5. P | Q9HY65 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.85e-13 | 9.21e-03 | NA | NA |
5. P | A8EZU3 | Serine hydroxymethyltransferase | 5.82e-10 | 3.17e-07 | NA | NA |
5. P | B7I5D6 | Phosphoserine aminotransferase | 6.94e-14 | 4.36e-10 | NA | NA |
5. P | O26330 | Glutamate-1-semialdehyde 2,1-aminomutase | 1.88e-13 | 2.61e-02 | NA | NA |
5. P | Q2YAU6 | Histidinol-phosphate aminotransferase 1 | 1.60e-09 | 1.14e-08 | NA | NA |
5. P | Q1BT36 | 8-amino-7-oxononanoate synthase | 1.04e-10 | 2.63e-08 | NA | NA |
5. P | Q58DW2 | Cystathionine gamma-lyase | 5.90e-09 | 1.23e-04 | NA | NA |
5. P | Q0UIN2 | Kynureninase 1 | 1.35e-13 | 7.25e-13 | NA | NA |
5. P | B7GZR6 | Serine hydroxymethyltransferase | 6.85e-10 | 8.86e-06 | NA | NA |
5. P | A0RMN9 | Histidinol-phosphate aminotransferase | 1.52e-09 | 8.29e-08 | NA | NA |
5. P | Q2YUJ1 | Serine hydroxymethyltransferase | 1.87e-10 | 1.84e-06 | NA | NA |
5. P | B1JRX7 | Serine hydroxymethyltransferase | 2.93e-10 | 3.07e-08 | NA | NA |
5. P | A7I3S9 | Serine hydroxymethyltransferase | 2.64e-10 | 1.82e-06 | NA | NA |
5. P | A8AY31 | Histidinol-phosphate aminotransferase | 9.65e-10 | 6.86e-10 | NA | NA |
5. P | Q6MDE0 | LL-diaminopimelate aminotransferase | 9.21e-08 | 3.10e-08 | NA | NA |
5. P | P66803 | Serine hydroxymethyltransferase | 1.63e-10 | 1.44e-06 | NA | NA |
5. P | Q492K2 | Histidinol-phosphate aminotransferase | 5.53e-08 | 1.60e-09 | NA | NA |
5. P | A0KWN5 | Phosphoserine aminotransferase | 9.97e-08 | 1.33e-07 | NA | NA |
5. P | A9BGL0 | 8-amino-7-oxononanoate synthase | 9.81e-11 | 2.96e-07 | NA | NA |
5. P | A2RIS2 | Phosphoserine aminotransferase | 1.13e-14 | 1.88e-11 | NA | NA |
5. P | B0TI64 | Serine hydroxymethyltransferase | 2.92e-10 | 9.30e-09 | NA | NA |
5. P | Q5SI56 | Serine hydroxymethyltransferase | 3.00e-10 | 4.50e-09 | NA | NA |
5. P | B5YFZ0 | Serine hydroxymethyltransferase | 1.26e-10 | 1.51e-06 | NA | NA |
5. P | B0KQJ6 | Histidinol-phosphate aminotransferase | 8.01e-08 | 2.45e-08 | NA | NA |
5. P | Q5HAJ7 | Serine hydroxymethyltransferase | 2.96e-10 | 2.14e-06 | NA | NA |
5. P | Q8KD01 | Histidinol-phosphate aminotransferase | 3.32e-13 | 6.77e-10 | NA | NA |
5. P | Q5LPA8 | Serine hydroxymethyltransferase | 6.33e-10 | 1.81e-07 | NA | NA |
5. P | Q8YMW8 | Serine hydroxymethyltransferase | 8.88e-10 | 8.14e-06 | NA | NA |
5. P | Q3MAX6 | Histidinol-phosphate aminotransferase 2 | 9.60e-13 | 2.62e-09 | NA | NA |
5. P | Q61JN8 | O-phosphoseryl-tRNA(Sec) selenium transferase | 1.32e-06 | 2.86e-04 | NA | NA |
5. P | A1JKP3 | Serine hydroxymethyltransferase | 3.42e-10 | 1.07e-07 | NA | NA |
5. P | A4SMP7 | Histidinol-phosphate aminotransferase | 2.62e-09 | 1.98e-08 | NA | NA |
5. P | A1AE82 | Serine hydroxymethyltransferase | 2.78e-10 | 1.69e-08 | NA | NA |
5. P | Q9I138 | Serine hydroxymethyltransferase 2 | 4.37e-10 | 1.51e-07 | NA | NA |
5. P | P36839 | Acetylornithine aminotransferase | 3.92e-14 | 9.38e-03 | NA | NA |
5. P | A9MHX6 | Phosphoserine aminotransferase | 6.02e-14 | 1.10e-09 | NA | NA |
5. P | Q8TUE8 | Acetylornithine aminotransferase | 6.00e-10 | 6.74e-03 | NA | NA |
5. P | Q08897 | Tyrosine phenol-lyase | 5.07e-07 | 5.40e-05 | NA | NA |
5. P | B5EX40 | Histidinol-phosphate aminotransferase | 2.01e-09 | 1.17e-09 | NA | NA |
5. P | B8EA90 | Phosphoserine aminotransferase | 1.66e-09 | 1.76e-08 | NA | NA |
5. P | Q4UZN9 | 8-amino-7-oxononanoate synthase | 4.38e-11 | 4.96e-08 | NA | NA |
5. P | Q8PCN4 | Serine hydroxymethyltransferase | 4.96e-10 | 1.30e-07 | NA | NA |
5. P | A9AA73 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 1.67e-15 | 8.76e-24 | NA | NA |
5. P | C3PLL9 | Serine hydroxymethyltransferase | 4.40e-10 | 6.37e-06 | NA | NA |
5. P | B0KC20 | 8-amino-7-oxononanoate synthase | 2.89e-15 | 2.03e-07 | NA | NA |
5. P | A8FKA6 | Histidinol-phosphate aminotransferase | 6.94e-10 | 6.24e-09 | NA | NA |
5. P | P55900 | Phosphoserine aminotransferase | 5.56e-14 | 8.28e-10 | NA | NA |
5. P | P63499 | Alanine aminotransferase | 1.21e-07 | 1.40e-04 | NA | NA |
5. P | B9M384 | LL-diaminopimelate aminotransferase | 2.29e-07 | 7.80e-04 | NA | NA |
5. P | Q3AMU5 | LL-diaminopimelate aminotransferase | 4.02e-07 | 9.17e-04 | NA | NA |
5. P | Q2Y9Y8 | 8-amino-7-oxononanoate synthase | 9.80e-11 | 1.82e-06 | NA | NA |
5. P | Q8XA55 | Serine hydroxymethyltransferase | 2.67e-10 | 4.52e-08 | NA | NA |
5. P | B8I5V1 | Histidinol-phosphate aminotransferase | 2.41e-09 | 5.53e-09 | NA | NA |
5. P | A5FEF4 | Serine hydroxymethyltransferase | 1.12e-09 | 2.89e-08 | NA | NA |
5. P | Q3JWR6 | 8-amino-7-oxononanoate synthase | 1.38e-10 | 1.41e-07 | NA | NA |
5. P | A3CN08 | Serine hydroxymethyltransferase | 7.31e-10 | 4.75e-07 | NA | NA |
5. P | B4TBG4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 7.82e-14 | 9.89e-04 | NA | NA |
5. P | Q9X794 | Serine hydroxymethyltransferase | 3.30e-10 | 4.81e-07 | NA | NA |
5. P | P07172 | Histidinol-phosphate aminotransferase | 2.55e-07 | 2.33e-08 | NA | NA |
5. P | A0AIF0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.53e-08 | 1.88e-06 | NA | NA |
5. P | P09053 | Valine--pyruvate aminotransferase | 1.05e-07 | 2.98e-13 | NA | NA |
5. P | Q5F6R6 | Putative 8-amino-7-oxononanoate synthase | 5.05e-14 | 2.07e-05 | NA | NA |
5. P | B1MFC0 | Putative phenylalanine aminotransferase | 9.16e-14 | 1.35e-07 | NA | NA |
5. P | Q3JW89 | Histidinol-phosphate aminotransferase 1 | 1.31e-09 | 1.68e-09 | NA | NA |
5. P | Q6ALW3 | Phosphoserine aminotransferase | 5.50e-14 | 2.72e-11 | NA | NA |
5. P | A4Y966 | Serine hydroxymethyltransferase | 3.37e-10 | 1.64e-09 | NA | NA |
5. P | Q2ILI1 | Serine hydroxymethyltransferase | 2.41e-10 | 5.20e-08 | NA | NA |
5. P | Q39K90 | Histidinol-phosphate aminotransferase 1 | 1.26e-09 | 1.47e-08 | NA | NA |
5. P | Q2IF62 | 8-amino-7-oxononanoate synthase | 3.33e-15 | 5.39e-08 | NA | NA |
5. P | Q47C04 | 8-amino-7-oxononanoate synthase | 3.26e-11 | 8.78e-08 | NA | NA |
5. P | A8GHZ4 | Serine hydroxymethyltransferase | 3.14e-10 | 2.63e-08 | NA | NA |
5. P | Q65RB2 | Histidinol-phosphate aminotransferase 2 | 1.02e-08 | 1.59e-10 | NA | NA |
5. P | Q8FHG5 | Glutamate decarboxylase beta | 1.27e-10 | 1.74e-06 | NA | NA |
5. P | C1CKA2 | Serine hydroxymethyltransferase | 5.47e-10 | 3.83e-08 | NA | NA |
5. P | P46646 | Aspartate aminotransferase, cytoplasmic isozyme 2 | 9.00e-07 | 1.31e-04 | NA | NA |
5. P | A9KSH6 | Serine hydroxymethyltransferase | 1.04e-10 | 2.64e-06 | NA | NA |
5. P | Q0S6R3 | Phosphoserine aminotransferase | 3.42e-08 | 3.38e-10 | NA | NA |
5. P | P43623 | Putative cystathionine beta-lyase | 2.17e-05 | 5.58e-03 | NA | NA |
5. P | Q5WF31 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.77e-08 | 1.35e-07 | NA | NA |
5. P | Q8K9P0 | Adenosylmethionine-8-amino-7-oxononanoate aminotransferase | 2.72e-12 | 1.29e-03 | NA | NA |
5. P | Q1C946 | 8-amino-7-oxononanoate synthase | 3.54e-11 | 1.31e-06 | NA | NA |
5. P | Q8E3Y3 | Phosphoserine aminotransferase | 5.33e-15 | 3.83e-11 | NA | NA |
5. P | A5V9T6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.29e-10 | 2.31e-08 | NA | NA |
5. P | A6TFA0 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.82e-13 | 2.47e-03 | NA | NA |
5. P | Q8UI71 | Acetylornithine aminotransferase | 1.93e-14 | 9.61e-04 | NA | NA |
5. P | P39643 | Transaminase BacF | 1.43e-07 | 1.34e-06 | NA | NA |
5. P | B1XKF6 | LL-diaminopimelate aminotransferase | 1.71e-07 | 2.03e-04 | NA | NA |
5. P | B2GBS2 | Phosphoserine aminotransferase | 3.32e-13 | 1.27e-12 | NA | NA |
5. P | A1USI0 | Serine hydroxymethyltransferase | 2.40e-10 | 2.73e-07 | NA | NA |
5. P | A9N7V7 | Phosphoserine aminotransferase | 2.83e-14 | 5.20e-10 | NA | NA |
5. P | Q6G3L3 | Serine hydroxymethyltransferase | 3.62e-10 | 5.32e-07 | NA | NA |
5. P | A4SJN4 | Serine hydroxymethyltransferase | 3.79e-10 | 1.43e-09 | NA | NA |
5. P | C4K3B1 | Phosphoserine aminotransferase | 8.28e-14 | 4.58e-10 | NA | NA |
5. P | Q9ZPS3 | Glutamate decarboxylase 4 | 1.11e-15 | 6.75e-05 | NA | NA |
5. P | A3Q635 | Putative phosphoserine aminotransferase | 5.33e-10 | 1.57e-10 | NA | NA |
5. P | Q42881 | 1-aminocyclopropane-1-carboxylate synthase 3 | 3.01e-05 | 2.28e-05 | NA | NA |
5. P | B1XL23 | Putative 8-amino-7-oxononanoate synthase | 5.00e-15 | 1.01e-06 | NA | NA |
5. P | Q081U0 | Phosphoserine aminotransferase | 2.09e-13 | 2.23e-08 | NA | NA |
5. P | Q9HD40 | O-phosphoseryl-tRNA(Sec) selenium transferase | 5.08e-07 | 1.91e-04 | NA | NA |
5. P | A4QFG6 | Histidinol-phosphate aminotransferase | 5.21e-09 | 3.01e-05 | NA | NA |
5. P | Q98A07 | Histidine decarboxylase | 1.40e-10 | 1.13e-07 | NA | NA |
5. P | Q8D8N0 | 8-amino-7-oxononanoate synthase | 5.89e-11 | 1.29e-08 | NA | NA |
5. P | B7LUF2 | Histidinol-phosphate aminotransferase | 4.60e-08 | 1.23e-09 | NA | NA |
5. P | Q6D2E9 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.27e-13 | 1.17e-02 | NA | NA |
5. P | Q8Y0Y8 | Histidinol-phosphate aminotransferase 2 | 7.74e-10 | 1.38e-07 | NA | NA |
5. P | O14192 | Aromatic amino acid aminotransferase C56E4.03 | 2.70e-06 | 2.83e-05 | NA | NA |
5. P | Q02PX3 | Phosphoserine aminotransferase | 5.20e-14 | 8.92e-10 | NA | NA |
5. P | Q814V2 | Serine hydroxymethyltransferase | 2.25e-10 | 6.65e-08 | NA | NA |
5. P | Q88UT5 | Serine hydroxymethyltransferase | 2.70e-10 | 7.03e-07 | NA | NA |
5. P | P97084 | Threonine-phosphate decarboxylase | 5.96e-10 | 3.73e-06 | NA | NA |
5. P | B4RFX5 | Putative 8-amino-7-oxononanoate synthase | 1.08e-10 | 1.67e-06 | NA | NA |
5. P | A1TGS6 | Putative phenylalanine aminotransferase | 7.54e-14 | 1.07e-08 | NA | NA |
5. P | Q5M4W1 | Serine hydroxymethyltransferase | 4.99e-10 | 6.05e-08 | NA | NA |
5. P | B4S5J4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.96e-11 | 8.50e-07 | NA | NA |
5. P | Q9F5P3 | Glutamate decarboxylase alpha | 2.11e-15 | 1.78e-08 | NA | NA |
5. P | O42851 | Uncharacterized trans-sulfuration enzyme C23A1.14c | 5.95e-08 | 1.38e-08 | NA | NA |
5. P | Q7NYI8 | Serine hydroxymethyltransferase | 8.38e-11 | 5.64e-08 | NA | NA |
5. P | A8FIC1 | Serine hydroxymethyltransferase | 2.40e-10 | 9.14e-06 | NA | NA |
5. P | O07674 | Tryptophanase | 4.32e-07 | 7.24e-05 | NA | NA |
5. P | Q6MS85 | Serine hydroxymethyltransferase | 3.42e-10 | 1.05e-08 | NA | NA |
5. P | A5EYI0 | Tryptophanase | 4.72e-07 | 3.62e-02 | NA | NA |
5. P | Q1LS75 | 8-amino-7-oxononanoate synthase | 8.03e-11 | 1.41e-07 | NA | NA |
5. P | Q4UJV4 | 5-aminolevulinate synthase | 3.33e-11 | 5.09e-07 | NA | NA |
5. P | B2S0U9 | Serine hydroxymethyltransferase | 1.35e-09 | 1.03e-10 | NA | NA |
5. P | Q3Z3L5 | Phosphoserine aminotransferase | 7.09e-14 | 7.49e-10 | NA | NA |
5. P | Q9F837 | dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase | 1.20e-09 | 1.46e-03 | NA | NA |
5. P | B0U6J0 | 8-amino-7-oxononanoate synthase | 2.85e-11 | 4.91e-08 | NA | NA |
5. P | Q0AMJ2 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 9.08e-09 | 1.26e-08 | NA | NA |
5. P | P46807 | Cystathionine gamma-synthase | 1.42e-08 | 3.07e-05 | NA | NA |
5. P | Q7V4Z3 | LL-diaminopimelate aminotransferase | 3.18e-07 | 4.14e-04 | NA | NA |
5. P | Q2YSI3 | Histidinol-phosphate aminotransferase | 2.02e-09 | 8.76e-09 | NA | NA |
5. P | A1VEK5 | Serine hydroxymethyltransferase | 2.39e-10 | 3.35e-07 | NA | NA |
5. P | B4UIM7 | Serine hydroxymethyltransferase | 2.72e-10 | 7.91e-08 | NA | NA |
5. P | A9BDM9 | Serine hydroxymethyltransferase | 3.57e-10 | 2.64e-07 | NA | NA |
5. P | O14209 | Uncharacterized aminotransferase C6B12.04c | 3.62e-08 | 1.85e-02 | NA | NA |
5. P | P0A854 | Tryptophanase | 4.24e-07 | 2.61e-03 | NA | NA |
5. P | O51547 | Serine hydroxymethyltransferase | 1.47e-09 | 7.03e-10 | NA | NA |
5. P | B5Z9V7 | Serine hydroxymethyltransferase | 2.28e-10 | 4.20e-07 | NA | NA |
5. P | Q927V4 | Serine hydroxymethyltransferase | 2.86e-10 | 4.49e-07 | NA | NA |
5. P | Q7MAE6 | Acetylornithine aminotransferase | 4.20e-13 | 1.47e-02 | NA | NA |
5. P | Q9YBY6 | Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase | 2.78e-14 | 2.34e-03 | NA | NA |
5. P | A1A918 | 8-amino-7-oxononanoate synthase | 2.68e-11 | 1.72e-06 | NA | NA |
5. P | P44336 | Phosphoserine aminotransferase | 6.03e-10 | 5.67e-11 | NA | NA |
5. P | C1FN41 | Histidinol-phosphate aminotransferase | 4.63e-14 | 5.89e-11 | NA | NA |
5. P | Q48ED0 | Histidinol-phosphate aminotransferase | 1.52e-09 | 2.57e-08 | NA | NA |
5. P | Q4R5L1 | Aspartate aminotransferase, cytoplasmic | 1.67e-06 | 2.97e-04 | NA | NA |
5. P | Q1QQD5 | Histidinol-phosphate aminotransferase | 1.73e-13 | 1.35e-08 | NA | NA |
5. P | A4W0W9 | Serine hydroxymethyltransferase | 5.64e-10 | 4.63e-08 | NA | NA |
5. P | Q8NTR2 | Aspartate aminotransferase | 7.74e-06 | 1.98e-09 | NA | NA |
5. P | B6ESC6 | 8-amino-7-oxononanoate synthase | 6.49e-11 | 2.28e-07 | NA | NA |
5. P | P9WGB4 | O-succinylhomoserine sulfhydrylase | 1.95e-08 | 2.24e-04 | NA | NA |
5. P | Q6LZM9 | O-phosphoseryl-tRNA(Sec) selenium transferase | 1.04e-07 | 7.16e-04 | NA | NA |
5. P | Q9ALN9 | dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase | 5.99e-10 | 9.30e-03 | NA | NA |
5. P | A6U3J8 | Serine hydroxymethyltransferase | 1.90e-10 | 1.44e-06 | NA | NA |
5. P | Q8PZQ0 | Serine hydroxymethyltransferase | 4.00e-10 | 4.47e-06 | NA | NA |
5. P | B1VZY7 | Serine hydroxymethyltransferase | 1.10e-10 | 5.45e-11 | NA | NA |
5. P | A9IVC5 | Serine hydroxymethyltransferase | 3.26e-10 | 1.27e-05 | NA | NA |
5. P | Q5E6F2 | Phosphoserine aminotransferase | 5.34e-14 | 2.15e-09 | NA | NA |
5. P | B7NNK6 | 8-amino-7-oxononanoate synthase | 2.61e-11 | 1.28e-05 | NA | NA |
5. P | Q5N4R3 | Histidinol-phosphate aminotransferase | 1.19e-12 | 3.06e-10 | NA | NA |
5. P | Q6L733 | Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase | 7.05e-09 | 2.23e-03 | NA | NA |
5. P | Q609W4 | Histidinol-phosphate aminotransferase 1 | 1.96e-08 | 6.52e-10 | NA | NA |
5. P | Q81M07 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.94e-08 | 7.32e-06 | NA | NA |
5. P | A0R2V7 | Serine hydroxymethyltransferase | 1.72e-06 | 1.25e-04 | NA | NA |
5. P | B5FDA0 | Histidinol-phosphate aminotransferase | 1.28e-09 | 6.89e-11 | NA | NA |
5. P | C1DRQ9 | Phosphoserine aminotransferase | 5.90e-14 | 3.35e-09 | NA | NA |
5. P | A4VR87 | 8-amino-7-oxononanoate synthase | 1.78e-15 | 3.52e-09 | NA | NA |
5. P | Q63DL4 | Histidinol-phosphate aminotransferase 1 | 1.28e-09 | 2.18e-07 | NA | NA |
5. P | Q8XEA7 | Phosphoserine aminotransferase | 3.93e-14 | 1.70e-09 | NA | NA |
5. P | Q4ZNH2 | Serine hydroxymethyltransferase 1 | 2.66e-10 | 2.67e-07 | NA | NA |
5. P | Q5JNT6 | Putative L-cysteine desulfhydrase 2 | 0.00e+00 | 8.81e-15 | NA | NA |
5. P | Q84I51 | Histidinol-phosphate aminotransferase | 3.73e-09 | 3.45e-08 | NA | NA |
5. P | B2RID6 | Phosphoserine aminotransferase | 1.33e-13 | 5.45e-11 | NA | NA |
5. P | Q8DH33 | Serine hydroxymethyltransferase | 6.56e-10 | 8.13e-07 | NA | NA |
5. P | Q49W96 | Ornithine aminotransferase 2 | 3.42e-14 | 2.61e-03 | NA | NA |
5. P | A9ADV9 | Phosphoserine aminotransferase | 8.88e-14 | 1.37e-11 | NA | NA |
5. P | Q6Q887 | Probable aminotransferase sirI | 3.02e-06 | 1.87e-03 | NA | NA |
5. P | O28277 | Histidinol-phosphate aminotransferase 1 | 5.58e-14 | 2.55e-12 | NA | NA |
5. P | A9MHI3 | Serine hydroxymethyltransferase | 2.67e-10 | 8.38e-08 | NA | NA |
5. P | A0A3S7WQS5 | O-phosphoseryl-tRNA(Sec) selenium transferase | 2.25e-04 | 9.95e-06 | NA | NA |
5. P | Q1C5G0 | Serine hydroxymethyltransferase | 3.70e-10 | 3.07e-08 | NA | NA |
5. P | A7FJH1 | Histidinol-phosphate aminotransferase | 8.71e-08 | 8.29e-08 | NA | NA |
5. P | B6IYQ0 | Histidinol-phosphate aminotransferase | 8.58e-14 | 7.38e-08 | NA | NA |
5. P | Q928R9 | Glutamate decarboxylase beta | 1.67e-15 | 3.88e-07 | NA | NA |
5. P | Q89AK6 | 8-amino-7-oxononanoate synthase | 7.32e-11 | 1.24e-06 | NA | NA |
5. P | Q12F38 | 8-amino-7-oxononanoate synthase 1 | 5.44e-15 | 1.95e-08 | NA | NA |
5. P | Q0I3R5 | Tryptophanase | 4.17e-07 | 3.57e-04 | NA | NA |
5. P | B8FP20 | Histidinol-phosphate aminotransferase | 1.08e-09 | 6.34e-08 | NA | NA |
5. P | B7N212 | Tryptophanase | 4.54e-07 | 2.61e-03 | NA | NA |
5. P | B1L5K9 | Serine hydroxymethyltransferase | 3.23e-10 | 1.54e-09 | NA | NA |
5. P | A9WI58 | Serine hydroxymethyltransferase | 2.55e-10 | 4.92e-07 | NA | NA |
5. P | P59319 | Acetylornithine aminotransferase | 3.12e-14 | 3.74e-03 | NA | NA |
5. P | Q6MLK1 | Serine hydroxymethyltransferase | 3.20e-10 | 5.32e-07 | NA | NA |
5. P | A4G060 | Probable L-tyrosine/L-aspartate decarboxylase | 1.44e-12 | 3.14e-10 | NA | NA |
5. P | P08262 | 5-aminolevulinate synthase | 1.84e-11 | 1.36e-09 | NA | NA |
5. P | A7GSN7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.03e-08 | 1.47e-05 | NA | NA |
5. P | Q42521 | Glutamate decarboxylase 1 | 1.44e-15 | 2.72e-06 | NA | NA |
5. P | Q04KR0 | Serine hydroxymethyltransferase | 5.59e-10 | 3.83e-08 | NA | NA |
5. P | Q0C348 | Histidinol-phosphate aminotransferase | 3.02e-14 | 4.96e-08 | NA | NA |
5. P | Q2KV15 | Serine hydroxymethyltransferase | 8.01e-11 | 1.17e-07 | NA | NA |
5. P | Q2W4T2 | Serine hydroxymethyltransferase | 5.74e-10 | 6.88e-07 | NA | NA |
5. P | Q39XE0 | 8-amino-7-oxononanoate synthase | 1.33e-15 | 1.30e-07 | NA | NA |
5. P | Q8Y6U4 | Acetylornithine aminotransferase | 2.36e-14 | 5.11e-04 | NA | NA |
5. P | Q48TK6 | Serine hydroxymethyltransferase | 5.17e-10 | 6.29e-07 | NA | NA |
5. P | B7NNT2 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.00e-13 | 1.93e-03 | NA | NA |
5. P | B9K6R4 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 7.52e-07 | 4.79e-08 | NA | NA |
5. P | Q88P86 | Histidinol-phosphate aminotransferase | 8.64e-08 | 6.88e-08 | NA | NA |
5. P | Q8XV80 | Histidinol-phosphate aminotransferase 1 | 4.27e-08 | 1.81e-07 | NA | NA |
5. P | A5V022 | Histidinol-phosphate aminotransferase | 6.37e-10 | 1.48e-06 | NA | NA |
5. P | A9A0A5 | Phosphoserine aminotransferase | 2.79e-13 | 4.72e-13 | NA | NA |
5. P | Q46A52 | Serine hydroxymethyltransferase | 4.64e-10 | 7.91e-08 | NA | NA |
5. P | A7MX17 | Histidinol-phosphate aminotransferase | 1.41e-09 | 1.23e-10 | NA | NA |
5. P | Q7RT90 | Ornithine aminotransferase | 3.07e-10 | 5.48e-03 | NA | NA |
5. P | Q8PX16 | Acetylornithine aminotransferase | 6.16e-10 | 2.29e-02 | NA | NA |
5. P | Q9KDM4 | Phosphoserine aminotransferase | 2.98e-14 | 1.37e-10 | NA | NA |
5. P | Q3B3L3 | Histidinol-phosphate aminotransferase | 1.25e-09 | 1.62e-09 | NA | NA |
5. P | A4QCW6 | Serine hydroxymethyltransferase | 3.12e-10 | 1.98e-09 | NA | NA |
5. P | Q72PY2 | Serine hydroxymethyltransferase | 2.70e-10 | 1.17e-07 | NA | NA |
5. P | Q3Z408 | 8-amino-7-oxononanoate synthase | 1.81e-11 | 2.31e-06 | NA | NA |
5. P | Q3KLW3 | LL-diaminopimelate aminotransferase | 7.34e-08 | 3.93e-09 | NA | NA |
5. P | A9N278 | Succinylornithine transaminase | 3.99e-14 | 2.38e-03 | NA | NA |
5. P | P9WGB6 | Cystathionine gamma-synthase | 1.51e-08 | 4.83e-04 | NA | NA |
5. P | C6BW42 | L-seryl-tRNA(Sec) selenium transferase | 2.17e-06 | 8.58e-03 | NA | NA |
5. P | Q81MS2 | Arginine decarboxylase | 2.56e-09 | 9.70e-04 | NA | NA |
5. P | Q492S5 | Phosphoserine aminotransferase | 3.02e-14 | 3.32e-11 | NA | NA |
5. P | Q5B0H8 | Kynureninase 1 | 0.00e+00 | 9.77e-11 | NA | NA |
5. P | P43336 | Aromatic-amino-acid aminotransferase | 9.65e-06 | 6.69e-04 | NA | NA |
5. P | Q0ABQ9 | Serine hydroxymethyltransferase | 5.18e-10 | 6.51e-07 | NA | NA |
5. P | Q9K935 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.99e-08 | 2.34e-06 | NA | NA |
5. P | Q30R29 | Serine hydroxymethyltransferase 1 | 3.68e-10 | 4.26e-08 | NA | NA |
5. P | Q87QN5 | 8-amino-7-oxononanoate synthase | 7.59e-11 | 1.01e-08 | NA | NA |
5. P | B0SCE2 | Phosphoserine aminotransferase | 1.84e-13 | 2.39e-12 | NA | NA |
5. P | B1ILA9 | Histidinol-phosphate aminotransferase | 1.38e-09 | 8.70e-12 | NA | NA |
5. P | A1VK38 | Histidinol-phosphate aminotransferase | 1.01e-13 | 1.43e-06 | NA | NA |
5. P | B5Z123 | Serine hydroxymethyltransferase | 2.69e-10 | 4.52e-08 | NA | NA |
5. P | B5EUP9 | 8-amino-7-oxononanoate synthase | 4.80e-11 | 6.80e-07 | NA | NA |
5. P | A2RM21 | Cystathionine beta-lyase | 1.71e-12 | 8.58e-04 | NA | NA |
5. P | Q5LNM6 | Histidinol-phosphate aminotransferase | 7.18e-14 | 9.42e-09 | NA | NA |
5. P | P9WGJ7 | Protein Rv3402c | 2.07e-08 | 1.79e-07 | NA | NA |
5. P | Q2SCF2 | Phosphoserine aminotransferase | 4.43e-14 | 2.23e-08 | NA | NA |
5. P | C4L432 | Phosphoserine aminotransferase | 1.26e-10 | 1.16e-12 | NA | NA |
5. P | B7N584 | Succinylornithine transaminase | 3.32e-14 | 7.92e-03 | NA | NA |
5. P | Q5LC03 | LL-diaminopimelate aminotransferase | 1.91e-07 | 9.98e-04 | NA | NA |
5. P | P10658 | Phosphoserine aminotransferase | 7.39e-14 | 5.52e-11 | NA | NA |
5. P | Q824A4 | LL-diaminopimelate aminotransferase | 1.85e-07 | 2.36e-08 | NA | NA |
5. P | B1GYQ9 | Serine hydroxymethyltransferase | 4.54e-10 | 1.19e-07 | NA | NA |
5. P | Q8PH31 | Acetylornithine aminotransferase | 9.48e-14 | 2.90e-02 | NA | NA |
5. P | B2KER5 | Serine hydroxymethyltransferase | 1.25e-10 | 7.64e-08 | NA | NA |
5. P | Q9ZMD0 | Glutamate-1-semialdehyde 2,1-aminomutase | 8.13e-13 | 2.22e-02 | NA | NA |
5. P | Q02TR5 | 8-amino-7-oxononanoate synthase | 2.66e-15 | 6.57e-08 | NA | NA |
5. P | A4IZK5 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.39e-07 | 6.96e-08 | NA | NA |
5. P | Q92GH7 | Serine hydroxymethyltransferase | 5.27e-10 | 6.37e-06 | NA | NA |
5. P | Q1JBR5 | Serine hydroxymethyltransferase | 5.43e-10 | 6.29e-07 | NA | NA |
5. P | Q8VCN5 | Cystathionine gamma-lyase | 1.72e-07 | 2.98e-05 | NA | NA |
5. P | P00503 | Aspartate aminotransferase, cytoplasmic | 1.91e-06 | 1.80e-04 | NA | NA |
5. P | P77962 | Serine hydroxymethyltransferase | 7.37e-10 | 6.30e-06 | NA | NA |
5. P | C3MPT5 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.49e-07 | 1.03e-07 | NA | NA |
5. P | Q82UP9 | Serine hydroxymethyltransferase | 2.06e-10 | 2.15e-08 | NA | NA |
5. P | Q8Y4K4 | Probable glutamate decarboxylase gamma | 3.22e-15 | 1.58e-07 | NA | NA |
5. P | Q5WHT9 | Phosphoserine aminotransferase | 5.41e-14 | 2.13e-09 | NA | NA |
5. P | O33770 | Histidinol-phosphate aminotransferase | 4.08e-09 | 4.87e-05 | NA | NA |
5. P | A4QCG9 | Phosphoserine aminotransferase | 8.40e-14 | 5.97e-11 | NA | NA |
5. P | Q39IG4 | Phosphoserine aminotransferase | 9.10e-14 | 8.14e-12 | NA | NA |
5. P | A7FJX0 | Phosphoserine aminotransferase | 7.82e-14 | 7.35e-11 | NA | NA |
5. P | Q7NN66 | Acetylornithine aminotransferase | 7.66e-15 | 1.65e-04 | NA | NA |
5. P | Q9RME2 | Phosphoserine aminotransferase | 2.56e-14 | 2.87e-10 | NA | NA |
5. P | B0K590 | 8-amino-7-oxononanoate synthase | 3.66e-15 | 8.38e-08 | NA | NA |
5. P | Q818X0 | Putative 8-amino-7-oxononanoate synthase | 8.75e-11 | 2.89e-07 | NA | NA |
5. P | J7SZ64 | Tryptophan decarboxylase | 4.85e-08 | 1.89e-05 | NA | NA |
5. P | Q72BI1 | LL-diaminopimelate aminotransferase | 1.60e-07 | 2.19e-06 | NA | NA |
5. P | Q84CG1 | Capreomycidine synthase | 1.96e-09 | 8.70e-12 | NA | NA |
5. P | B2J2U3 | LL-diaminopimelate aminotransferase | 2.37e-07 | 1.09e-04 | NA | NA |
5. P | A5UQB7 | Serine hydroxymethyltransferase | 1.92e-09 | 2.03e-07 | NA | NA |
5. P | A5CU18 | Serine hydroxymethyltransferase | 8.78e-10 | 1.24e-08 | NA | NA |
5. P | P9WPZ4 | Probable N-succinyldiaminopimelate aminotransferase DapC | 1.28e-09 | 1.11e-05 | NA | NA |
5. P | Q8EBN8 | Serine hydroxymethyltransferase | 3.19e-10 | 1.84e-09 | NA | NA |
5. P | Q51687 | Histidinol-phosphate aminotransferase | 1.35e-13 | 1.65e-08 | NA | NA |
5. P | Q2W9A3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.36e-10 | 5.91e-08 | NA | NA |
5. P | Q7W1I6 | Serine hydroxymethyltransferase 1 | 5.69e-10 | 1.30e-07 | NA | NA |
5. P | B1XTC3 | Serine hydroxymethyltransferase | 7.10e-11 | 1.01e-06 | NA | NA |
5. P | O13972 | Probable serine hydroxymethyltransferase, cytosolic | 1.13e-09 | 2.07e-05 | NA | NA |
5. P | P14290 | Erythromycin biosynthesis sensory transduction protein EryC1 | 2.79e-13 | 3.03e-06 | NA | NA |
5. P | A1KJ16 | Histidinol-phosphate aminotransferase | 9.24e-09 | 1.10e-06 | NA | NA |
5. P | Q2FF15 | Serine hydroxymethyltransferase | 1.67e-10 | 3.20e-06 | NA | NA |
5. P | Q20YH9 | Histidinol-phosphate aminotransferase | 8.76e-14 | 9.08e-09 | NA | NA |
5. P | Q55828 | LL-diaminopimelate aminotransferase | 2.23e-07 | 4.43e-04 | NA | NA |
5. P | O67781 | Probable aspartate/prephenate aminotransferase | 1.41e-08 | 2.07e-05 | NA | NA |
5. P | Q9WZY4 | O-acetyl-L-homoserine sulfhydrylase | 3.15e-08 | 1.60e-04 | NA | NA |
5. P | Q9JYH7 | Histidinol-phosphate aminotransferase | 1.01e-12 | 6.21e-11 | NA | NA |
5. P | A8H1Q0 | Serine hydroxymethyltransferase | 8.56e-10 | 2.62e-09 | NA | NA |
5. P | B1HTD4 | Histidinol-phosphate aminotransferase | 2.05e-09 | 9.85e-06 | NA | NA |
5. P | P39148 | Serine hydroxymethyltransferase | 2.13e-10 | 8.41e-07 | NA | NA |
5. P | A5IBR0 | Phosphoserine aminotransferase | 2.75e-14 | 1.04e-09 | NA | NA |
5. P | P59317 | Acetylornithine/succinyldiaminopimelate aminotransferase | 9.15e-14 | 1.63e-02 | NA | NA |
5. P | B2SJJ1 | Phosphoserine aminotransferase | 3.49e-14 | 2.09e-10 | NA | NA |
5. P | Q2NAR9 | Serine hydroxymethyltransferase | 7.75e-10 | 6.51e-07 | NA | NA |
5. P | Q318P3 | LL-diaminopimelate aminotransferase | 3.28e-07 | 3.68e-04 | NA | NA |
5. P | O42652 | Aspartate aminotransferase, cytoplasmic | 1.45e-06 | 4.43e-04 | NA | NA |
5. P | Q8ZPV2 | Succinylornithine transaminase | 4.42e-14 | 9.30e-03 | NA | NA |
5. P | A1KQA5 | Putative phenylalanine aminotransferase | 1.24e-09 | 3.13e-07 | NA | NA |
5. P | Q5PG49 | 8-amino-7-oxononanoate synthase | 2.03e-11 | 2.18e-07 | NA | NA |
5. P | B2FLM5 | 8-amino-7-oxononanoate synthase | 5.80e-11 | 1.40e-08 | NA | NA |
5. P | Q4L332 | Cystathionine beta-lyase MetC | 1.70e-08 | 5.34e-05 | NA | NA |
5. P | B5R270 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 8.32e-14 | 9.52e-04 | NA | NA |
5. P | Q8CTG8 | Histidinol-phosphate aminotransferase | 2.08e-09 | 1.58e-07 | NA | NA |
5. P | Q7MX71 | L-methionine gamma-lyase | 9.19e-09 | 1.72e-05 | NA | NA |
5. P | Q3E6S9 | Probable L-cysteine desulfhydrase, chloroplastic | 0.00e+00 | 1.63e-12 | NA | NA |
5. P | P43844 | Serine hydroxymethyltransferase | 3.19e-10 | 1.38e-07 | NA | NA |
5. P | Q9UW18 | Alanine racemase TOXG | 2.64e-09 | 1.22e-12 | NA | NA |
5. P | Q8FNZ1 | Histidinol-phosphate aminotransferase | 2.96e-12 | 3.47e-04 | NA | NA |
5. P | Q21V29 | Serine hydroxymethyltransferase | 1.15e-10 | 1.46e-07 | NA | NA |
5. P | Q5YYP9 | Histidinol-phosphate aminotransferase | 7.50e-09 | 1.84e-06 | NA | NA |
5. P | B3CM26 | Serine hydroxymethyltransferase | 4.26e-10 | 3.07e-06 | NA | NA |
5. P | Q5MNI0 | L-cysteine desulfhydrase-like protein lolT1 | 0.00e+00 | 4.86e-22 | NA | NA |
5. P | Q5L6P4 | Serine hydroxymethyltransferase | 1.35e-09 | 9.43e-04 | NA | NA |
5. P | Q9HKM6 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.27e-13 | 3.44e-02 | NA | NA |
5. P | P77434 | Glutamate-pyruvate aminotransferase AlaC | 6.39e-07 | 3.51e-07 | NA | NA |
5. P | Q8G8Y2 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase | 4.80e-09 | 2.77e-04 | NA | NA |
5. P | Q9X7B8 | Histidinol-phosphate aminotransferase | 6.64e-09 | 2.25e-08 | NA | NA |
5. P | Q5NN85 | Serine hydroxymethyltransferase | 5.37e-10 | 3.38e-06 | NA | NA |
5. P | B5XY88 | Phosphoserine aminotransferase | 5.73e-14 | 5.54e-10 | NA | NA |
5. P | B1L9T9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.14e-07 | 6.96e-07 | NA | NA |
5. P | Q8F6A0 | Serine hydroxymethyltransferase | 2.16e-10 | 1.17e-07 | NA | NA |
5. P | Q6A8L4 | Histidinol-phosphate aminotransferase | 6.79e-09 | 6.63e-04 | NA | NA |
5. P | A5INE2 | Histidinol-phosphate aminotransferase | 3.59e-08 | 4.23e-09 | NA | NA |
5. P | Q1JLP8 | Serine hydroxymethyltransferase | 4.90e-10 | 6.29e-07 | NA | NA |
5. P | B9KAQ7 | Serine hydroxymethyltransferase | 7.69e-10 | 1.41e-06 | NA | NA |
5. P | B7M5T5 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.03e-13 | 1.09e-03 | NA | NA |
5. P | A4W8B8 | 8-amino-7-oxononanoate synthase | 2.94e-11 | 8.68e-08 | NA | NA |
5. P | B7MIN5 | Serine hydroxymethyltransferase | 2.72e-10 | 1.69e-08 | NA | NA |
5. P | Q7P0F4 | Histidinol-phosphate aminotransferase | 2.24e-09 | 1.88e-09 | NA | NA |
5. P | Q31E54 | 8-amino-7-oxononanoate synthase | 1.77e-10 | 1.55e-07 | NA | NA |
5. P | A2SSS7 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 2 | 4.44e-16 | 6.47e-20 | NA | NA |
5. P | B8D8Q3 | Histidinol-phosphate aminotransferase | 3.01e-07 | 1.82e-08 | NA | NA |
5. P | B1IZ53 | Histidinol-phosphate aminotransferase | 4.86e-08 | 2.82e-09 | NA | NA |
5. P | Q9CMK9 | Tyrosine phenol-lyase | 4.31e-07 | 7.09e-06 | NA | NA |
5. P | Q04YV8 | LL-diaminopimelate aminotransferase | 4.55e-07 | 1.74e-05 | NA | NA |
5. P | Q5WB66 | Serine hydroxymethyltransferase | 3.79e-10 | 2.99e-07 | NA | NA |
5. P | P66876 | Cystathionine gamma-synthase | 1.71e-08 | 4.83e-04 | NA | NA |
5. P | Q47AL9 | Histidinol-phosphate aminotransferase 2 | 6.58e-10 | 2.06e-11 | NA | NA |
5. P | Q8EWD1 | Serine hydroxymethyltransferase | 6.26e-10 | 2.41e-07 | NA | NA |
5. P | B8I0R1 | Glutamate-1-semialdehyde 2,1-aminomutase | 4.71e-13 | 8.58e-04 | NA | NA |
5. P | A0PZX4 | Serine hydroxymethyltransferase | 1.42e-10 | 1.55e-07 | NA | NA |
5. P | P77690 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.34e-13 | 2.01e-04 | NA | NA |
5. P | B4SX42 | Histidinol-phosphate aminotransferase | 5.59e-08 | 1.25e-09 | NA | NA |
5. P | Q81FQ1 | Histidinol-phosphate aminotransferase 1 | 1.36e-09 | 1.84e-08 | NA | NA |
5. P | C6DYX1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.71e-09 | 9.15e-10 | NA | NA |
5. P | A6VGH9 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 1.55e-15 | 1.68e-24 | NA | NA |
5. P | Q8YV89 | Histidinol-phosphate aminotransferase 1 | 3.43e-09 | 3.84e-09 | NA | NA |
5. P | B2HWW3 | Phosphoserine aminotransferase | 8.32e-14 | 3.51e-10 | NA | NA |
5. P | A0KJP3 | Tryptophanase | 2.51e-07 | 2.69e-06 | NA | NA |
5. P | B0TJY5 | Serine hydroxymethyltransferase | 1.08e-09 | 4.55e-09 | NA | NA |
5. P | A1JPP9 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 2.30e-13 | 1.86e-03 | NA | NA |
5. P | B8D707 | Histidinol-phosphate aminotransferase | 1.43e-08 | 1.82e-08 | NA | NA |
5. P | A9R8C1 | Serine hydroxymethyltransferase | 3.29e-10 | 3.07e-08 | NA | NA |
5. P | Q8Z2Z9 | Serine hydroxymethyltransferase 2 | 6.41e-10 | 1.72e-06 | NA | NA |
5. P | A7FIL6 | Succinylornithine transaminase | 5.63e-14 | 3.35e-03 | NA | NA |
5. P | A7ZFA4 | Serine hydroxymethyltransferase | 3.90e-10 | 1.29e-07 | NA | NA |
5. P | P59953 | Serine hydroxymethyltransferase 1 | 3.55e-10 | 3.93e-09 | NA | NA |
5. P | A0K5L8 | Phosphoserine aminotransferase | 8.16e-14 | 5.01e-10 | NA | NA |
5. P | Q2LQM6 | Serine hydroxymethyltransferase | 2.08e-10 | 3.43e-07 | NA | NA |
5. P | A6SU64 | 8-amino-7-oxononanoate synthase | 3.69e-11 | 2.41e-07 | NA | NA |
5. P | B0BC69 | Serine hydroxymethyltransferase | 1.18e-09 | 1.06e-03 | NA | NA |
5. P | Q7VWP1 | Putative 8-amino-7-oxononanoate synthase | 6.77e-11 | 3.23e-09 | NA | NA |
5. P | B7UGZ1 | Serine hydroxymethyltransferase | 2.60e-10 | 1.69e-08 | NA | NA |
5. P | B2K9S8 | Serine hydroxymethyltransferase | 3.93e-10 | 3.07e-08 | NA | NA |
5. P | Q9CG20 | Glutamate decarboxylase | 1.78e-15 | 1.69e-07 | NA | NA |
5. P | Q87DT2 | 8-amino-7-oxononanoate synthase | 3.13e-11 | 3.62e-08 | NA | NA |
5. P | P0A826 | Serine hydroxymethyltransferase | 2.83e-10 | 1.69e-08 | NA | NA |
5. P | Q8DPZ0 | Serine hydroxymethyltransferase | 4.99e-10 | 3.83e-08 | NA | NA |
5. P | B8GIB0 | Histidinol-phosphate aminotransferase | 2.66e-12 | 9.38e-10 | NA | NA |
5. P | Q6VMN7 | Aminotransferase ALD1 homolog | 1.06e-07 | 1.83e-02 | NA | NA |
5. P | Q2KA25 | Serine hydroxymethyltransferase | 3.53e-10 | 2.80e-07 | NA | NA |
5. P | Q9XB01 | Serine hydroxymethyltransferase | 2.40e-10 | 4.20e-07 | NA | NA |
5. P | B5BC30 | 8-amino-7-oxononanoate synthase | 1.98e-11 | 2.18e-07 | NA | NA |
5. P | B9KHP8 | Serine hydroxymethyltransferase | 4.25e-10 | 6.58e-07 | NA | NA |
5. P | B5YFU5 | Putative 8-amino-7-oxononanoate synthase | 4.74e-11 | 1.99e-07 | NA | NA |
5. P | B0VBB3 | Serine hydroxymethyltransferase | 6.73e-10 | 8.86e-06 | NA | NA |
5. P | Q9HPJ9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.31e-07 | 4.36e-08 | NA | NA |
5. P | P60295 | Ornithine aminotransferase 1 | 3.29e-14 | 5.94e-03 | NA | NA |
5. P | Q68VS3 | 5-aminolevulinate synthase | 2.28e-11 | 1.26e-07 | NA | NA |
5. P | Q976H2 | Glutamate-1-semialdehyde 2,1-aminomutase | 2.28e-12 | 3.38e-02 | NA | NA |
5. P | Q7WDY3 | Histidinol-phosphate aminotransferase 2 | 5.34e-08 | 2.02e-08 | NA | NA |
5. P | Q04UL5 | LL-diaminopimelate aminotransferase | 4.70e-07 | 6.55e-05 | NA | NA |
5. P | A0QX65 | 8-amino-7-oxononanoate synthase | 1.23e-14 | 2.25e-08 | NA | NA |
5. P | A7I2V8 | Histidinol-phosphate aminotransferase | 1.38e-09 | 1.48e-06 | NA | NA |
5. P | P00509 | Aspartate aminotransferase | 7.67e-06 | 6.82e-05 | NA | NA |
5. P | Q031D7 | Serine hydroxymethyltransferase | 3.28e-10 | 1.02e-07 | NA | NA |
5. P | A7ZML6 | Succinylornithine transaminase | 3.31e-14 | 1.05e-02 | NA | NA |
5. P | D7PHZ0 | Aldolase vrtJ | 2.97e-13 | 1.71e-08 | NA | NA |
5. P | Q2NTX2 | Histidinol-phosphate aminotransferase | 1.95e-09 | 1.45e-09 | NA | NA |
5. P | C5CEA8 | Serine hydroxymethyltransferase | 7.44e-10 | 1.39e-07 | NA | NA |
5. P | Q9K8V5 | Acetylornithine aminotransferase | 1.17e-14 | 8.21e-03 | NA | NA |
5. P | B6YRL2 | LL-diaminopimelate aminotransferase | 1.33e-07 | 8.50e-07 | NA | NA |
5. P | B4TGE0 | Succinylornithine transaminase | 2.62e-14 | 2.97e-03 | NA | NA |
5. P | A8FVN8 | Phosphoserine aminotransferase | 1.82e-13 | 1.27e-09 | NA | NA |
5. P | P33447 | Tyrosine aminotransferase | 5.00e-08 | 6.44e-03 | NA | NA |
5. P | B0RDR3 | Serine hydroxymethyltransferase | 6.67e-10 | 1.89e-08 | NA | NA |
5. P | B8FJ72 | Serine hydroxymethyltransferase | 4.36e-10 | 2.10e-07 | NA | NA |
5. P | Q71VT6 | Phosphoserine aminotransferase | 2.15e-14 | 3.22e-10 | NA | NA |
5. P | B4SJB0 | Serine hydroxymethyltransferase | 3.69e-10 | 6.96e-08 | NA | NA |
5. P | C5BEV2 | Serine hydroxymethyltransferase | 2.72e-10 | 4.79e-08 | NA | NA |
5. P | A6UYW1 | 8-amino-7-oxononanoate synthase | 2.33e-15 | 2.01e-07 | NA | NA |
5. P | A6QIV7 | Serine hydroxymethyltransferase | 2.24e-10 | 1.44e-06 | NA | NA |
5. P | Q9JTH8 | Histidinol-phosphate aminotransferase | 8.56e-13 | 8.15e-11 | NA | NA |
5. P | B6I7T0 | 8-amino-7-oxononanoate synthase | 2.18e-11 | 3.85e-06 | NA | NA |
5. P | Q7UQN2 | Serine hydroxymethyltransferase | 2.61e-10 | 1.18e-05 | NA | NA |
5. P | B9IWY0 | Putative 8-amino-7-oxononanoate synthase | 1.42e-10 | 1.00e-06 | NA | NA |
5. P | B5FNT7 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 8.48e-14 | 1.22e-03 | NA | NA |
5. P | Q2RH48 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.34e-11 | 4.20e-10 | NA | NA |
5. P | Q4AAB2 | Serine hydroxymethyltransferase | 1.84e-10 | 1.20e-07 | NA | NA |
5. P | Q18GK0 | Serine hydroxymethyltransferase | 6.90e-10 | 1.07e-08 | NA | NA |
5. P | Q3S8P9 | 4-dedimethylamino-4-oxo-anhydrotetracycline transaminase OxyQ | 2.45e-07 | 1.34e-05 | NA | NA |
5. P | Q3Z8H5 | LL-diaminopimelate aminotransferase | 1.55e-07 | 1.07e-05 | NA | NA |
5. P | Q04792 | Glutamate decarboxylase | 1.22e-13 | 2.45e-05 | NA | NA |
5. P | C0PXU3 | Phosphoserine aminotransferase | 3.18e-14 | 5.01e-10 | NA | NA |
5. P | Q57M57 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 8.28e-14 | 1.47e-03 | NA | NA |
5. P | B7GHW7 | Putative 8-amino-7-oxononanoate synthase | 1.32e-10 | 6.88e-08 | NA | NA |
5. P | A6T6L6 | 8-amino-7-oxononanoate synthase | 4.32e-11 | 3.61e-06 | NA | NA |
5. P | O66875 | Putative 8-amino-7-oxononanoate synthase | 5.46e-11 | 1.22e-10 | NA | NA |
5. P | B7KL61 | LL-diaminopimelate aminotransferase | 2.39e-07 | 8.34e-05 | NA | NA |
5. P | O85718 | Serine hydroxymethyltransferase | 6.89e-10 | 3.89e-06 | NA | NA |
5. P | C0PYJ5 | Serine hydroxymethyltransferase | 2.85e-10 | 3.97e-08 | NA | NA |
5. P | Q31PF9 | Histidinol-phosphate aminotransferase | 1.52e-12 | 3.43e-10 | NA | NA |
5. P | B9JCX4 | Serine hydroxymethyltransferase | 5.90e-10 | 1.37e-06 | NA | NA |
5. P | B1JXR6 | Phosphoserine aminotransferase | 7.75e-14 | 3.99e-10 | NA | NA |
5. P | Q83KJ6 | Histidinol-phosphate aminotransferase | 4.73e-08 | 3.15e-09 | NA | NA |
5. P | Q54GT6 | Serine--pyruvate aminotransferase | 1.11e-16 | 1.81e-11 | NA | NA |
5. P | Q87QL0 | Histidinol-phosphate aminotransferase | 1.46e-09 | 2.76e-10 | NA | NA |
5. P | A5UA19 | Histidinol-phosphate aminotransferase | 1.61e-09 | 2.29e-09 | NA | NA |
5. P | A8HT29 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.21e-14 | 1.93e-08 | NA | NA |
5. P | P31531 | 1-aminocyclopropane-1-carboxylate synthase | 1.03e-05 | 3.92e-03 | NA | NA |
5. P | Q2RL44 | Histidinol-phosphate aminotransferase | 2.15e-09 | 2.38e-03 | NA | NA |
5. P | A8A1P5 | Histidinol-phosphate aminotransferase | 4.75e-08 | 2.82e-09 | NA | NA |
5. P | Q82AA5 | Histidinol-phosphate aminotransferase | 2.65e-09 | 9.64e-06 | NA | NA |
5. P | Q7VLP0 | Phosphoserine aminotransferase | 4.88e-10 | 2.17e-10 | NA | NA |
5. P | Q4QN73 | Histidinol-phosphate aminotransferase 1 | 1.64e-09 | 5.14e-09 | NA | NA |
5. P | P32929 | Cystathionine gamma-lyase | 4.36e-09 | 1.52e-04 | NA | NA |
5. P | Q9CL27 | Tryptophanase | 1.48e-08 | 2.07e-03 | NA | NA |
5. P | P63567 | Acetylornithine aminotransferase | 2.11e-14 | 2.16e-02 | NA | NA |
5. P | B1YNS0 | 8-amino-7-oxononanoate synthase | 2.63e-10 | 2.83e-05 | NA | NA |
5. P | P29535 | 1-aminocyclopropane-1-carboxylate synthase 4 | 9.27e-06 | 4.95e-02 | NA | NA |
5. P | Q52811 | Putative cystathionine beta-lyase | 3.83e-07 | 1.12e-03 | NA | NA |
5. P | Q5F7D7 | Histidinol-phosphate aminotransferase | 7.06e-13 | 2.90e-09 | NA | NA |
5. P | P59323 | Acetylornithine aminotransferase | 3.23e-14 | 1.68e-02 | NA | NA |
5. P | Q8RHM6 | Tyrosine phenol-lyase | 3.86e-07 | 2.35e-05 | NA | NA |
5. P | C1AIM6 | Putative phenylalanine aminotransferase | 1.29e-09 | 3.13e-07 | NA | NA |
5. P | Q71ZX3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.44e-08 | 2.29e-06 | NA | NA |
5. P | P57376 | Serine hydroxymethyltransferase | 3.46e-10 | 1.25e-09 | NA | NA |
5. P | A4FWT8 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 1.55e-15 | 1.18e-23 | NA | NA |
5. P | Q18F03 | Histidinol-phosphate aminotransferase | 1.53e-07 | 7.68e-10 | NA | NA |
5. P | Q32E24 | Phosphoserine aminotransferase | 3.94e-14 | 8.70e-10 | NA | NA |
5. P | Q99ZP1 | Serine hydroxymethyltransferase | 4.98e-10 | 8.38e-08 | NA | NA |
5. P | A1VY45 | Phosphoserine aminotransferase | 2.18e-13 | 9.40e-11 | NA | NA |
5. P | Q74CR5 | Serine hydroxymethyltransferase | 2.21e-10 | 3.14e-08 | NA | NA |
5. P | O87320 | Putative aminotransferase AatC | 2.13e-07 | 7.11e-07 | NA | NA |
5. P | Q9HZ76 | UDP-2-acetamido-2-deoxy-3-oxo-D-glucuronate aminotransferase | 4.50e-14 | 1.13e-06 | NA | NA |
5. P | Q03L77 | Serine hydroxymethyltransferase | 5.07e-10 | 8.78e-08 | NA | NA |
5. P | Q818M4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.92e-08 | 7.47e-06 | NA | NA |
5. P | O66630 | LL-diaminopimelate aminotransferase | 3.10e-07 | 2.75e-06 | NA | NA |
5. P | Q1B1Z8 | Putative phenylalanine aminotransferase | 1.95e-09 | 1.95e-09 | NA | NA |
5. P | Q7N6D6 | Phosphoserine aminotransferase | 5.02e-14 | 1.84e-09 | NA | NA |
5. P | Q9K5Z2 | Ornithine aminotransferase | 4.64e-14 | 1.30e-03 | NA | NA |
5. P | A5G6I9 | 8-amino-7-oxononanoate synthase | 2.55e-15 | 4.21e-08 | NA | NA |
5. P | B7J6V1 | Phosphoserine aminotransferase | 6.45e-14 | 2.16e-13 | NA | NA |
5. P | A6RSP5 | Kynureninase | 0.00e+00 | 1.79e-10 | NA | NA |
5. P | A0R5X8 | Putative phenylalanine aminotransferase | 1.38e-13 | 3.88e-08 | NA | NA |
5. P | B7M748 | 8-amino-7-oxononanoate synthase | 3.10e-11 | 2.64e-06 | NA | NA |
5. P | P94890 | O-acetyl-L-homoserine sulfhydrylase | 8.36e-08 | 1.44e-05 | NA | NA |
5. P | Q48CP3 | Serine hydroxymethyltransferase 2 | 4.84e-10 | 2.39e-07 | NA | NA |
5. P | A1VC86 | Tryptophanase | 3.22e-07 | 4.25e-07 | NA | NA |
5. P | Q64HC5 | Cysteine-S-conjugate beta-lyase | 9.73e-09 | 2.72e-04 | NA | NA |
5. P | Q92G23 | 5-aminolevulinate synthase | 7.29e-11 | 7.35e-07 | NA | NA |
5. P | Q31FS6 | Serine hydroxymethyltransferase | 7.77e-10 | 1.36e-07 | NA | NA |
5. P | Q5LD58 | Serine hydroxymethyltransferase | 1.37e-09 | 5.63e-07 | NA | NA |
5. P | B9DTW4 | Phosphoserine aminotransferase | 7.66e-15 | 2.87e-11 | NA | NA |
5. P | C6C0V0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.90e-11 | 1.16e-07 | NA | NA |
5. P | Q92QU6 | Serine hydroxymethyltransferase 1 | 2.54e-10 | 6.79e-06 | NA | NA |
5. P | B1XB26 | Serine hydroxymethyltransferase | 2.82e-10 | 1.69e-08 | NA | NA |
5. P | Q0TJS2 | 8-amino-7-oxononanoate synthase | 2.67e-11 | 3.53e-06 | NA | NA |
5. P | B0K625 | Histidinol-phosphate aminotransferase | 3.32e-13 | 1.35e-08 | NA | NA |
5. P | Q845V2 | Histidinol-phosphate aminotransferase | 1.65e-09 | 2.55e-07 | NA | NA |
5. P | Q3K5P2 | 8-amino-7-oxononanoate synthase | 1.44e-15 | 6.32e-09 | NA | NA |
5. P | O30508 | Succinylornithine transaminase/acetylornithine aminotransferase | 5.18e-14 | 1.36e-03 | NA | NA |
5. P | B7GHJ8 | Histidinol-phosphate aminotransferase | 4.58e-10 | 1.13e-06 | NA | NA |
5. P | A9MTI7 | 8-amino-7-oxononanoate synthase | 2.01e-11 | 2.52e-07 | NA | NA |
5. P | A8ZTV3 | Serine hydroxymethyltransferase | 7.51e-10 | 1.82e-06 | NA | NA |
5. P | Q65T08 | Serine hydroxymethyltransferase | 4.57e-10 | 3.18e-08 | NA | NA |
5. P | C4ZXC6 | Serine hydroxymethyltransferase | 2.70e-10 | 1.69e-08 | NA | NA |
5. P | A5G0E0 | Serine hydroxymethyltransferase | 3.85e-10 | 1.12e-07 | NA | NA |
5. P | Q0APF8 | Serine hydroxymethyltransferase | 8.62e-10 | 6.05e-08 | NA | NA |
5. P | Q58027 | O-phosphoseryl-tRNA(Sec) selenium transferase | 8.34e-08 | 1.97e-05 | NA | NA |
5. P | Q3AB61 | L-seryl-tRNA(Sec) selenium transferase | 2.34e-06 | 3.65e-02 | NA | NA |
5. P | C0MF11 | Serine hydroxymethyltransferase | 5.99e-10 | 1.29e-07 | NA | NA |
5. P | A4XTE7 | Phosphoserine aminotransferase | 6.72e-14 | 9.99e-10 | NA | NA |
5. P | Q8RCW1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.62e-11 | 7.24e-06 | NA | NA |
5. P | B9DIU0 | Ornithine aminotransferase | 2.82e-14 | 6.10e-03 | NA | NA |
5. P | B0SKW4 | Phosphoserine aminotransferase | 1.65e-13 | 2.39e-12 | NA | NA |
5. P | C0RIA2 | Serine hydroxymethyltransferase | 3.66e-10 | 8.89e-07 | NA | NA |
5. P | A5CCC4 | Serine hydroxymethyltransferase | 5.78e-14 | 2.09e-05 | NA | NA |
5. P | P9WQ90 | Alanine aminotransferase | 1.21e-07 | 1.40e-04 | NA | NA |
5. P | P57881 | Phosphoserine aminotransferase | 5.56e-10 | 1.11e-08 | NA | NA |
5. P | Q49VS0 | Histidinol-phosphate aminotransferase | 2.10e-09 | 2.44e-07 | NA | NA |
5. P | Q894M8 | Tryptophanase | 7.87e-07 | 4.31e-05 | NA | NA |
5. P | B2U7G7 | Serine hydroxymethyltransferase | 1.03e-10 | 1.63e-08 | NA | NA |
5. P | O93744 | Aspartate aminotransferase | 1.64e-07 | 5.38e-07 | NA | NA |
5. P | Q8UG75 | Serine hydroxymethyltransferase 1 | 5.29e-10 | 6.36e-07 | NA | NA |
5. P | P0DF70 | Serine hydroxymethyltransferase | 5.14e-10 | 6.05e-08 | NA | NA |
5. P | B0SEF8 | Serine hydroxymethyltransferase | 2.41e-10 | 3.10e-06 | NA | NA |
5. P | Q0BYP2 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.11e-14 | 2.39e-07 | NA | NA |
5. P | A7HMM1 | 8-amino-7-oxononanoate synthase | 8.59e-11 | 3.03e-07 | NA | NA |
5. P | Q8E5C6 | Serine hydroxymethyltransferase | 4.70e-10 | 1.36e-07 | NA | NA |
5. P | B1LNK7 | Serine hydroxymethyltransferase | 2.69e-10 | 1.69e-08 | NA | NA |
5. P | B4EZV5 | Serine hydroxymethyltransferase | 3.14e-10 | 5.51e-08 | NA | NA |
5. P | Q6AAU3 | Serine hydroxymethyltransferase | 2.53e-09 | 7.09e-06 | NA | NA |
5. P | B6YQL2 | Phosphoserine aminotransferase | 6.14e-13 | 4.14e-10 | NA | NA |
5. P | B7MDH5 | Histidinol-phosphate aminotransferase | 4.50e-08 | 1.01e-09 | NA | NA |
5. P | Q2W3L2 | Putative 8-amino-7-oxononanoate synthase | 8.99e-11 | 1.15e-09 | NA | NA |
5. P | O94350 | Cystathionine beta-lyase | 6.38e-10 | 3.35e-03 | NA | NA |
5. P | Q98G10 | Histidinol-phosphate aminotransferase 2 | 7.78e-14 | 4.82e-05 | NA | NA |
5. P | Q111H1 | Serine hydroxymethyltransferase | 7.68e-10 | 9.85e-06 | NA | NA |
5. P | B7HAZ0 | Putative 8-amino-7-oxononanoate synthase | 9.71e-11 | 2.89e-07 | NA | NA |
5. P | A1VYC2 | Serine hydroxymethyltransferase | 3.97e-10 | 4.25e-07 | NA | NA |
5. P | Q7VA14 | LL-diaminopimelate aminotransferase | 3.66e-07 | 1.03e-05 | NA | NA |
5. P | Q7VQW9 | Histidinol-phosphate aminotransferase | 2.25e-09 | 9.86e-10 | NA | NA |
5. P | Q7N2G7 | Succinylornithine transaminase | 2.04e-14 | 1.32e-02 | NA | NA |
5. P | B8DBH0 | Serine hydroxymethyltransferase | 2.58e-10 | 3.88e-07 | NA | NA |
5. P | Q0AE73 | 8-amino-7-oxononanoate synthase | 1.33e-15 | 3.71e-07 | NA | NA |
5. P | Q3B2G3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.84e-11 | 7.60e-07 | NA | NA |
5. P | Q73AX7 | Histidinol-phosphate aminotransferase 1 | 1.15e-09 | 4.36e-08 | NA | NA |
5. P | C3K6J5 | Phosphoserine aminotransferase | 3.91e-14 | 1.93e-08 | NA | NA |
5. P | P0C9C9 | NifS-like protein | NA | 3.85e-06 | NA | NA |
5. P | B8IZX8 | LL-diaminopimelate aminotransferase | 1.23e-07 | 2.67e-04 | NA | NA |
5. P | Q1D345 | Serine hydroxymethyltransferase | 3.00e-10 | 5.69e-07 | NA | NA |
5. P | Q6HE48 | Putative 8-amino-7-oxononanoate synthase | 7.95e-11 | 3.28e-07 | NA | NA |
5. P | B5YQ35 | Succinylornithine transaminase | 3.29e-14 | 3.61e-03 | NA | NA |
5. P | P05034 | Histidine decarboxylase | 4.13e-10 | 5.40e-10 | NA | NA |
5. P | Q6F211 | Serine hydroxymethyltransferase | 2.74e-10 | 1.32e-08 | NA | NA |
5. P | P58228 | Glutamate decarboxylase alpha | 1.30e-10 | 3.46e-06 | NA | NA |
5. P | Q6HGI0 | Phosphoserine aminotransferase | 3.74e-14 | 1.04e-12 | NA | NA |
5. P | B7NAQ6 | Phosphoserine aminotransferase | 7.35e-14 | 1.02e-09 | NA | NA |
5. P | Q12MU6 | Phosphoserine aminotransferase | 1.37e-13 | 1.88e-07 | NA | NA |
5. P | Q608S3 | Histidinol-phosphate aminotransferase 2 | 1.06e-09 | 2.26e-06 | NA | NA |
5. P | B2J908 | Tyrosine phenol-lyase | 1.49e-08 | 1.06e-05 | NA | NA |
5. P | B0JJJ7 | Histidinol-phosphate aminotransferase | 2.00e-09 | 1.31e-10 | NA | NA |
5. P | A7FU81 | Histidinol-phosphate aminotransferase | 7.94e-14 | 6.80e-11 | NA | NA |
5. P | Q1GP30 | Histidinol-phosphate aminotransferase | 7.38e-14 | 9.13e-05 | NA | NA |
5. P | A6L7E4 | LL-diaminopimelate aminotransferase | 1.78e-07 | 5.38e-03 | NA | NA |
5. P | B8DJJ6 | LL-diaminopimelate aminotransferase | 1.95e-07 | 3.81e-05 | NA | NA |
5. P | Q4H4F5 | Neamine transaminase BtrB | 1.33e-11 | 1.17e-03 | NA | NA |
5. P | A0RLA3 | Serine hydroxymethyltransferase | 2.34e-10 | 5.20e-08 | NA | NA |
5. P | B3PCJ2 | Histidinol-phosphate aminotransferase | 3.78e-09 | 2.00e-08 | NA | NA |
5. P | Q57DY5 | Serine hydroxymethyltransferase | 4.00e-10 | 1.37e-06 | NA | NA |
5. P | P00935 | Cystathionine gamma-synthase | 3.10e-08 | 1.21e-04 | NA | NA |
5. P | A4VUM9 | Serine hydroxymethyltransferase | 5.04e-10 | 4.63e-08 | NA | NA |
5. P | Q89GX0 | Histidinol-phosphate aminotransferase 1 | 6.21e-10 | 2.25e-07 | NA | NA |
5. P | B4TDC8 | Serine hydroxymethyltransferase | 2.89e-10 | 4.47e-08 | NA | NA |
5. P | Q74LC1 | Serine hydroxymethyltransferase | 3.59e-10 | 3.49e-08 | NA | NA |
5. P | Q3APN5 | Serine hydroxymethyltransferase | 1.40e-09 | 1.83e-07 | NA | NA |
5. P | Q8PLY7 | Phosphoserine aminotransferase | 4.47e-14 | 1.03e-10 | NA | NA |
5. P | Q6T1W6 | dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase | 1.63e-13 | 2.02e-03 | NA | NA |
5. P | Q2H7G2 | Kynureninase 2 | 0.00e+00 | 1.84e-06 | NA | NA |
5. P | A1TTV0 | 8-amino-7-oxononanoate synthase | 1.05e-14 | 5.03e-07 | NA | NA |
5. P | C4ZG66 | LL-diaminopimelate aminotransferase | 3.42e-07 | 1.48e-05 | NA | NA |
5. P | Q828A3 | Acetylornithine aminotransferase | 7.21e-14 | 1.63e-02 | NA | NA |
5. P | A1WVG6 | Serine hydroxymethyltransferase | 2.41e-10 | 1.73e-08 | NA | NA |
5. P | Q0A5W2 | 8-amino-7-oxononanoate synthase | 3.20e-11 | 2.55e-07 | NA | NA |
5. P | A6Q1Z5 | Histidinol-phosphate aminotransferase | 1.61e-09 | 3.71e-07 | NA | NA |
5. P | Q2G646 | Serine hydroxymethyltransferase | 6.77e-10 | 1.34e-06 | NA | NA |
5. P | Q53U20 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase | 5.61e-09 | 5.21e-04 | NA | NA |
5. P | O27392 | Acetylornithine aminotransferase | 5.44e-15 | 8.35e-03 | NA | NA |
5. P | B7L6M2 | Succinylornithine transaminase | 3.47e-14 | 9.72e-03 | NA | NA |
5. P | Q8FG51 | Histidinol-phosphate aminotransferase | 4.69e-08 | 2.29e-09 | NA | NA |
5. P | B7GZI3 | Histidinol-phosphate aminotransferase | 2.39e-09 | 4.52e-08 | NA | NA |
5. P | O35423 | Serine--pyruvate aminotransferase, mitochondrial | 1.11e-16 | 9.20e-08 | NA | NA |
5. P | A1SUU0 | Serine hydroxymethyltransferase | 4.48e-10 | 9.75e-08 | NA | NA |
5. P | I1RV23 | Glutamate decarboxylase-like protein FG08083 | 6.90e-08 | 2.59e-03 | NA | NA |
5. P | B4SM82 | 8-amino-7-oxononanoate synthase | 5.62e-11 | 2.02e-08 | NA | NA |
5. P | B1LZ88 | Serine hydroxymethyltransferase | 7.79e-10 | 1.99e-07 | NA | NA |
5. P | B7I6C5 | Histidinol-phosphate aminotransferase | 2.75e-09 | 4.52e-08 | NA | NA |
5. P | Q5HJI8 | Ornithine aminotransferase 1 | 3.42e-14 | 7.92e-03 | NA | NA |
5. P | A3PAX9 | Serine hydroxymethyltransferase | 3.53e-10 | 1.43e-07 | NA | NA |
5. P | Q3A3Z8 | Putative 8-amino-7-oxononanoate synthase | 1.02e-10 | 1.24e-08 | NA | NA |
5. P | A4W8S7 | Phosphoserine aminotransferase | 6.25e-14 | 2.53e-10 | NA | NA |
5. P | B1YMC6 | 8-amino-7-oxononanoate synthase | 2.44e-15 | 2.93e-07 | NA | NA |
5. P | Q1R9G2 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.01e-13 | 1.23e-03 | NA | NA |
5. P | C1ANM2 | Histidinol-phosphate aminotransferase | 9.03e-09 | 1.10e-06 | NA | NA |
5. P | Q92BC0 | Acetylornithine aminotransferase | 5.54e-14 | 1.58e-03 | NA | NA |
5. P | Q8XIK2 | L-seryl-tRNA(Sec) selenium transferase | 9.91e-07 | 1.15e-02 | NA | NA |
5. P | Q8TUZ5 | Acetylornithine aminotransferase | 3.63e-14 | 1.93e-02 | NA | NA |
5. P | P23034 | Aspartate aminotransferase | 2.12e-08 | 2.21e-06 | NA | NA |
5. P | B6J893 | Phosphoserine aminotransferase | 9.15e-14 | 1.13e-07 | NA | NA |
5. P | Q07805 | Ornithine aminotransferase | 4.25e-14 | 5.68e-03 | NA | NA |
5. P | Q7WP51 | Ornithine aminotransferase | 1.02e-13 | 2.15e-03 | NA | NA |
5. P | P77952 | L-glutamine:scyllo-inosose aminotransferase | 4.79e-09 | 5.07e-04 | NA | NA |
5. P | Q0T3A6 | Histidinol-phosphate aminotransferase | 4.79e-08 | 3.15e-09 | NA | NA |
5. P | Q2GLH3 | Serine hydroxymethyltransferase | 4.25e-10 | 1.04e-07 | NA | NA |
5. P | B8CMG9 | Phosphoserine aminotransferase | 9.16e-14 | 3.70e-09 | NA | NA |
5. P | Q28EN2 | O-phosphoseryl-tRNA(Sec) selenium transferase | 1.28e-06 | 2.54e-04 | NA | NA |
5. P | Q4KI72 | Histidinol-phosphate aminotransferase 1 | 2.31e-09 | 1.88e-09 | NA | NA |
5. P | Q1RDV1 | Phosphoserine aminotransferase | 4.27e-14 | 9.15e-10 | NA | NA |
5. P | Q17X40 | Glutamate-1-semialdehyde 2,1-aminomutase | 2.41e-09 | 4.47e-02 | NA | NA |
5. P | Q3SV41 | Histidinol-phosphate aminotransferase | 1.15e-13 | 2.60e-08 | NA | NA |
5. P | P53090 | Aromatic/aminoadipate aminotransferase 1 | 2.67e-05 | 7.87e-04 | NA | NA |
5. P | Q9SGU9 | Methionine gamma-lyase | 3.92e-09 | 1.31e-03 | NA | NA |
5. P | C1D8N3 | Phosphoserine aminotransferase | 4.94e-14 | 8.81e-10 | NA | NA |
5. P | B1LYP9 | 8-amino-7-oxononanoate synthase | 8.23e-11 | 3.73e-06 | NA | NA |
5. P | Q1CA74 | Phosphoserine aminotransferase | 7.72e-14 | 3.74e-10 | NA | NA |
5. P | Q46HB6 | Serine hydroxymethyltransferase | 2.62e-10 | 3.43e-07 | NA | NA |
5. P | Q66C50 | Histidinol-phosphate aminotransferase | 1.03e-07 | 2.60e-08 | NA | NA |
5. P | Q8Z5J9 | Histidinol-phosphate aminotransferase | 5.19e-08 | 1.56e-09 | NA | NA |
5. P | B4RB35 | Serine hydroxymethyltransferase | 5.95e-10 | 2.78e-06 | NA | NA |
5. P | Q81JY4 | Serine hydroxymethyltransferase | 2.07e-10 | 5.91e-08 | NA | NA |
5. P | Q24S01 | LL-diaminopimelate aminotransferase | 1.81e-07 | 2.42e-04 | NA | NA |
5. P | A5GIG4 | Serine hydroxymethyltransferase | 6.95e-10 | 5.71e-08 | NA | NA |
5. P | P69912 | Glutamate decarboxylase beta | 1.33e-10 | 5.63e-07 | NA | NA |
5. P | A7GDQ6 | Histidinol-phosphate aminotransferase | 8.59e-10 | 4.37e-11 | NA | NA |
5. P | Q5P791 | Histidinol-phosphate aminotransferase | 8.60e-10 | 4.18e-09 | NA | NA |
5. P | Q2S4G9 | Serine hydroxymethyltransferase | 1.22e-09 | 1.73e-09 | NA | NA |
5. P | Q7M181 | 2-aminohexano-6-lactam racemase | 3.10e-13 | 3.64e-03 | NA | NA |
5. P | A9BIK8 | Serine hydroxymethyltransferase | 8.86e-10 | 3.75e-07 | NA | NA |
5. P | P9WQ91 | Alanine aminotransferase | 1.25e-07 | 1.40e-04 | NA | NA |
5. P | A7MVI6 | Histidine decarboxylase | 3.22e-10 | 1.23e-10 | NA | NA |
5. P | Q819L4 | Arginine decarboxylase | 1.29e-09 | 2.72e-08 | NA | NA |
5. P | O13426 | Serine hydroxymethyltransferase, cytosolic | 1.11e-06 | 2.24e-06 | NA | NA |
5. P | B4ETL5 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.84e-13 | 4.18e-04 | NA | NA |
5. P | P46645 | Aspartate aminotransferase, cytoplasmic isozyme 1 | 1.37e-06 | 1.57e-04 | NA | NA |
5. P | B5QYQ7 | Phosphoserine aminotransferase | 3.28e-14 | 5.20e-10 | NA | NA |
5. P | B7JUI4 | Histidinol-phosphate aminotransferase | 1.97e-07 | 1.49e-10 | NA | NA |
5. P | B1JRE0 | Phosphoserine aminotransferase | 7.35e-14 | 7.35e-11 | NA | NA |
5. P | Q4A8E1 | Serine hydroxymethyltransferase | 1.95e-10 | 5.78e-08 | NA | NA |
5. P | B4SE02 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 5.30e-11 | 8.68e-08 | NA | NA |
5. P | Q8F814 | LL-diaminopimelate aminotransferase | 4.81e-07 | 6.22e-05 | NA | NA |
5. P | Q6U1I3 | dTDP-4-amino-4,6-dideoxy-D-glucose transaminase | 6.05e-10 | 1.49e-07 | NA | NA |
5. P | Q7W2Y3 | Histidinol-phosphate aminotransferase 2 | 4.63e-08 | 2.05e-08 | NA | NA |
5. P | A6WR52 | Serine hydroxymethyltransferase | 3.34e-10 | 2.41e-09 | NA | NA |
5. P | B3EMW0 | Serine hydroxymethyltransferase | 7.59e-10 | 7.22e-09 | NA | NA |
5. P | A3MYT3 | Serine hydroxymethyltransferase | 2.96e-10 | 5.85e-08 | NA | NA |
5. P | C5D3D2 | Histidinol-phosphate aminotransferase | 4.58e-10 | 4.33e-06 | NA | NA |
5. P | Q1IDA2 | Phosphoserine aminotransferase | 8.28e-14 | 2.93e-09 | NA | NA |
5. P | Q5WYH4 | Serine hydroxymethyltransferase | 4.44e-10 | 6.73e-07 | NA | NA |
5. P | Q8DH57 | LL-diaminopimelate aminotransferase | 1.97e-07 | 1.91e-05 | NA | NA |
5. P | Q5JGX5 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.97e-08 | 8.98e-07 | NA | NA |
5. P | Q7X8D4 | Serine decarboxylase 3 | 9.35e-10 | 3.57e-03 | NA | NA |
5. P | Q6FXA4 | Acetylornithine aminotransferase, mitochondrial | 1.22e-09 | 3.74e-02 | NA | NA |
5. P | A1JJH3 | Tryptophanase | 2.74e-07 | 2.08e-07 | NA | NA |
5. P | A0PXP5 | Histidinol-phosphate aminotransferase | 2.09e-09 | 1.48e-10 | NA | NA |
5. P | A0LI16 | Serine hydroxymethyltransferase | 2.27e-10 | 1.13e-08 | NA | NA |
5. P | A4T9L3 | 8-amino-7-oxononanoate synthase | 1.77e-14 | 3.03e-08 | NA | NA |
5. P | Q1J1W0 | Serine hydroxymethyltransferase | 3.78e-10 | 8.07e-10 | NA | NA |
5. P | A7ZJZ6 | Phosphoserine aminotransferase | 6.72e-14 | 7.97e-10 | NA | NA |
5. P | B0V7Q2 | Histidinol-phosphate aminotransferase | 2.96e-09 | 6.49e-08 | NA | NA |
5. P | Q97C04 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.19e-08 | 5.26e-08 | NA | NA |
5. P | Q03Y25 | Serine hydroxymethyltransferase | 2.40e-10 | 3.83e-08 | NA | NA |
5. P | P96847 | Valine--pyruvate aminotransferase | 4.38e-08 | 9.86e-10 | NA | NA |
5. P | B7UT58 | Histidinol-phosphate aminotransferase | 4.73e-08 | 1.04e-09 | NA | NA |
5. P | A8F2M5 | Serine hydroxymethyltransferase | 4.47e-10 | 4.49e-07 | NA | NA |
5. P | Q5SHW0 | Cystathionine beta-lyase | 4.75e-08 | 3.00e-02 | NA | NA |
5. P | Q5HMB0 | Serine hydroxymethyltransferase | 1.76e-10 | 2.58e-07 | NA | NA |
5. P | B4UCB1 | 8-amino-7-oxononanoate synthase | 3.44e-15 | 4.85e-08 | NA | NA |
5. P | Q9CC12 | Acetylornithine aminotransferase | 5.58e-14 | 1.32e-02 | NA | NA |
5. P | B9JV74 | Serine hydroxymethyltransferase | 6.25e-10 | 1.35e-07 | NA | NA |
5. P | B0CEI9 | Serine hydroxymethyltransferase | 7.25e-10 | 7.32e-05 | NA | NA |
5. P | P44425 | Aspartate aminotransferase | 8.28e-06 | 1.70e-04 | NA | NA |
5. P | B0T1I5 | Serine hydroxymethyltransferase | 3.65e-10 | 2.10e-06 | NA | NA |
5. P | A6GXC2 | Phosphoserine aminotransferase | 1.53e-12 | 6.79e-14 | NA | NA |
5. P | B6IBG8 | Succinylornithine transaminase | 3.43e-14 | 1.05e-02 | NA | NA |
5. P | Q9ZLN3 | 8-amino-7-oxononanoate synthase | 4.77e-15 | 1.40e-09 | NA | NA |
5. P | B5BFB9 | Histidinol-phosphate aminotransferase | 4.89e-08 | 1.17e-09 | NA | NA |
5. P | Q9KM65 | CAI-1 autoinducer synthase | 1.17e-10 | 1.93e-08 | NA | NA |
5. P | P44502 | Cystathionine gamma-synthase | 2.12e-09 | 2.86e-08 | NA | NA |
5. P | Q5BC73 | Kynureninase 2 | 0.00e+00 | 3.77e-06 | NA | NA |
5. P | A1DGW4 | Kynureninase 1 | 0.00e+00 | 4.25e-10 | NA | NA |
5. P | Q5RFK5 | Serine hydroxymethyltransferase, cytosolic | 1.00e-06 | 1.42e-02 | NA | NA |
5. P | Q31XT6 | Serine hydroxymethyltransferase | 2.73e-10 | 1.69e-08 | NA | NA |
5. P | P24087 | Acetylornithine aminotransferase | 2.52e-10 | 7.05e-03 | NA | NA |
5. P | C5A7J0 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.18e-07 | 4.60e-07 | NA | NA |
5. P | B7M400 | Histidinol-phosphate aminotransferase | 6.00e-08 | 1.54e-09 | NA | NA |
5. P | C4ZYY6 | Tryptophanase | 4.00e-07 | 2.61e-03 | NA | NA |
5. P | P10356 | Uncharacterized protein YER152C | 3.07e-08 | 1.67e-11 | NA | NA |
5. P | Q7NNL4 | Putative 8-amino-7-oxononanoate synthase | 2.11e-15 | 1.89e-08 | NA | NA |
5. P | B9E168 | Histidinol-phosphate aminotransferase | 2.06e-09 | 1.30e-07 | NA | NA |
5. P | Q6LPR3 | 8-amino-7-oxononanoate synthase | 7.71e-11 | 5.43e-06 | NA | NA |
5. P | Q42472 | Glutamate decarboxylase 2 | 1.11e-15 | 7.86e-07 | NA | NA |
5. P | Q9ZQI7 | Aminotransferase ALD1, chloroplastic | 2.18e-07 | 9.72e-03 | NA | NA |
5. P | Q31GD4 | Histidinol-phosphate aminotransferase 2 | 9.42e-10 | 5.66e-06 | NA | NA |
5. P | Q5GTS7 | Serine hydroxymethyltransferase | 2.78e-10 | 9.44e-06 | NA | NA |
5. P | B8EPH9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.68e-14 | 2.86e-09 | NA | NA |
5. P | Q1QU94 | Serine hydroxymethyltransferase | 3.03e-10 | 1.03e-06 | NA | NA |
5. P | Q3K8U2 | Histidinol-phosphate aminotransferase 2 | 1.46e-09 | 3.81e-05 | NA | NA |
5. P | Q06429 | 1-aminocyclopropane-1-carboxylate synthase-like protein 1 | 6.14e-05 | 7.24e-05 | NA | NA |
5. P | Q9Y7S6 | Aromatic amino acid aminotransferase C569.07 | 2.94e-06 | 2.77e-05 | NA | NA |
5. P | Q0TH82 | Succinylornithine transaminase | 2.45e-14 | 7.44e-03 | NA | NA |
5. P | Q7W1E4 | Ornithine aminotransferase | 9.64e-14 | 2.15e-03 | NA | NA |
5. P | A9N1W0 | Serine hydroxymethyltransferase | 2.97e-10 | 4.47e-08 | NA | NA |
5. P | B5XTK7 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.71e-13 | 2.07e-03 | NA | NA |
5. P | Q8KC36 | Serine hydroxymethyltransferase | 1.44e-09 | 6.51e-07 | NA | NA |
5. P | Q2JPM4 | Histidinol-phosphate aminotransferase | 1.43e-10 | 5.04e-11 | NA | NA |
5. P | Q7MH19 | Acetylornithine aminotransferase | 3.84e-14 | 1.75e-02 | NA | NA |
5. P | Q47GP2 | Histidinol-phosphate aminotransferase 1 | 7.93e-10 | 1.37e-08 | NA | NA |
5. P | A7MX30 | 8-amino-7-oxononanoate synthase | 6.38e-11 | 1.23e-08 | NA | NA |
5. P | B9K9R9 | Histidinol-phosphate aminotransferase | 2.41e-08 | 1.04e-08 | NA | NA |
5. P | Q253I4 | Serine hydroxymethyltransferase | 1.61e-09 | 1.41e-03 | NA | NA |
5. P | Q6AQK2 | Histidinol-phosphate aminotransferase | 6.70e-10 | 1.77e-07 | NA | NA |
5. P | A5CZ78 | Histidinol-phosphate aminotransferase | 2.56e-10 | 7.94e-11 | NA | NA |
5. P | Q7V0G0 | Acetylornithine aminotransferase | 2.95e-13 | 6.92e-03 | NA | NA |
5. P | P9WGI7 | Serine hydroxymethyltransferase 2 | 4.26e-10 | 1.13e-09 | NA | NA |
5. P | C1KYV6 | Serine hydroxymethyltransferase | 2.56e-10 | 3.88e-07 | NA | NA |
5. P | B7MVM7 | Succinylornithine transaminase | 2.44e-14 | 7.44e-03 | NA | NA |
5. P | Q2L2T1 | Phosphoserine aminotransferase | 3.11e-14 | 6.44e-10 | NA | NA |
5. P | P60120 | Putative pyridoxal phosphate-dependent acyltransferase | 4.09e-11 | 6.58e-07 | NA | NA |
5. P | Q3AD52 | Histidinol-phosphate aminotransferase 1 | 1.31e-13 | 1.92e-06 | NA | NA |
5. P | B7JLX2 | Putative 8-amino-7-oxononanoate synthase | 7.35e-11 | 3.55e-07 | NA | NA |
5. P | Q7UNC3 | Histidinol-phosphate aminotransferase | 1.40e-10 | 3.03e-07 | NA | NA |
5. P | A0RR46 | L-seryl-tRNA(Sec) selenium transferase | 2.16e-06 | 6.74e-03 | NA | NA |
5. P | Q324B6 | 8-amino-7-oxononanoate synthase | 2.14e-11 | 3.00e-06 | NA | NA |
5. P | P0A679 | Histidinol-phosphate aminotransferase | 9.22e-09 | 1.10e-06 | NA | NA |
5. P | O28255 | Histidinol-phosphate aminotransferase 2 | 2.99e-09 | 1.23e-09 | NA | NA |
5. P | P0AB78 | 2-amino-3-ketobutyrate coenzyme A ligase | 6.84e-11 | 4.77e-06 | NA | NA |
5. P | Q39M27 | Histidinol-phosphate aminotransferase 3 | 2.34e-09 | 3.85e-06 | NA | NA |
5. P | C4ZSB0 | Histidinol-phosphate aminotransferase | 6.95e-08 | 1.54e-09 | NA | NA |
5. P | C1C6Z9 | Serine hydroxymethyltransferase | 5.04e-10 | 3.49e-08 | NA | NA |
5. P | A7ZJI5 | 8-amino-7-oxononanoate synthase | 2.62e-11 | 3.85e-06 | NA | NA |
5. P | Q92C05 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.61e-08 | 2.24e-06 | NA | NA |
5. P | B7GTL3 | Serine hydroxymethyltransferase | 5.41e-10 | 8.86e-09 | NA | NA |
5. P | A8G2R8 | Serine hydroxymethyltransferase | 4.14e-10 | 2.08e-07 | NA | NA |
5. P | B3QM32 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.36e-11 | 1.32e-06 | NA | NA |
5. P | C4K1H9 | Serine hydroxymethyltransferase | 4.86e-10 | 3.13e-06 | NA | NA |
5. P | A0A0J6G7P5 | L-methionine gamma-lyase | 8.76e-09 | 3.07e-06 | NA | NA |
5. P | Q46IX2 | LL-diaminopimelate aminotransferase | 1.25e-07 | 3.77e-05 | NA | NA |
5. P | Q97R16 | Serine hydroxymethyltransferase | 5.58e-10 | 3.75e-08 | NA | NA |
5. P | Q1LU81 | Serine hydroxymethyltransferase | 4.26e-10 | 2.54e-08 | NA | NA |
5. P | Q81I05 | Putative pyridoxal phosphate-dependent acyltransferase | 7.68e-11 | 5.88e-07 | NA | NA |
5. P | Q4JU69 | Serine hydroxymethyltransferase | 4.30e-10 | 3.04e-09 | NA | NA |
5. P | Q28TL1 | Histidinol-phosphate aminotransferase | 9.38e-10 | 7.73e-08 | NA | NA |
5. P | Q79VI4 | O-acetyl-L-homoserine sulfhydrylase | 6.49e-08 | 1.46e-04 | NA | NA |
5. P | Q93703 | Tyrosine aminotransferase | 6.41e-08 | 1.22e-02 | NA | NA |
5. P | B1X8W6 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.81e-14 | 1.82e-03 | NA | NA |
5. P | P59320 | Acetylornithine aminotransferase | 4.04e-14 | 2.97e-02 | NA | NA |
5. P | A8ZUS7 | Putative 8-amino-7-oxononanoate synthase | 3.89e-15 | 2.90e-09 | NA | NA |
5. P | Q9V1I4 | Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase | 5.50e-13 | 2.18e-02 | NA | NA |
5. P | Q3SMB8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.00e-10 | 6.80e-09 | NA | NA |
5. P | Q1IS84 | Serine hydroxymethyltransferase | 2.24e-10 | 5.98e-08 | NA | NA |
5. P | A7UX13 | Hercynylcysteine sulfoxide lyase | 0.00e+00 | 2.98e-20 | NA | NA |
5. P | B8IYW9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.22e-08 | 2.48e-08 | NA | NA |
5. P | A5G937 | L-seryl-tRNA(Sec) selenium transferase | 1.52e-06 | 1.34e-02 | NA | NA |
5. P | Q7U4C3 | LL-diaminopimelate aminotransferase | 2.88e-07 | 1.72e-03 | NA | NA |
5. P | Q07IG8 | Histidinol-phosphate aminotransferase | 1.14e-13 | 4.96e-08 | NA | NA |
5. P | A3Q146 | 8-amino-7-oxononanoate synthase | 1.24e-14 | 4.66e-09 | NA | NA |
5. P | A4Y757 | Phosphoserine aminotransferase | 1.02e-13 | 5.08e-09 | NA | NA |
5. P | O86565 | Serine hydroxymethyltransferase | 9.14e-11 | 2.21e-09 | NA | NA |
5. P | C3KVX5 | Histidinol-phosphate aminotransferase | 6.98e-14 | 1.91e-11 | NA | NA |
5. P | A6QBY8 | Histidinol-phosphate aminotransferase | 4.76e-09 | 4.57e-08 | NA | NA |
5. P | B5F159 | Phosphoserine aminotransferase | 2.92e-14 | 5.20e-10 | NA | NA |
5. P | P56115 | Glutamate-1-semialdehyde 2,1-aminomutase | 6.17e-13 | 2.38e-02 | NA | NA |
5. P | A5U2S6 | 8-amino-7-oxononanoate synthase | 1.94e-14 | 1.90e-07 | NA | NA |
5. P | A6UQL9 | Putative 8-amino-7-oxononanoate synthase | 8.46e-11 | 2.16e-05 | NA | NA |
5. P | O84395 | LL-diaminopimelate aminotransferase | 1.36e-07 | 3.93e-09 | NA | NA |
5. P | A1R558 | Histidinol-phosphate aminotransferase | 1.52e-07 | 4.63e-05 | NA | NA |
5. P | P18335 | Acetylornithine/succinyldiaminopimelate aminotransferase | 1.05e-13 | 9.30e-03 | NA | NA |
5. P | Q8D268 | Phosphoserine aminotransferase | 4.16e-14 | 3.68e-11 | NA | NA |
5. P | A8AIH6 | Phosphoserine aminotransferase | 3.60e-14 | 1.73e-09 | NA | NA |
5. P | A9NC17 | Phosphoserine aminotransferase | 1.56e-13 | 2.47e-07 | NA | NA |
5. P | Q7NPW2 | 8-amino-7-oxononanoate synthase | 6.66e-15 | 8.79e-07 | NA | NA |
5. P | O13940 | Probable low-specificity L-threonine aldolase | 2.04e-09 | 2.56e-09 | NA | NA |
5. P | Q4JAM7 | Glutamate-1-semialdehyde 2,1-aminomutase | 1.52e-12 | 8.58e-03 | NA | NA |
5. P | B5XPE6 | Histidinol-phosphate aminotransferase | 5.35e-08 | 1.28e-09 | NA | NA |
5. P | Q8Y4B2 | Serine hydroxymethyltransferase | 2.54e-10 | 4.30e-07 | NA | NA |
5. P | Q2GEI3 | Serine hydroxymethyltransferase | 2.54e-10 | 4.47e-08 | NA | NA |
5. P | O84439 | Serine hydroxymethyltransferase | 1.16e-09 | 1.67e-03 | NA | NA |
5. P | Q0DKE8 | Tryptophan aminotransferase-related protein 1 | 1.80e-04 | 3.74e-03 | NA | NA |
5. P | Q8Y7D4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.23e-08 | 2.14e-06 | NA | NA |
5. P | A7MJP4 | Histidinol-phosphate aminotransferase | 7.47e-08 | 6.36e-10 | NA | NA |
5. P | Q2H9P7 | Kynureninase 1 | 0.00e+00 | 5.97e-10 | NA | NA |
5. P | Q4K4T3 | 8-amino-7-oxononanoate synthase | 1.55e-15 | 7.05e-09 | NA | NA |
5. P | Q0IDD8 | Serine hydroxymethyltransferase | 7.69e-10 | 1.01e-07 | NA | NA |
5. P | P21549 | Serine--pyruvate aminotransferase | 0.00e+00 | 2.38e-13 | NA | NA |
5. P | B5E4E3 | Serine hydroxymethyltransferase | NA | 2.79e-08 | NA | NA |
5. P | B9KDM7 | Phosphoserine aminotransferase | 1.24e-13 | 7.74e-11 | NA | NA |
5. P | A3CWS8 | Histidinol-phosphate aminotransferase | 5.57e-09 | 1.77e-10 | NA | NA |
5. P | Q8YM38 | LL-diaminopimelate aminotransferase 1 | 2.62e-07 | 4.26e-04 | NA | NA |
5. P | Q8ESS3 | Histidinol-phosphate aminotransferase 1 | 1.22e-13 | 2.52e-11 | NA | NA |
5. P | A3M736 | Serine hydroxymethyltransferase | 6.59e-10 | 8.86e-06 | NA | NA |
5. P | Q46C09 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 4.88e-15 | 3.76e-23 | NA | NA |
5. P | Q97GV1 | Serine hydroxymethyltransferase | 1.54e-10 | 5.03e-07 | NA | NA |
5. P | B1IX30 | Tryptophanase | 4.26e-07 | 2.61e-03 | NA | NA |
5. P | Q7MEH7 | Serine hydroxymethyltransferase 2 | 5.11e-10 | 3.17e-07 | NA | NA |
5. P | Q04ZF5 | Serine hydroxymethyltransferase | 1.84e-10 | 1.24e-07 | NA | NA |
5. P | B3EFN5 | Serine hydroxymethyltransferase | 1.38e-09 | 2.12e-08 | NA | NA |
5. P | P36605 | Histidinol-phosphate aminotransferase | 4.17e-09 | 1.98e-09 | NA | NA |
5. P | Q7MLU9 | 8-amino-7-oxononanoate synthase | 4.95e-11 | 1.78e-08 | NA | NA |
5. P | Q0TNJ4 | L-seryl-tRNA(Sec) selenium transferase | 1.27e-06 | 5.19e-03 | NA | NA |
5. P | A7H556 | Histidinol-phosphate aminotransferase | 7.84e-10 | 1.32e-08 | NA | NA |
5. P | A0PP15 | Histidinol-phosphate aminotransferase | 5.55e-09 | 1.72e-06 | NA | NA |
5. P | A5VZ57 | Histidinol-phosphate aminotransferase | 8.00e-08 | 2.20e-08 | NA | NA |
5. P | Q5HP24 | Acetylornithine aminotransferase | 3.79e-14 | 8.50e-03 | NA | NA |
5. P | A4UBV5 | Kynureninase | 0.00e+00 | 4.14e-04 | NA | NA |
5. P | P18949 | Cystathionine beta-lyase | 2.58e-05 | 5.63e-07 | NA | NA |
5. P | Q87WV6 | Histidinol-phosphate aminotransferase | 1.76e-09 | 8.28e-10 | NA | NA |
5. P | A4SPR6 | 8-amino-7-oxononanoate synthase | 6.66e-16 | 2.55e-07 | NA | NA |
5. P | B7M8A7 | Serine hydroxymethyltransferase | 2.70e-10 | 1.69e-08 | NA | NA |
5. P | A3Q7J9 | Putative phenylalanine aminotransferase | 2.02e-09 | 3.27e-09 | NA | NA |
5. P | B7HNZ0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.90e-08 | 9.24e-06 | NA | NA |
5. P | Q4FP52 | Histidinol-phosphate aminotransferase | 1.03e-09 | 9.99e-10 | NA | NA |
5. P | D4AU29 | Aminotransferase swnA | 9.31e-06 | 3.75e-04 | NA | NA |
5. P | Q0K7W0 | Serine hydroxymethyltransferase | 1.34e-10 | 1.98e-08 | NA | NA |
5. P | B5XNI6 | Serine hydroxymethyltransferase | 2.60e-10 | 6.05e-08 | NA | NA |
5. P | B2IH50 | 8-amino-7-oxononanoate synthase | 5.68e-11 | 2.36e-06 | NA | NA |
5. P | O27624 | Histidinol-phosphate aminotransferase | 6.63e-10 | 9.50e-07 | NA | NA |
5. P | B2JF00 | Phosphoserine aminotransferase | 9.11e-14 | 2.89e-12 | NA | NA |
5. P | Q7TVQ0 | Putative phenylalanine aminotransferase | 1.27e-09 | 3.13e-07 | NA | NA |
5. P | Q67Y55 | Probable aminotransferase TAT1 | 5.88e-08 | 3.48e-05 | NA | NA |
5. P | Q21Y51 | Phosphoserine aminotransferase | 1.85e-14 | 1.89e-12 | NA | NA |
5. P | B8D9A2 | Phosphoserine aminotransferase | 2.28e-14 | 9.48e-15 | NA | NA |
5. P | Q89AX7 | Histidinol-phosphate aminotransferase | 3.13e-09 | 4.70e-10 | NA | NA |
5. P | B0UML5 | Serine hydroxymethyltransferase | 7.24e-10 | 3.97e-07 | NA | NA |
5. P | B1IBI3 | Serine hydroxymethyltransferase | 5.06e-10 | 4.07e-08 | NA | NA |
5. P | Q58992 | Serine hydroxymethyltransferase | 2.10e-10 | 6.05e-11 | NA | NA |
5. P | Q7V335 | Serine hydroxymethyltransferase | 3.59e-10 | 6.13e-08 | NA | NA |
5. P | Q87JQ6 | Tryptophanase | 2.61e-07 | 4.47e-06 | NA | NA |
5. P | A5U2V6 | Histidinol-phosphate aminotransferase | 8.94e-09 | 1.10e-06 | NA | NA |
5. P | A1AQT1 | 8-amino-7-oxononanoate synthase | 2.78e-15 | 9.53e-09 | NA | NA |
5. P | B1LL35 | Tryptophanase | 4.41e-07 | 2.43e-03 | NA | NA |
5. P | B8FZ69 | Serine hydroxymethyltransferase | 1.95e-10 | 1.26e-08 | NA | NA |
5. P | Q3BXI8 | Serine hydroxymethyltransferase | 4.82e-10 | 9.41e-08 | NA | NA |
5. P | E6SFG5 | Tyrosine phenol-lyase | 2.16e-08 | 8.43e-05 | NA | NA |
5. P | Q62GE0 | Histidinol-phosphate aminotransferase 1 | 1.24e-09 | 1.63e-08 | NA | NA |
5. P | P23542 | Aspartate aminotransferase, cytoplasmic | 1.43e-05 | 3.54e-04 | NA | NA |
5. P | A0RXB3 | Glutamate-1-semialdehyde 2,1-aminomutase 1 | 4.71e-14 | 8.35e-03 | NA | NA |
5. P | A4SFY3 | Serine hydroxymethyltransferase | 1.07e-09 | 4.16e-08 | NA | NA |
5. P | A4W0D4 | Phosphoserine aminotransferase | 6.88e-15 | 1.98e-10 | NA | NA |
5. P | Q63XM1 | Histidinol-phosphate aminotransferase 1 | 1.04e-09 | 1.68e-09 | NA | NA |
5. P | B4TMR6 | Histidinol-phosphate aminotransferase | 5.24e-08 | 1.17e-09 | NA | NA |
5. P | B7I2R7 | Serine hydroxymethyltransferase | 6.83e-10 | 8.86e-06 | NA | NA |
5. P | P70712 | Kynureninase | 0.00e+00 | 4.31e-11 | NA | NA |
5. P | Q88QX1 | 8-amino-7-oxononanoate synthase | 8.88e-16 | 5.60e-09 | NA | NA |
5. P | A0RIB9 | Putative 8-amino-7-oxononanoate synthase | 1.09e-10 | 4.02e-07 | NA | NA |
5. P | Q7WPH6 | Serine hydroxymethyltransferase 1 | 6.01e-10 | 1.71e-07 | NA | NA |
5. P | A1A2H6 | Histidinol-phosphate aminotransferase | 6.49e-09 | 4.81e-07 | NA | NA |
5. P | Q12Q48 | Serine hydroxymethyltransferase | 3.69e-10 | 4.28e-09 | NA | NA |
5. P | B4T141 | Phosphoserine aminotransferase | 5.58e-14 | 8.28e-10 | NA | NA |
5. P | A8MGL7 | Serine hydroxymethyltransferase | 1.82e-10 | 6.34e-08 | NA | NA |
5. P | B7IWN1 | Putative 8-amino-7-oxononanoate synthase | 1.14e-10 | 3.35e-07 | NA | NA |
5. P | Q7W6Q1 | Histidinol-phosphate aminotransferase 1 | 5.94e-10 | 1.63e-08 | NA | NA |
5. P | Q7WH76 | Putative 8-amino-7-oxononanoate synthase | 6.75e-11 | 5.53e-09 | NA | NA |
5. P | Q1C9R1 | Histidinol-phosphate aminotransferase | 1.06e-07 | 1.76e-08 | NA | NA |
5. P | Q8DTM1 | Asparagine--oxo-acid transaminase | 1.85e-08 | 1.07e-05 | NA | NA |
5. P | Q8XWN8 | Acetylornithine aminotransferase | 6.02e-14 | 1.04e-02 | NA | NA |
5. P | B7ID58 | 8-amino-7-oxononanoate synthase | 9.47e-11 | 3.51e-07 | NA | NA |
5. P | A1BE03 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.00e-11 | 6.79e-06 | NA | NA |
5. P | B2IGK3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.16e-10 | 5.46e-09 | NA | NA |
5. P | B1LP20 | Histidinol-phosphate aminotransferase | 4.82e-08 | 1.02e-09 | NA | NA |
5. P | P81435 | Phosphoserine aminotransferase | 4.46e-14 | 5.16e-12 | NA | NA |
5. P | Q43309 | 1-aminocyclopropane-1-carboxylate synthase 4 | 8.67e-06 | 2.07e-05 | NA | NA |
5. P | A0KGY8 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 2.39e-13 | 1.29e-03 | NA | NA |
5. P | Q9ALN8 | dTDP-4-dehydro-2,6-dideoxy-D-glucose 3-dehydratase | 6.09e-08 | 1.61e-06 | NA | NA |
5. P | B0K735 | Histidinol-phosphate aminotransferase | 3.00e-13 | 1.78e-08 | NA | NA |
5. P | P66804 | Serine hydroxymethyltransferase | 1.94e-10 | 1.44e-06 | NA | NA |
5. P | B5YU77 | Histidinol-phosphate aminotransferase | 5.19e-08 | 1.75e-09 | NA | NA |
5. P | Q8DTQ4 | Histidinol-phosphate aminotransferase | 4.39e-14 | 4.95e-10 | NA | NA |
5. P | Q88R12 | Serine hydroxymethyltransferase 1 | 4.81e-10 | 2.58e-07 | NA | NA |
5. P | B2IDA4 | Histidinol-phosphate aminotransferase | 5.46e-14 | 6.42e-08 | NA | NA |
5. P | Q8R7C1 | Acetylornithine aminotransferase | 1.68e-14 | 1.06e-02 | NA | NA |
5. P | Q8DJ97 | Putative 8-amino-7-oxononanoate synthase | 3.89e-15 | 7.58e-09 | NA | NA |
5. P | A9L2Y2 | Phosphoserine aminotransferase | 1.39e-09 | 1.10e-08 | NA | NA |
5. P | A0ALM4 | Serine hydroxymethyltransferase | 2.65e-10 | 3.20e-07 | NA | NA |
5. P | Q6GBT7 | Putative pyridoxal phosphate-dependent acyltransferase | 4.53e-11 | 6.58e-07 | NA | NA |
5. P | Q3KCC3 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 2.67e-13 | 1.50e-02 | NA | NA |
5. P | Q7UQL3 | Phosphoserine aminotransferase | 5.94e-14 | 8.44e-13 | NA | NA |
5. P | Q731H9 | Putative 8-amino-7-oxononanoate synthase | 1.05e-10 | 1.90e-07 | NA | NA |
5. P | C6DF64 | Phosphoserine aminotransferase | 7.29e-14 | 2.21e-09 | NA | NA |
5. P | Q82UP3 | Acetylornithine aminotransferase | 1.83e-14 | 2.39e-04 | NA | NA |
5. P | B9DS48 | Serine hydroxymethyltransferase | 7.38e-10 | 1.11e-07 | NA | NA |
5. P | Q12D74 | 8-amino-7-oxononanoate synthase 2 | 1.31e-10 | 1.74e-05 | NA | NA |
5. P | P75823 | Low specificity L-threonine aldolase | 1.26e-13 | 3.83e-13 | NA | NA |
5. P | A5IXK9 | Serine hydroxymethyltransferase | 3.60e-10 | 3.03e-06 | NA | NA |
5. P | A5FVN2 | Histidinol-phosphate aminotransferase | 1.06e-13 | 1.78e-06 | NA | NA |
5. P | Q9Y617 | Phosphoserine aminotransferase | 1.04e-13 | 1.14e-10 | NA | NA |
5. P | A7ICA9 | Histidinol-phosphate aminotransferase | 2.10e-13 | 2.19e-06 | NA | NA |
5. P | Q9VAN0 | Probable phosphoserine aminotransferase | 5.78e-14 | 1.61e-08 | NA | NA |
5. P | B5ZA72 | Glutamate-1-semialdehyde 2,1-aminomutase | 9.32e-13 | 1.77e-02 | NA | NA |
5. P | Q14GZ5 | Serine hydroxymethyltransferase | 4.55e-10 | 1.18e-06 | NA | NA |
5. P | C4ZQ33 | Phosphoserine aminotransferase | 6.52e-14 | 1.68e-09 | NA | NA |
5. P | Q2N7G6 | Histidinol-phosphate aminotransferase | 3.19e-13 | 2.96e-08 | NA | NA |
5. P | Q7NDX4 | LL-diaminopimelate aminotransferase | 2.15e-07 | 5.66e-06 | NA | NA |
5. P | Q7W2N9 | Acetylornithine aminotransferase 2 | 6.73e-14 | 5.78e-03 | NA | NA |
5. P | B1I4F9 | Putative 8-amino-7-oxononanoate synthase | 7.10e-11 | 8.04e-07 | NA | NA |
5. P | Q81MB0 | Putative 8-amino-7-oxononanoate synthase | 8.99e-11 | 3.55e-07 | NA | NA |
5. P | B1IW24 | Phosphoserine aminotransferase | 7.06e-14 | 7.49e-10 | NA | NA |
5. P | Q3MBD8 | Serine hydroxymethyltransferase | 9.33e-10 | 3.85e-06 | NA | NA |
5. P | Q3JP81 | Serine hydroxymethyltransferase 1 | 1.27e-10 | 4.52e-08 | NA | NA |
5. P | B0T014 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.30e-10 | 1.56e-09 | NA | NA |
5. P | Q9ZCB8 | 5-aminolevulinate synthase | 2.49e-11 | 1.17e-07 | NA | NA |
5. P | Q3IZN2 | Serine hydroxymethyltransferase | 6.17e-10 | 2.01e-06 | NA | NA |
5. P | Q8P122 | Serine hydroxymethyltransferase | 4.94e-10 | 5.85e-08 | NA | NA |
5. P | P37419 | 2-amino-3-ketobutyrate coenzyme A ligase | 4.90e-11 | 8.76e-06 | NA | NA |
5. P | B4SYW9 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 7.37e-14 | 9.89e-04 | NA | NA |
5. P | Q9PET2 | Serine hydroxymethyltransferase | 5.13e-10 | 3.10e-07 | NA | NA |
5. P | Q58365 | Histidinol-phosphate aminotransferase | 4.85e-10 | 6.65e-07 | NA | NA |
5. P | Q9WVM8 | Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial | 3.55e-06 | 3.85e-05 | NA | NA |
5. P | Q2RK33 | LL-diaminopimelate aminotransferase | 1.43e-07 | 1.32e-06 | NA | NA |
5. P | Q54IJ3 | Glutamate decarboxylase B | 3.16e-11 | 4.07e-08 | NA | NA |
5. P | P95468 | Aromatic-amino-acid aminotransferase | 5.97e-07 | 1.85e-04 | NA | NA |
5. P | B5F073 | 8-amino-7-oxononanoate synthase | 2.12e-11 | 3.39e-07 | NA | NA |
5. P | A0KU60 | Serine hydroxymethyltransferase | 3.21e-10 | 3.31e-09 | NA | NA |
5. P | D3QY10 | GDP-4-keto-6-deoxy-D-mannose 3-dehydratase | 1.76e-13 | 1.32e-05 | NA | NA |
5. P | A7MES8 | Phosphoserine aminotransferase | 3.99e-14 | 1.30e-10 | NA | NA |
5. P | Q9WY57 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.28e-07 | 3.57e-08 | NA | NA |
5. P | C4ZZA4 | Succinylornithine transaminase | 2.55e-14 | 1.05e-02 | NA | NA |
5. P | B7NT29 | Succinylornithine transaminase | 3.06e-14 | 7.92e-03 | NA | NA |
5. P | B6I5C4 | Serine hydroxymethyltransferase | 2.72e-10 | 1.69e-08 | NA | NA |
5. P | A8F8M6 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.01e-10 | 7.13e-08 | NA | NA |
5. P | Q477A3 | 8-amino-7-oxononanoate synthase | 9.02e-11 | 3.13e-07 | NA | NA |
5. P | B7NR10 | Tryptophanase | 4.92e-07 | 2.61e-03 | NA | NA |
5. P | Q63Y23 | 8-amino-7-oxononanoate synthase | 1.08e-10 | 1.86e-07 | NA | NA |
5. P | Q58737 | Uncharacterized protein MJ1341 | 1.42e-12 | 3.71e-03 | NA | NA |
5. P | Q3AET5 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.68e-08 | 3.62e-08 | NA | NA |
5. P | Q1GGA4 | Serine hydroxymethyltransferase | 5.62e-10 | 2.12e-08 | NA | NA |
5. P | O85746 | Tyrosine aminotransferase | 1.15e-05 | 1.81e-05 | NA | NA |
5. P | B4TRT8 | Phosphoserine aminotransferase | 3.89e-14 | 5.20e-10 | NA | NA |
5. P | Q7RXY2 | Kynureninase 2 | 0.00e+00 | 1.80e-13 | NA | NA |
5. P | B3QUT6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.71e-11 | 1.82e-08 | NA | NA |
5. P | Q5PII3 | Serine hydroxymethyltransferase | 2.88e-10 | 4.47e-08 | NA | NA |
5. P | B1ZJN1 | Serine hydroxymethyltransferase | 3.62e-10 | 3.03e-07 | NA | NA |
5. P | B8HR59 | Serine hydroxymethyltransferase | 5.74e-10 | 1.27e-06 | NA | NA |
5. P | P38021 | Ornithine aminotransferase | 3.63e-14 | 3.71e-03 | NA | NA |
5. P | P56990 | Serine hydroxymethyltransferase | 2.45e-10 | 2.30e-05 | NA | NA |
5. P | C3P210 | Phosphoserine aminotransferase | 3.63e-14 | 3.29e-13 | NA | NA |
5. P | A6X1Y9 | Serine hydroxymethyltransferase | 3.11e-10 | 3.17e-06 | NA | NA |
5. P | A1AYS1 | L-seryl-tRNA(Sec) selenium transferase | 7.92e-06 | 2.50e-02 | NA | NA |
5. P | Q58097 | (5-formylfuran-3-yl)methyl phosphate transaminase | 1.39e-08 | 1.60e-09 | NA | NA |
5. P | A1VR16 | Phosphoserine aminotransferase | 6.11e-14 | 3.78e-12 | NA | NA |
5. P | P16246 | Histidinol-phosphate aminotransferase | 2.30e-09 | 5.63e-07 | NA | NA |
5. P | P57397 | Phosphoserine aminotransferase | 2.33e-14 | 9.48e-15 | NA | NA |
5. P | B2GM31 | Serine hydroxymethyltransferase | 5.88e-10 | 2.21e-09 | NA | NA |
5. P | Q8FQR1 | Serine hydroxymethyltransferase | 4.34e-10 | 3.40e-09 | NA | NA |
5. P | Q9CHD3 | Acetylornithine aminotransferase | 9.60e-14 | 7.18e-03 | NA | NA |
5. P | A8A651 | L-seryl-tRNA(Sec) selenium transferase | 7.14e-06 | 1.91e-02 | NA | NA |
5. P | Q0SMQ5 | Serine hydroxymethyltransferase | 1.12e-09 | 2.62e-10 | NA | NA |
5. P | Q04FR7 | Serine hydroxymethyltransferase | 1.60e-10 | 1.90e-09 | NA | NA |
5. P | B9E156 | Serine hydroxymethyltransferase | 1.50e-10 | 2.99e-08 | NA | NA |
5. P | P9WQ89 | Uncharacterized aminotransferase Rv2231c | 7.60e-09 | 1.66e-07 | NA | NA |
5. P | P0C9D1 | NifS-like protein | NA | 2.15e-04 | NA | NA |
5. P | B7MS22 | Phosphoserine aminotransferase | 3.93e-14 | 1.25e-09 | NA | NA |
5. P | A0RQ51 | Glutamate-1-semialdehyde 2,1-aminomutase | 6.92e-13 | 3.84e-02 | NA | NA |
5. P | B7L0L2 | 8-amino-7-oxononanoate synthase | 7.03e-11 | 5.03e-05 | NA | NA |
5. P | Q72LL6 | 2-aminoadipate transaminase | 3.43e-08 | 3.40e-12 | NA | NA |
5. P | A8ZXV5 | LL-diaminopimelate aminotransferase | 1.85e-07 | 3.58e-05 | NA | NA |
5. P | A4TKK4 | Histidinol-phosphate aminotransferase | 9.97e-08 | 1.76e-08 | NA | NA |
5. P | Q8XZC3 | 8-amino-7-oxononanoate synthase | 5.90e-11 | 3.14e-08 | NA | NA |
5. P | A6QF32 | Histidinol-phosphate aminotransferase | 2.13e-09 | 9.53e-09 | NA | NA |
5. P | Q4ZQ94 | Phosphoserine aminotransferase | 6.22e-14 | 1.82e-08 | NA | NA |
5. P | Q5N492 | LL-diaminopimelate aminotransferase | 1.97e-07 | 5.13e-05 | NA | NA |
5. P | Q5RAK7 | O-phosphoseryl-tRNA(Sec) selenium transferase | 3.05e-07 | 4.18e-04 | NA | NA |
5. P | Q0APZ9 | 8-amino-7-oxononanoate synthase | 5.86e-11 | 8.31e-07 | NA | NA |
5. P | Q214H7 | Serine hydroxymethyltransferase | 9.58e-10 | 7.10e-05 | NA | NA |
5. P | Q8F930 | Phosphoserine aminotransferase | 9.45e-14 | 1.48e-11 | NA | NA |
5. P | P50431 | Serine hydroxymethyltransferase, cytosolic | 1.37e-06 | 2.18e-02 | NA | NA |
5. P | Q64SY6 | LL-diaminopimelate aminotransferase | 1.91e-07 | 5.91e-04 | NA | NA |
5. P | F8P1W6 | L-tyrosine:2-oxoglutarate aminotransferase amt1 | 1.18e-04 | 1.17e-04 | NA | NA |
5. P | A9MAE5 | Serine hydroxymethyltransferase | 3.81e-10 | 1.21e-06 | NA | NA |
5. P | Q7MLH6 | Phosphoserine aminotransferase | 5.23e-14 | 6.13e-11 | NA | NA |
5. P | P18485 | 1-aminocyclopropane-1-carboxylate synthase 2 | 1.17e-05 | 4.41e-03 | NA | NA |
5. P | A3MNG3 | 8-amino-7-oxononanoate synthase | 1.13e-10 | 1.86e-07 | NA | NA |
5. P | B7MGC9 | Tryptophanase | 4.30e-07 | 2.61e-03 | NA | NA |
5. P | Q97GH9 | Acetylornithine aminotransferase | 4.11e-15 | 7.71e-03 | NA | NA |
5. P | A0M3N2 | Serine hydroxymethyltransferase | 1.51e-09 | 1.11e-08 | NA | NA |
5. P | P0A821 | L-seryl-tRNA(Sec) selenium transferase | 7.10e-06 | 1.91e-02 | NA | NA |
5. P | Q81TV3 | Ornithine aminotransferase | 5.18e-14 | 4.51e-02 | NA | NA |
5. P | B4TRY8 | Serine hydroxymethyltransferase | 2.85e-10 | 4.02e-08 | NA | NA |
5. P | Q54VQ5 | Glutamate decarboxylase A | 6.61e-11 | 1.18e-06 | NA | NA |
5. P | B6IZ80 | Serine hydroxymethyltransferase | 3.24e-10 | 4.65e-07 | NA | NA |
5. P | Q62DI5 | Serine hydroxymethyltransferase 2 | 4.71e-10 | 6.08e-07 | NA | NA |
5. P | C3LKQ3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.91e-08 | 7.32e-06 | NA | NA |
5. P | P31373 | Cystathionine gamma-lyase | 4.42e-09 | 3.57e-04 | NA | NA |
5. P | A6W0Y0 | 8-amino-7-oxononanoate synthase | 2.78e-15 | 5.50e-07 | NA | NA |
5. P | A5F2A2 | Histidinol-phosphate aminotransferase | 1.51e-09 | 6.45e-11 | NA | NA |
5. P | P60121 | Putative pyridoxal phosphate-dependent acyltransferase | 4.44e-11 | 6.58e-07 | NA | NA |
5. P | P59324 | Acetylornithine/succinyldiaminopimelate aminotransferase | 5.94e-14 | 1.80e-02 | NA | NA |
5. P | Q0KF88 | 8-amino-7-oxononanoate synthase | 5.88e-11 | 1.13e-08 | NA | NA |
5. P | Q5PDP4 | Histidinol-phosphate aminotransferase | 5.00e-08 | 1.17e-09 | NA | NA |
5. P | Q1RIV2 | 5-aminolevulinate synthase | 2.88e-11 | 4.65e-07 | NA | NA |
5. P | P66805 | Serine hydroxymethyltransferase | 7.38e-10 | 5.78e-08 | NA | NA |
5. P | Q7WGU2 | Phosphoserine aminotransferase | 1.79e-14 | 1.93e-08 | NA | NA |
5. P | A6TZK2 | Histidinol-phosphate aminotransferase | 2.09e-09 | 9.53e-09 | NA | NA |
5. P | Q2RPV1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.92e-08 | 1.34e-06 | NA | NA |
5. P | B7NA75 | 8-amino-7-oxononanoate synthase | 2.90e-11 | 4.67e-06 | NA | NA |
5. P | B7NM68 | Phosphoserine aminotransferase | 4.02e-14 | 1.75e-09 | NA | NA |
5. P | C3P1G5 | Serine hydroxymethyltransferase | 2.31e-10 | 5.91e-08 | NA | NA |
5. P | A6TCG5 | Serine hydroxymethyltransferase | 2.57e-10 | 7.82e-08 | NA | NA |
5. P | B1YLN7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.04e-07 | 1.03e-07 | NA | NA |
5. P | A0Q588 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.47e-07 | 1.53e-07 | NA | NA |
5. P | Q8A8L4 | Phosphoserine aminotransferase | 1.08e-12 | 1.68e-10 | NA | NA |
5. P | Q3A1U5 | LL-diaminopimelate aminotransferase | 1.78e-07 | 2.57e-03 | NA | NA |
5. P | Q8P5Q4 | Acetylornithine aminotransferase | 1.19e-13 | 1.04e-02 | NA | NA |
5. P | B4EB45 | Phosphoserine aminotransferase | 9.68e-14 | 3.47e-10 | NA | NA |
5. P | Q9WZH9 | Serine hydroxymethyltransferase | 8.57e-10 | 6.96e-07 | NA | NA |
5. P | Q8PVS9 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 6.55e-15 | 3.86e-26 | NA | NA |
5. P | A5UI33 | Serine hydroxymethyltransferase | 3.14e-10 | 1.27e-07 | NA | NA |
5. P | A8AEK3 | Histidinol-phosphate aminotransferase | 5.06e-08 | 4.50e-09 | NA | NA |
5. P | Q59829 | Putative cystathionine gamma-lyase | 4.21e-08 | 1.39e-05 | NA | NA |
5. P | Q5X5E7 | Phosphoserine aminotransferase | 5.18e-14 | 1.51e-09 | NA | NA |
5. P | Q64UR4 | Phosphoserine aminotransferase | 6.18e-13 | 1.06e-10 | NA | NA |
5. P | Q8YGG7 | Serine hydroxymethyltransferase | 3.62e-10 | 9.82e-07 | NA | NA |
5. P | Q6AM21 | Serine hydroxymethyltransferase | 1.25e-10 | 8.69e-07 | NA | NA |
5. P | O27936 | UPF0425 pyridoxal phosphate-dependent protein MTH_1914 | 3.80e-07 | 8.49e-10 | NA | NA |
5. P | Q74GT3 | LL-diaminopimelate aminotransferase | 2.61e-07 | 3.98e-04 | NA | NA |
5. P | A6T0T6 | Serine hydroxymethyltransferase | 1.27e-10 | 1.71e-07 | NA | NA |
5. P | Q9S3K3 | L-seryl-tRNA(Sec) selenium transferase | 2.05e-05 | 2.50e-02 | NA | NA |
5. P | B2FKF0 | Phosphoserine aminotransferase | 4.49e-14 | 1.74e-11 | NA | NA |
5. P | Q83S45 | 8-amino-7-oxononanoate synthase | 2.24e-11 | 2.24e-06 | NA | NA |
5. P | B2RGR2 | Serine hydroxymethyltransferase | 2.00e-09 | 2.15e-07 | NA | NA |
5. P | P61002 | Histidinol-phosphate aminotransferase | 1.44e-13 | 1.82e-08 | NA | NA |
5. P | B2US14 | Serine hydroxymethyltransferase | 2.51e-10 | 5.26e-07 | NA | NA |
5. P | P10369 | Histidinol-phosphate aminotransferase | 5.22e-08 | 1.15e-09 | NA | NA |
5. P | Q8L0X4 | L-methionine gamma-lyase | 5.43e-09 | 1.88e-06 | NA | NA |
5. P | P60998 | Histidinol-phosphate aminotransferase | 2.58e-09 | 3.97e-07 | NA | NA |
5. P | Q2NZ83 | Serine hydroxymethyltransferase | 4.64e-10 | 5.82e-07 | NA | NA |
5. P | A2BP57 | Serine hydroxymethyltransferase | 4.11e-10 | 7.38e-08 | NA | NA |
5. P | B1IPI2 | Succinylornithine transaminase | 3.42e-14 | 1.05e-02 | NA | NA |
5. P | B2IJJ3 | Serine hydroxymethyltransferase | 6.35e-10 | 7.95e-07 | NA | NA |
5. P | A7WZL0 | Histidinol-phosphate aminotransferase | 2.02e-09 | 9.53e-09 | NA | NA |
5. P | Q72IH2 | Serine hydroxymethyltransferase | 2.84e-10 | 4.44e-09 | NA | NA |
5. P | B0VV21 | Histidinol-phosphate aminotransferase | 3.29e-09 | 7.13e-08 | NA | NA |
5. P | Q2RP86 | Histidinol-phosphate aminotransferase | 3.40e-13 | 8.31e-06 | NA | NA |
5. P | Q3MDN5 | LL-diaminopimelate aminotransferase 2 | 1.25e-07 | 3.00e-06 | NA | NA |
5. P | B7LN70 | Phosphoserine aminotransferase | 4.02e-14 | 1.64e-09 | NA | NA |
5. P | A4SNA7 | Tryptophanase | 2.25e-07 | 6.65e-07 | NA | NA |
5. P | A1ULN4 | Putative phosphoserine aminotransferase | 4.79e-10 | 1.57e-10 | NA | NA |
5. P | Q9HZ66 | Phosphoserine aminotransferase | 9.26e-14 | 9.04e-10 | NA | NA |
5. P | B1ILX5 | L-seryl-tRNA(Sec) selenium transferase | 1.60e-06 | 1.98e-02 | NA | NA |
5. P | B0CDH5 | LL-diaminopimelate aminotransferase | 2.81e-07 | 1.35e-04 | NA | NA |
5. P | A5UJ44 | Putative 8-amino-7-oxononanoate synthase | 8.53e-14 | 2.66e-06 | NA | NA |
5. P | Q39Z65 | LL-diaminopimelate aminotransferase | 1.91e-07 | 3.72e-04 | NA | NA |
5. P | Q2YD58 | Serine hydroxymethyltransferase | 2.75e-10 | 1.47e-09 | NA | NA |
5. P | A7Z4X1 | 8-amino-7-oxononanoate synthase 1 | 1.44e-15 | 1.19e-07 | NA | NA |
5. P | A2BUN9 | Serine hydroxymethyltransferase | 3.46e-10 | 8.89e-07 | NA | NA |
5. P | A9VYW6 | Serine hydroxymethyltransferase | 7.52e-10 | 3.70e-08 | NA | NA |
5. P | Q5E9N4 | Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial | 4.76e-07 | 1.02e-05 | NA | NA |
5. P | A8EWM9 | Histidinol-phosphate aminotransferase | 3.44e-09 | 1.37e-08 | NA | NA |
5. P | Q058A6 | Histidinol-phosphate aminotransferase | 1.05e-09 | 1.61e-10 | NA | NA |
5. P | Q9KSX2 | Histidinol-phosphate aminotransferase | 1.85e-09 | 1.30e-10 | NA | NA |
5. P | B2A3H6 | Serine hydroxymethyltransferase | 2.26e-10 | 6.63e-09 | NA | NA |
5. P | Q89VE9 | Acetylornithine aminotransferase 1 | 2.24e-14 | 3.24e-04 | NA | NA |
5. P | P67724 | Histidinol-phosphate aminotransferase | 2.39e-09 | 9.53e-09 | NA | NA |
5. P | Q2NFU9 | UPF0425 pyridoxal phosphate-dependent protein Msp_0916 | 2.38e-07 | 3.24e-06 | NA | NA |
5. P | B9MR57 | Serine hydroxymethyltransferase | 3.04e-10 | 2.42e-08 | NA | NA |
5. P | Q730W2 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.60e-08 | 5.73e-06 | NA | NA |
5. P | Q7U2X3 | Serine hydroxymethyltransferase 2 | 3.21e-10 | 2.08e-09 | NA | NA |
5. P | B3Q8Z5 | Histidinol-phosphate aminotransferase | 1.44e-13 | 1.82e-08 | NA | NA |
5. P | P0DF71 | Serine hydroxymethyltransferase | 4.93e-10 | 6.05e-08 | NA | NA |
5. P | A5UDI4 | Serine hydroxymethyltransferase | 4.32e-10 | 1.43e-07 | NA | NA |
5. P | A8FKI9 | Serine hydroxymethyltransferase | 4.06e-10 | 1.46e-07 | NA | NA |
5. P | Q54K00 | Aromatic amino acid aminotransferase DDB_G0287711 | 2.54e-06 | 2.17e-06 | NA | NA |
5. P | B1VFM5 | Serine hydroxymethyltransferase | 5.80e-10 | 2.21e-09 | NA | NA |
5. P | Q1M0P5 | Cystathionine gamma-synthase | 2.64e-12 | 5.26e-06 | NA | NA |
5. P | A9B6Q3 | Phosphoserine aminotransferase | 5.60e-14 | 1.79e-10 | NA | NA |
5. P | Q5H5R0 | 8-amino-7-oxononanoate synthase | 3.83e-11 | 6.88e-08 | NA | NA |
5. P | Q8Y3L0 | Phosphoserine aminotransferase | 5.69e-10 | 2.76e-10 | NA | NA |
5. P | Q89RB7 | Ornithine aminotransferase | 5.50e-14 | 4.33e-03 | NA | NA |
5. P | A1VRC8 | Serine hydroxymethyltransferase | 1.97e-10 | 2.33e-08 | NA | NA |
5. P | P06721 | Cystathionine beta-lyase MetC | 2.34e-05 | 2.77e-07 | NA | NA |
5. P | Q92L21 | Histidinol-phosphate aminotransferase 2 | 1.17e-09 | 3.18e-08 | NA | NA |
5. P | C1F935 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.67e-11 | 3.66e-08 | NA | NA |
5. P | Q119K2 | Putative 8-amino-7-oxononanoate synthase | 1.22e-15 | 3.80e-07 | NA | NA |
5. P | Q1IE97 | Histidinol-phosphate aminotransferase | 2.34e-09 | 4.36e-08 | NA | NA |
5. P | P16524 | Probable N-acetyl-LL-diaminopimelate aminotransferase | 2.17e-08 | 8.81e-10 | NA | NA |
5. P | C4Z4Y1 | LL-diaminopimelate aminotransferase | 3.28e-07 | 4.52e-06 | NA | NA |
5. P | Q2NUJ6 | 8-amino-7-oxononanoate synthase | 1.95e-11 | 5.64e-08 | NA | NA |
5. P | C5CPY0 | Serine hydroxymethyltransferase | 1.32e-10 | 4.79e-08 | NA | NA |
5. P | Q88ZU5 | Phosphoserine aminotransferase | 2.52e-14 | 6.31e-13 | NA | NA |
5. P | A0A1U9YHZ6 | Aminotransferase verI | 4.41e-06 | 1.36e-02 | NA | NA |
5. P | Q9CK66 | L-seryl-tRNA(Sec) selenium transferase | 8.96e-06 | 1.71e-02 | NA | NA |
5. P | Q3IRX5 | Serine hydroxymethyltransferase | 4.70e-10 | 3.10e-08 | NA | NA |
5. P | P53556 | 8-amino-7-oxononanoate synthase 2 | 4.28e-11 | 6.96e-07 | NA | NA |
5. P | P9WML6 | Histidinol-phosphate aminotransferase | 9.37e-09 | 1.10e-06 | NA | NA |
5. P | C0ZCE7 | Histidinol-phosphate aminotransferase | 7.15e-10 | 2.18e-05 | NA | NA |
5. P | Q58874 | Uncharacterized aminotransferase MJ1479 | 1.85e-07 | 7.32e-05 | NA | NA |
5. P | B7M835 | Phosphoserine aminotransferase | 5.02e-14 | 7.49e-10 | NA | NA |
5. P | B8ZSH2 | Serine hydroxymethyltransferase | 3.32e-10 | 4.81e-07 | NA | NA |
5. P | Q57MS2 | Histidinol-phosphate aminotransferase | 2.08e-09 | 1.16e-09 | NA | NA |
5. P | A1S6Z2 | Histidinol-phosphate aminotransferase | 7.52e-07 | 3.46e-06 | NA | NA |
5. P | A5U9A1 | Putative phenylalanine aminotransferase | 1.28e-13 | 2.99e-07 | NA | NA |
5. P | P28796 | Tryptophanase | 2.90e-07 | 1.53e-05 | NA | NA |
5. P | A5FS31 | Serine hydroxymethyltransferase | 1.26e-10 | 7.58e-09 | NA | NA |
5. P | Q5PNA4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 7.59e-14 | 1.57e-03 | NA | NA |
5. P | A8FRR4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.49e-13 | 7.99e-03 | NA | NA |
5. P | B4T3Z4 | Succinylornithine transaminase | 2.85e-14 | 1.79e-03 | NA | NA |
5. P | B1X6V8 | Histidinol-phosphate aminotransferase | 6.82e-08 | 1.54e-09 | NA | NA |
5. P | B8GG35 | Serine hydroxymethyltransferase | 2.63e-10 | 4.43e-06 | NA | NA |
5. P | Q0HXJ6 | Serine hydroxymethyltransferase | 3.53e-10 | 3.31e-09 | NA | NA |
5. P | A9QZ63 | Succinylornithine transaminase | 5.40e-14 | 3.71e-03 | NA | NA |
5. P | Q6BI19 | Kynureninase | 0.00e+00 | 1.37e-18 | NA | NA |
5. P | Q3M504 | Histidinol-phosphate aminotransferase 1 | 1.25e-09 | 4.47e-10 | NA | NA |
5. P | B2VI25 | Serine hydroxymethyltransferase | 2.51e-10 | 4.61e-09 | NA | NA |
5. P | B0TYH3 | Serine hydroxymethyltransferase | 3.17e-10 | 1.44e-07 | NA | NA |
5. P | A6L9B7 | Phosphoserine aminotransferase | 9.21e-13 | 3.06e-10 | NA | NA |
5. P | B0S1N3 | Serine hydroxymethyltransferase | 1.81e-10 | 3.56e-10 | NA | NA |
5. P | B2TUH4 | Phosphoserine aminotransferase | 6.75e-14 | 8.28e-10 | NA | NA |
5. P | B8E6W1 | Serine hydroxymethyltransferase | 3.54e-10 | 2.50e-09 | NA | NA |
5. P | Q4UQT6 | Serine hydroxymethyltransferase | 5.00e-10 | 1.30e-07 | NA | NA |
5. P | Q8ZNF3 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.74e-14 | 4.87e-05 | NA | NA |
5. P | B1I3P6 | L-seryl-tRNA(Sec) selenium transferase | 2.00e-06 | 1.27e-02 | NA | NA |
5. P | Q39CT7 | Histidinol-phosphate aminotransferase 2 | 9.14e-10 | 1.74e-10 | NA | NA |
5. P | A1A9I4 | Phosphoserine aminotransferase | 3.82e-14 | 9.15e-10 | NA | NA |
5. P | B1JZD9 | 8-amino-7-oxononanoate synthase | 1.08e-10 | 7.47e-08 | NA | NA |
5. P | B7L9P8 | Histidinol-phosphate aminotransferase | 4.80e-08 | 1.23e-09 | NA | NA |
5. P | Q5HIC5 | Putative pyridoxal phosphate-dependent acyltransferase | 4.18e-11 | 6.43e-07 | NA | NA |
5. P | A7NIF2 | Serine hydroxymethyltransferase | 1.01e-09 | 1.03e-07 | NA | NA |
5. P | Q81SV5 | Histidinol-phosphate aminotransferase 1 | 1.18e-09 | 1.75e-07 | NA | NA |
5. P | Q04R46 | Serine hydroxymethyltransferase | 1.90e-10 | 1.24e-07 | NA | NA |
5. P | B6YT11 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.21e-07 | 3.97e-07 | NA | NA |
5. P | Q5L6M0 | LL-diaminopimelate aminotransferase | 2.34e-07 | 9.64e-08 | NA | NA |
5. P | B7MAV9 | Succinylornithine transaminase | 2.90e-14 | 7.44e-03 | NA | NA |
5. P | Q0P8W3 | UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase | 2.69e-13 | 1.29e-03 | NA | NA |
5. P | Q1C8B1 | Succinylornithine transaminase | 5.54e-14 | 3.71e-03 | NA | NA |
5. P | A5VXF2 | 8-amino-7-oxononanoate synthase | 1.11e-15 | 1.30e-08 | NA | NA |
5. P | A0RIL0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.03e-08 | 7.32e-06 | NA | NA |
5. P | P06106 | Homocysteine/cysteine synthase | 3.74e-08 | 9.52e-04 | NA | NA |
5. P | Q6G009 | Serine hydroxymethyltransferase | 3.33e-10 | 4.33e-06 | NA | NA |
5. P | B9E8F5 | Serine hydroxymethyltransferase | 1.50e-10 | 2.76e-09 | NA | NA |
5. P | Q8ZFX6 | Histidinol-phosphate aminotransferase | 1.06e-07 | 1.76e-08 | NA | NA |
5. P | B7JVL5 | LL-diaminopimelate aminotransferase | 1.84e-07 | 2.05e-04 | NA | NA |
5. P | P33097 | Aspartate aminotransferase, cytoplasmic | 2.29e-06 | 2.49e-04 | NA | NA |
5. P | P0A4K2 | Cystathionine beta-lyase | 1.58e-12 | 8.58e-04 | NA | NA |
5. P | A8H4A2 | Phosphoserine aminotransferase | 1.24e-13 | 1.05e-09 | NA | NA |
5. P | Q5WWT0 | Phosphoserine aminotransferase | 3.67e-14 | 3.31e-09 | NA | NA |
5. P | A6VUD3 | Histidinol-phosphate aminotransferase | 2.76e-09 | 4.84e-09 | NA | NA |
5. P | B2U882 | Phosphoserine aminotransferase | 4.82e-14 | 6.33e-14 | NA | NA |
5. P | A0LEA5 | LL-diaminopimelate aminotransferase | 6.90e-08 | 1.25e-06 | NA | NA |
5. P | Q2FTK5 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.71e-13 | 2.20e-02 | NA | NA |
5. P | A8YW78 | Phosphoserine aminotransferase | 4.54e-14 | 1.28e-09 | NA | NA |
5. P | Q9KJU4 | Histidinol-phosphate aminotransferase | 4.65e-09 | 3.14e-05 | NA | NA |
5. P | Q488N6 | Serine hydroxymethyltransferase 1 | 7.50e-10 | 1.60e-07 | NA | NA |
5. P | B7I459 | Histidine decarboxylase | 3.88e-10 | 2.39e-12 | NA | NA |
5. P | C0QFJ4 | LL-diaminopimelate aminotransferase | 1.54e-07 | 5.73e-06 | NA | NA |
5. P | P9WGI9 | Serine hydroxymethyltransferase 1 | 4.44e-10 | 5.39e-08 | NA | NA |
5. P | A0PP02 | 8-amino-7-oxononanoate synthase | 2.25e-14 | 1.67e-07 | NA | NA |
5. P | A9GPH2 | Serine hydroxymethyltransferase | 2.24e-10 | 2.75e-06 | NA | NA |
5. P | A3PEY9 | LL-diaminopimelate aminotransferase | 4.19e-07 | 5.97e-04 | NA | NA |
5. P | O31632 | Cystathionine beta-lyase MetC | 1.92e-12 | 4.52e-06 | NA | NA |
5. P | A3CPJ2 | Phosphoserine aminotransferase | 7.66e-15 | 1.35e-10 | NA | NA |
5. P | A4G865 | Phosphoserine aminotransferase | 3.70e-14 | 2.03e-09 | NA | NA |
5. P | A3CNT7 | Histidinol-phosphate aminotransferase | 1.28e-13 | 9.90e-11 | NA | NA |
5. P | Q3BUZ3 | Phosphoserine aminotransferase | 1.99e-14 | 1.59e-10 | NA | NA |
5. P | Q03K75 | Histidinol-phosphate aminotransferase | 9.64e-10 | 1.93e-10 | NA | NA |
5. P | Q0SRQ2 | Serine hydroxymethyltransferase | 1.27e-10 | 2.62e-09 | NA | NA |
5. P | P33330 | Phosphoserine aminotransferase | 3.77e-14 | 1.11e-07 | NA | NA |
5. P | Q1WTR3 | Serine hydroxymethyltransferase | 3.76e-10 | 2.18e-07 | NA | NA |
5. P | A1ABS9 | Succinylornithine transaminase | 2.62e-14 | 7.44e-03 | NA | NA |
5. P | P07511 | Serine hydroxymethyltransferase, cytosolic | 9.99e-07 | 3.29e-02 | NA | NA |
5. P | O32148 | (S)-ureidoglycine--glyoxylate transaminase | 1.11e-16 | 7.21e-10 | NA | NA |
5. P | Q897C2 | Tyrosine phenol-lyase | 3.88e-07 | 8.22e-06 | NA | NA |
5. P | A7TR79 | Kynureninase | 0.00e+00 | 5.36e-18 | NA | NA |
5. P | Q6D400 | Phosphoserine aminotransferase | 5.91e-14 | 1.68e-09 | NA | NA |
5. P | Q83E12 | Phosphoserine aminotransferase | 1.71e-13 | 2.89e-07 | NA | NA |
5. P | B5FP62 | 8-amino-7-oxononanoate synthase | 2.13e-11 | 2.31e-07 | NA | NA |
5. P | B7KVA7 | Serine hydroxymethyltransferase | 5.17e-10 | 3.70e-08 | NA | NA |
5. P | B9ITF9 | Ornithine aminotransferase | 4.65e-14 | 4.18e-02 | NA | NA |
5. P | B2TYF9 | Histidinol-phosphate aminotransferase | 4.77e-08 | 1.56e-09 | NA | NA |
5. P | A6LUF3 | Histidinol-phosphate aminotransferase | 1.04e-13 | 3.27e-11 | NA | NA |
5. P | Q1LT68 | Histidinol-phosphate aminotransferase | 5.61e-08 | 8.28e-10 | NA | NA |
5. P | A4SE60 | Histidinol-phosphate aminotransferase | 1.83e-09 | 7.30e-10 | NA | NA |
5. P | Q5HT33 | L-seryl-tRNA(Sec) selenium transferase | 3.10e-05 | 1.07e-02 | NA | NA |
5. P | A4XZR8 | 8-amino-7-oxononanoate synthase | 9.99e-16 | 1.33e-08 | NA | NA |
5. P | Q4QKR3 | Putative 8-amino-7-oxononanoate synthase | 8.35e-14 | 2.66e-06 | NA | NA |
5. P | Q57004 | Histidinol-phosphate aminotransferase 2 | 2.74e-10 | 5.26e-06 | NA | NA |
5. P | Q3M9A4 | Putative 8-amino-7-oxononanoate synthase | 5.55e-16 | 1.27e-07 | NA | NA |
5. P | B7IF24 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 6.76e-10 | 5.26e-07 | NA | NA |
5. P | A9NAX3 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.74e-13 | 5.00e-03 | NA | NA |
5. P | C3LUI5 | Tryptophanase | 5.74e-07 | 1.96e-02 | NA | NA |
5. P | Q3Z295 | Succinylornithine transaminase | 2.48e-14 | 7.50e-03 | NA | NA |
5. P | A0A0F7CUE9 | Aminotransferase tasG | 1.07e-03 | 8.34e-04 | NA | NA |
5. P | Q8Y1G1 | Serine hydroxymethyltransferase 1 | 1.09e-10 | 7.86e-09 | NA | NA |
5. P | Q6LXV6 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 1.67e-15 | 5.03e-25 | NA | NA |
5. P | O26043 | L-seryl-tRNA(Sec) selenium transferase | 5.87e-08 | 2.45e-13 | NA | NA |
5. P | Q6LU17 | Serine hydroxymethyltransferase 1 | 2.21e-10 | 6.09e-09 | NA | NA |
5. P | Q54K95 | Tyrosine aminotransferase | 5.85e-08 | 1.24e-05 | NA | NA |
5. P | A9KJ19 | LL-diaminopimelate aminotransferase | 4.78e-07 | 2.44e-04 | NA | NA |
5. P | A7HG96 | 8-amino-7-oxononanoate synthase | 6.11e-15 | 5.78e-08 | NA | NA |
5. P | Q8KZM9 | Putative 8-amino-7-oxononanoate synthase | 8.42e-10 | 8.14e-06 | NA | NA |
5. P | B7N5L8 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.94e-14 | 9.43e-04 | NA | NA |
5. P | B5Y9Z4 | 8-amino-7-oxononanoate synthase | 7.27e-11 | 5.26e-07 | NA | NA |
5. P | C4ZH69 | Serine hydroxymethyltransferase | 1.78e-10 | 3.07e-08 | NA | NA |
5. P | B6I7J6 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.09e-13 | 1.02e-03 | NA | NA |
5. P | A1KV48 | Phosphoserine aminotransferase | 6.55e-14 | 6.80e-11 | NA | NA |
5. P | Q5F7A0 | Phosphoserine aminotransferase | 4.76e-14 | 1.45e-09 | NA | NA |
5. P | Q60013 | Aspartate aminotransferase | 1.29e-08 | 2.31e-07 | NA | NA |
5. P | A3Q130 | Histidinol-phosphate aminotransferase | 4.65e-09 | 3.73e-06 | NA | NA |
5. P | P62676 | Phosphoserine aminotransferase | 3.19e-14 | 5.20e-10 | NA | NA |
5. P | B7IXL3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.62e-08 | 7.47e-06 | NA | NA |
5. P | Q5UPL1 | Uncharacterized protein L136 | NA | 7.54e-11 | NA | NA |
5. P | A5EVR7 | Serine hydroxymethyltransferase | 2.75e-10 | 4.11e-08 | NA | NA |
5. P | A1AWS2 | Serine hydroxymethyltransferase | 4.88e-10 | 2.31e-08 | NA | NA |
5. P | B0SEH8 | LL-diaminopimelate aminotransferase | 3.57e-07 | 3.11e-03 | NA | NA |
5. P | Q9HVX0 | Histidinol-phosphate aminotransferase 1 | 1.52e-09 | 5.07e-10 | NA | NA |
5. P | P9WQ73 | Phosphoserine aminotransferase | 4.85e-08 | 1.72e-10 | NA | NA |
5. P | Q18T09 | LL-diaminopimelate aminotransferase | 1.78e-07 | 1.91e-04 | NA | NA |
5. P | A6T1G7 | Phosphoserine aminotransferase | 3.08e-14 | 1.11e-10 | NA | NA |
5. P | Q2MF17 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase | 5.25e-09 | 2.67e-04 | NA | NA |
5. P | P56969 | Uncharacterized aminotransferase AF_1815 | 1.96e-09 | 5.07e-04 | NA | NA |
5. P | Q0BUV6 | 8-amino-7-oxononanoate synthase | 6.92e-11 | 8.22e-07 | NA | NA |
5. P | Q5L296 | Phosphoserine aminotransferase | 9.49e-14 | 6.31e-12 | NA | NA |
5. P | Q2LST8 | Histidinol-phosphate aminotransferase | 1.34e-09 | 4.21e-08 | NA | NA |
5. P | B1L7Y6 | Serine hydroxymethyltransferase | 8.16e-10 | 6.96e-07 | NA | NA |
5. P | P36570 | 8-amino-7-oxononanoate synthase | 9.51e-11 | 4.02e-07 | NA | NA |
5. P | Q57LF7 | Serine hydroxymethyltransferase | 2.90e-10 | 4.47e-08 | NA | NA |
5. P | Q5HQK4 | Ornithine aminotransferase | 3.14e-14 | 1.31e-03 | NA | NA |
5. P | B5E8U0 | Serine hydroxymethyltransferase | 3.63e-10 | 1.17e-07 | NA | NA |
5. P | Q57R24 | Phosphoserine aminotransferase | 5.85e-14 | 5.01e-10 | NA | NA |
5. P | Q0TET8 | Serine hydroxymethyltransferase | 2.57e-10 | 1.69e-08 | NA | NA |
5. P | Q9PMS2 | L-seryl-tRNA(Sec) selenium transferase | 3.14e-05 | 1.55e-02 | NA | NA |
5. P | Q2GHF1 | Serine hydroxymethyltransferase | 4.08e-10 | 4.88e-06 | NA | NA |
5. P | B8GN14 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.69e-07 | 1.83e-07 | NA | NA |
5. P | B1LJV7 | Phosphoserine aminotransferase | 6.97e-14 | 7.49e-10 | NA | NA |
5. P | Q5ZVM2 | Phosphoserine aminotransferase | 3.99e-14 | 7.67e-09 | NA | NA |
5. P | Q7MCR1 | Tryptophanase | 5.09e-07 | 3.23e-03 | NA | NA |
5. P | B4SGW1 | Glutamate-1-semialdehyde 2,1-aminomutase | 4.15e-13 | 1.96e-02 | NA | NA |
5. P | C1FVV5 | L-seryl-tRNA(Sec) selenium transferase | 1.78e-06 | 7.24e-03 | NA | NA |
5. P | P07991 | Ornithine aminotransferase | 1.60e-13 | 3.11e-03 | NA | NA |
5. P | B3R5S0 | Serine hydroxymethyltransferase | 1.49e-10 | 1.67e-08 | NA | NA |
5. P | P62677 | Phosphoserine aminotransferase | 4.66e-14 | 5.20e-10 | NA | NA |
5. P | Q8FJQ2 | 8-amino-7-oxononanoate synthase | 2.64e-11 | 3.89e-06 | NA | NA |
5. P | Q8A9S7 | Serine hydroxymethyltransferase | 1.29e-09 | 7.60e-07 | NA | NA |
5. P | Q9C969 | Aromatic aminotransferase ISS1 | 2.43e-07 | 3.09e-12 | NA | NA |
5. P | B4TPI0 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 8.13e-14 | 8.26e-04 | NA | NA |
5. P | Q30TC9 | Histidinol-phosphate aminotransferase | 2.49e-09 | 1.58e-04 | NA | NA |
5. P | A8MEX7 | 8-amino-7-oxononanoate synthase | 4.66e-15 | 5.14e-07 | NA | NA |
5. P | B0UTZ3 | Tryptophanase | 4.11e-07 | 6.38e-04 | NA | NA |
5. P | Q6NI47 | Serine hydroxymethyltransferase | 7.82e-10 | 1.43e-08 | NA | NA |
5. P | Q0AEQ0 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 2.48e-07 | 8.98e-07 | NA | NA |
5. P | B7NF25 | Tryptophanase | 4.28e-07 | 2.61e-03 | NA | NA |
5. P | A9R2K5 | Histidinol-phosphate aminotransferase | 1.01e-07 | 1.76e-08 | NA | NA |
5. P | Q183G0 | Serine hydroxymethyltransferase | 2.44e-10 | 1.13e-09 | NA | NA |
5. P | P26505 | 5-aminolevulinate synthase | 1.99e-11 | 4.36e-08 | NA | NA |
5. P | O13326 | Homocysteine synthase | 4.90e-08 | 1.79e-03 | NA | NA |
5. P | B2I8R0 | Serine hydroxymethyltransferase | 6.09e-10 | 3.97e-07 | NA | NA |
5. P | A8A2C0 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.06e-13 | 1.82e-03 | NA | NA |
5. P | A1ITK1 | Putative 8-amino-7-oxononanoate synthase | 7.34e-14 | 4.82e-06 | NA | NA |
5. P | Q7VAS9 | Acetylornithine aminotransferase | 2.09e-13 | 2.85e-02 | NA | NA |
5. P | Q87QA3 | Phosphoserine aminotransferase | 3.38e-14 | 8.48e-11 | NA | NA |
5. P | A7ZYL0 | Phosphoserine aminotransferase | 4.95e-14 | 7.49e-10 | NA | NA |
5. P | A8FSQ9 | Serine hydroxymethyltransferase | 7.65e-10 | 3.79e-09 | NA | NA |
5. P | B7ULX3 | 8-amino-7-oxononanoate synthase | 2.06e-11 | 9.44e-06 | NA | NA |
5. P | A0KKB7 | Histidinol-phosphate aminotransferase | 2.73e-09 | 3.75e-07 | NA | NA |
5. P | P24531 | Serine hydroxymethyltransferase | 3.73e-10 | 3.93e-07 | NA | NA |
5. P | Q9K6G4 | Serine hydroxymethyltransferase | 1.99e-10 | 5.98e-08 | NA | NA |
5. P | B7LDE3 | Serine hydroxymethyltransferase | 2.87e-10 | 1.69e-08 | NA | NA |
5. P | Q7VRR4 | Serine hydroxymethyltransferase | 1.72e-10 | 5.71e-08 | NA | NA |
5. P | Q1GV11 | Serine hydroxymethyltransferase | 6.91e-10 | 8.41e-07 | NA | NA |
5. P | A9M251 | Putative 8-amino-7-oxononanoate synthase | 4.56e-14 | 4.82e-06 | NA | NA |
5. P | A8YY80 | Serine hydroxymethyltransferase | 1.91e-10 | 3.20e-06 | NA | NA |
5. P | Q7SI94 | [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase | 2.88e-14 | 3.65e-02 | NA | NA |
5. P | B2TXW4 | Serine hydroxymethyltransferase | 2.74e-10 | 1.69e-08 | NA | NA |
5. P | Q734W9 | Phosphoserine aminotransferase | 2.00e-14 | 1.11e-12 | NA | NA |
5. P | Q8YZT3 | Putative 8-amino-7-oxononanoate synthase | 6.66e-16 | 1.81e-07 | NA | NA |
5. P | Q9HQS0 | Histidinol-phosphate aminotransferase | 6.76e-09 | 9.31e-08 | NA | NA |
5. P | A4SQW7 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.76e-13 | 1.99e-04 | NA | NA |
5. P | A5G9G1 | Histidinol-phosphate aminotransferase | 2.03e-09 | 2.26e-11 | NA | NA |
5. P | C5D4A1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.31e-08 | 1.23e-07 | NA | NA |
5. P | B6J1E0 | Phosphoserine aminotransferase | 1.07e-13 | 1.77e-07 | NA | NA |
5. P | P25048 | Daunorubicin biosynthesis sensory transduction protein DnrJ | 8.28e-13 | 4.87e-05 | NA | NA |
5. P | B1LDY3 | Succinylornithine transaminase | 3.25e-14 | 8.58e-03 | NA | NA |
5. P | Q1BY31 | Phosphoserine aminotransferase | 8.33e-14 | 5.01e-10 | NA | NA |
5. P | B7KD70 | Putative 8-amino-7-oxononanoate synthase | 3.89e-15 | 1.06e-05 | NA | NA |
5. P | Q8FJB7 | Phosphoserine aminotransferase | 4.12e-14 | 1.25e-09 | NA | NA |
5. P | C5BC01 | L-seryl-tRNA(Sec) selenium transferase | 3.60e-05 | 3.21e-02 | NA | NA |
5. P | Q5YQ76 | Serine hydroxymethyltransferase | 3.47e-10 | 1.38e-09 | NA | NA |
5. P | B1KZQ3 | L-seryl-tRNA(Sec) selenium transferase | 2.06e-06 | 1.52e-02 | NA | NA |
5. P | P31014 | Tryptophanase 1 | 3.82e-07 | 3.48e-03 | NA | NA |
5. P | Q5E637 | Histidinol-phosphate aminotransferase | 1.29e-09 | 4.66e-11 | NA | NA |
5. P | Q57622 | UPF0425 pyridoxal phosphate-dependent protein MJ0158 | 3.70e-07 | 2.15e-11 | NA | NA |
5. P | A9BM04 | Phosphoserine aminotransferase | 4.42e-14 | 2.87e-11 | NA | NA |
5. P | P57007 | Phosphoserine aminotransferase | 7.07e-14 | 1.61e-10 | NA | NA |
5. P | Q8TH25 | Histidinol-phosphate aminotransferase | 9.34e-09 | 4.48e-11 | NA | NA |
5. P | Q2RVA2 | Serine hydroxymethyltransferase 1 | 5.88e-10 | 1.49e-04 | NA | NA |
5. P | Q82JI0 | Serine hydroxymethyltransferase | 2.85e-10 | 4.09e-10 | NA | NA |
5. P | Q4ZMA9 | 8-amino-7-oxononanoate synthase | 3.22e-15 | 2.79e-08 | NA | NA |
5. P | Q7NVP1 | Phosphoserine aminotransferase | 9.96e-14 | 1.91e-11 | NA | NA |
5. P | O50584 | Low specificity L-threonine aldolase | 1.68e-12 | 1.70e-12 | NA | NA |
5. P | P60299 | Ornithine aminotransferase 2 | 2.51e-14 | 2.57e-03 | NA | NA |
5. P | P18757 | Cystathionine gamma-lyase | 1.67e-07 | 9.95e-06 | NA | NA |
5. P | A1RJD3 | Phosphoserine aminotransferase | 1.06e-07 | 1.36e-09 | NA | NA |
5. P | Q7NYV9 | Tryptophanase | 1.69e-07 | 5.38e-07 | NA | NA |
5. P | A9KBA0 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.76e-13 | 6.74e-03 | NA | NA |
5. P | Q9LSH2 | Glutamate decarboxylase 5 | 8.88e-16 | 2.09e-05 | NA | NA |
5. P | Q67N41 | Serine hydroxymethyltransferase | 1.60e-10 | 2.12e-08 | NA | NA |
5. P | Q0TFI9 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.00e-13 | 1.23e-03 | NA | NA |
5. P | Q65S80 | Phosphoserine aminotransferase | 4.31e-07 | 5.90e-12 | NA | NA |
5. P | P60298 | Ornithine aminotransferase 2 | 2.30e-14 | 2.57e-03 | NA | NA |
5. P | Q9X2A5 | Acetylornithine aminotransferase | 6.99e-15 | 9.70e-04 | NA | NA |
5. P | Q9A7Z1 | Putative 8-amino-7-oxononanoate synthase | 5.08e-11 | 3.59e-07 | NA | NA |
5. P | P77581 | Succinylornithine transaminase | 2.80e-14 | 1.05e-02 | NA | NA |
5. P | O06060 | Diaminobutyrate--2-oxoglutarate transaminase | 3.37e-12 | 4.99e-02 | NA | NA |
5. P | O07131 | Histidinol-phosphate aminotransferase | 1.93e-09 | 8.77e-05 | NA | NA |
5. P | Q1GXW0 | Glutamate-1-semialdehyde 2,1-aminomutase | 2.84e-13 | 3.00e-02 | NA | NA |
5. P | Q5FQA6 | Histidinol-phosphate aminotransferase 2 | 4.75e-10 | 2.06e-10 | NA | NA |
5. P | A4X6P4 | Serine hydroxymethyltransferase | 1.69e-09 | 1.39e-07 | NA | NA |
5. P | Q0AEP9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.48e-10 | 8.58e-08 | NA | NA |
5. P | A4WC70 | Histidinol-phosphate aminotransferase | 1.94e-09 | 8.18e-10 | NA | NA |
5. P | Q057N5 | Phosphoserine aminotransferase | 1.94e-14 | 1.92e-12 | NA | NA |
5. P | A7ESB8 | Kynureninase | 0.00e+00 | 1.35e-10 | NA | NA |
5. P | Q4A6A3 | Serine hydroxymethyltransferase | 3.67e-10 | 4.35e-07 | NA | NA |
5. P | Q8RV06 | Serine decarboxylase 2 | 5.70e-10 | 1.63e-02 | NA | NA |
5. P | C3LU31 | Histidinol-phosphate aminotransferase | 1.70e-09 | 6.45e-11 | NA | NA |
5. P | B4TC49 | 8-amino-7-oxononanoate synthase | 4.11e-11 | 3.10e-07 | NA | NA |
5. P | P9WPZ7 | Acetylornithine aminotransferase | 8.15e-14 | 1.28e-02 | NA | NA |
5. P | B5BAV4 | Serine hydroxymethyltransferase | 2.78e-10 | 4.47e-08 | NA | NA |
5. P | P74770 | Putative 8-amino-7-oxononanoate synthase | 2.66e-15 | 7.78e-07 | NA | NA |
5. P | Q6FA66 | Serine hydroxymethyltransferase | 6.05e-10 | 2.26e-06 | NA | NA |
5. P | Q5LYP0 | Phosphoserine aminotransferase | 1.72e-14 | 4.36e-10 | NA | NA |
5. P | Q6D246 | Serine hydroxymethyltransferase 1 | 2.02e-10 | 2.32e-09 | NA | NA |
5. P | P57830 | Serine hydroxymethyltransferase | 2.90e-10 | 2.69e-08 | NA | NA |
5. P | P45358 | Histidinol-phosphate aminotransferase | 1.55e-09 | 4.61e-09 | NA | NA |
5. P | Q391K1 | Serine hydroxymethyltransferase 2 | 1.37e-10 | 1.95e-08 | NA | NA |
5. P | P24060 | Serine hydroxymethyltransferase | 7.18e-10 | 2.50e-06 | NA | NA |
5. P | O62585 | Serine hydroxymethyltransferase, cytosolic | 4.37e-10 | 2.74e-05 | NA | NA |
5. P | A3M2I8 | Histidinol-phosphate aminotransferase | 2.77e-09 | 2.33e-08 | NA | NA |
5. P | Q824C8 | Serine hydroxymethyltransferase | 1.21e-09 | 9.08e-04 | NA | NA |
5. P | A1TRH1 | Serine hydroxymethyltransferase | 1.04e-10 | 1.64e-07 | NA | NA |
5. P | B2HUY9 | Serine hydroxymethyltransferase | 7.35e-10 | 8.86e-06 | NA | NA |
5. P | A4IQ80 | Histidinol-phosphate aminotransferase | 8.20e-10 | 9.05e-06 | NA | NA |
5. P | Q49Z60 | Serine hydroxymethyltransferase | 1.66e-10 | 1.40e-06 | NA | NA |
5. P | Q7VUW7 | Serine hydroxymethyltransferase | 7.74e-11 | 1.33e-07 | NA | NA |
5. P | C6E9Q7 | LL-diaminopimelate aminotransferase | 2.37e-07 | 3.37e-04 | NA | NA |
5. P | B1LM67 | 8-amino-7-oxononanoate synthase | 1.90e-11 | 2.69e-06 | NA | NA |
5. P | Q9KTG1 | Serine hydroxymethyltransferase 1 | 2.14e-10 | 5.26e-08 | NA | NA |
5. P | A7H4X6 | Serine hydroxymethyltransferase | 3.89e-10 | 1.35e-07 | NA | NA |
5. P | B5YT41 | Phosphoserine aminotransferase | 3.77e-14 | 1.70e-09 | NA | NA |
5. P | Q9S5G6 | Histidinol-phosphate aminotransferase | 4.76e-08 | 1.75e-09 | NA | NA |
5. P | Q1DCV8 | 8-amino-7-oxononanoate synthase | 1.18e-10 | 9.31e-08 | NA | NA |
5. P | P30900 | Acetylornithine aminotransferase | 5.66e-15 | 2.64e-04 | NA | NA |
5. P | Q63Q87 | Histidinol-phosphate aminotransferase 2 | 1.24e-09 | 1.63e-08 | NA | NA |
5. P | A4ITJ9 | Serine hydroxymethyltransferase | 1.92e-10 | 1.09e-07 | NA | NA |
5. P | P9WPZ5 | Probable N-succinyldiaminopimelate aminotransferase DapC | 1.27e-09 | 1.11e-05 | NA | NA |
5. P | Q4K8N0 | Histidinol-phosphate aminotransferase 2 | 1.39e-09 | 9.80e-05 | NA | NA |
5. P | Q5JFW3 | Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase | 4.58e-13 | 5.42e-04 | NA | NA |
5. P | B8ZRB0 | Histidinol-phosphate aminotransferase | 6.06e-09 | 2.25e-08 | NA | NA |
5. P | Q01QZ0 | Serine hydroxymethyltransferase | 2.73e-10 | 1.51e-07 | NA | NA |
5. P | Q1CFQ4 | 8-amino-7-oxononanoate synthase | 3.88e-11 | 1.31e-06 | NA | NA |
5. P | Q5KY23 | Putative 8-amino-7-oxononanoate synthase | 6.30e-11 | 1.29e-08 | NA | NA |
5. P | B0JQZ0 | Putative 8-amino-7-oxononanoate synthase | 3.00e-15 | 4.49e-07 | NA | NA |
5. P | Q2SBJ7 | Histidinol-phosphate aminotransferase | 5.65e-08 | 7.68e-10 | NA | NA |
5. P | P69911 | Glutamate decarboxylase beta | 5.00e-15 | 5.63e-07 | NA | NA |
5. P | B6JPT2 | Serine hydroxymethyltransferase | 2.62e-10 | 2.36e-07 | NA | NA |
5. P | B2USD7 | Glutamate-1-semialdehyde 2,1-aminomutase | 7.33e-13 | 1.96e-02 | NA | NA |
5. P | A2RKS5 | Histidinol-phosphate aminotransferase | 6.26e-08 | 2.87e-10 | NA | NA |
5. P | Q9KNW2 | Acetylornithine aminotransferase | 4.49e-14 | 2.01e-02 | NA | NA |
5. P | P54376 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.55e-11 | 1.68e-06 | NA | NA |
5. P | Q5XC65 | Serine hydroxymethyltransferase | 4.81e-10 | 3.33e-08 | NA | NA |
5. P | Q06402 | 1-aminocyclopropane-1-carboxylate synthase 2 | 2.41e-06 | 8.97e-03 | NA | NA |
5. P | A1W431 | Histidinol-phosphate aminotransferase | 1.59e-13 | 2.37e-05 | NA | NA |
5. P | B7MXT4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.01e-13 | 1.43e-03 | NA | NA |
5. P | Q7W400 | Serine hydroxymethyltransferase 2 | 7.59e-11 | 3.24e-07 | NA | NA |
5. P | Q8TXK0 | O-phosphoseryl-tRNA(Sec) selenium transferase | 5.38e-07 | 3.04e-05 | NA | NA |
5. P | A7GHJ2 | L-seryl-tRNA(Sec) selenium transferase | 1.61e-06 | 1.25e-02 | NA | NA |
5. P | A5I656 | L-seryl-tRNA(Sec) selenium transferase | 1.83e-06 | 1.75e-02 | NA | NA |
5. P | A6TU88 | 8-amino-7-oxononanoate synthase | 2.44e-15 | 1.51e-07 | NA | NA |
5. P | B4U7S5 | Serine hydroxymethyltransferase | 2.84e-10 | 2.01e-06 | NA | NA |
5. P | C4ZU95 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.03e-13 | 1.82e-03 | NA | NA |
5. P | Q47829 | 8-amino-7-oxononanoate synthase | 3.02e-11 | 3.71e-07 | NA | NA |
5. P | Q58369 | Uncharacterized aminotransferase MJ0959 | 0.00e+00 | 3.49e-11 | NA | NA |
5. P | Q6LX26 | LL-diaminopimelate aminotransferase | 3.32e-07 | 5.14e-07 | NA | NA |
5. P | Q8TK94 | Serine hydroxymethyltransferase | 4.36e-10 | 2.66e-06 | NA | NA |
5. P | Q75BQ6 | Serine hydroxymethyltransferase, cytosolic | 7.86e-07 | 7.55e-06 | NA | NA |
5. P | P13221 | Aspartate aminotransferase, cytoplasmic | 1.88e-06 | 3.24e-04 | NA | NA |
5. P | Q9XAY7 | Serine hydroxymethyltransferase | 2.08e-10 | 8.05e-06 | NA | NA |
5. P | Q7TWJ6 | Protein Mb3436c | 1.97e-08 | 2.61e-07 | NA | NA |
5. P | Q6GIR8 | Histidinol-phosphate aminotransferase | 1.67e-09 | 1.40e-08 | NA | NA |
5. P | P55216 | Putative cystathionine gamma-lyase 2 | 1.78e-09 | 1.36e-04 | NA | NA |
5. P | C1L2Q5 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.39e-08 | 1.86e-06 | NA | NA |
5. P | B7UMZ3 | Phosphoserine aminotransferase | 3.36e-14 | 2.44e-09 | NA | NA |
5. P | B3PN94 | Serine hydroxymethyltransferase | 2.39e-10 | 1.64e-07 | NA | NA |
5. P | B5YXB2 | Tryptophanase | 4.61e-07 | 2.36e-03 | NA | NA |
5. P | Q63RB4 | Serine hydroxymethyltransferase 1 | 1.36e-10 | 4.52e-08 | NA | NA |
5. P | B1JE54 | 8-amino-7-oxononanoate synthase | 1.44e-15 | 1.73e-08 | NA | NA |
5. P | Q8AAB8 | LL-diaminopimelate aminotransferase | 2.16e-07 | 2.23e-05 | NA | NA |
5. P | A0A0A2IDH4 | L-tryptophan decarboxylase cnsB | 5.79e-08 | 1.07e-04 | NA | NA |
5. P | A6TBC4 | Histidinol-phosphate aminotransferase | 5.56e-08 | 5.27e-10 | NA | NA |
5. P | B7N6D8 | Serine hydroxymethyltransferase | 2.88e-10 | 1.95e-08 | NA | NA |
5. P | Q83AK3 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.71e-13 | 5.00e-03 | NA | NA |
5. P | Q9CJU0 | Putative 8-amino-7-oxononanoate synthase | 2.37e-10 | 5.88e-09 | NA | NA |
5. P | Q729Z3 | Tryptophanase | 3.09e-07 | 4.25e-07 | NA | NA |
5. P | O26158 | LL-diaminopimelate aminotransferase | 1.39e-07 | 3.13e-06 | NA | NA |
5. P | A8FF40 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.49e-08 | 3.81e-06 | NA | NA |
5. P | Q7VSH3 | Acetylornithine aminotransferase 2 | 6.63e-14 | 9.46e-03 | NA | NA |
5. P | Q7VR40 | Phosphoserine aminotransferase | 2.30e-14 | 7.68e-10 | NA | NA |
5. P | A5IQS7 | Histidinol-phosphate aminotransferase | 1.80e-09 | 9.53e-09 | NA | NA |
5. P | B7MQM9 | 8-amino-7-oxononanoate synthase | 2.74e-11 | 3.53e-06 | NA | NA |
5. P | Q8KC05 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.43e-11 | 3.03e-06 | NA | NA |
5. P | P23721 | Phosphoserine aminotransferase | 6.43e-14 | 1.68e-09 | NA | NA |
5. P | Q163G3 | Histidinol-phosphate aminotransferase | 7.75e-10 | 3.98e-09 | NA | NA |
5. P | A9HVE9 | 8-amino-7-oxononanoate synthase | 3.50e-11 | 1.83e-07 | NA | NA |
5. P | Q5DZH9 | 8-amino-7-oxononanoate synthase | 7.18e-11 | 6.22e-07 | NA | NA |
5. P | Q8D0D7 | Succinylornithine transaminase | 5.66e-14 | 3.71e-03 | NA | NA |
5. P | Q73GL9 | L-alanine/L-glutamate racemase | 2.26e-08 | 1.23e-05 | NA | NA |
5. P | Q9I617 | 8-amino-7-oxononanoate synthase | 2.11e-15 | 3.18e-08 | NA | NA |
5. P | A2SE05 | Histidinol-phosphate aminotransferase | 5.91e-10 | 1.83e-05 | NA | NA |
5. P | B0RUW3 | Phosphoserine aminotransferase | 2.60e-14 | 1.48e-11 | NA | NA |
5. P | B0BV27 | Serine hydroxymethyltransferase | 4.89e-10 | 2.55e-06 | NA | NA |
5. P | Q81BC0 | Phosphoserine aminotransferase | 4.86e-14 | 5.37e-12 | NA | NA |
5. P | Q2UPB9 | Probable aminotransferase aclI | 3.18e-06 | 7.95e-04 | NA | NA |
5. P | Q83LP3 | Phosphoserine aminotransferase | 5.00e-14 | 7.49e-10 | NA | NA |
5. P | O31631 | Cystathionine gamma-synthase/O-acetylhomoserine (thiol)-lyase | 2.26e-09 | 4.96e-08 | NA | NA |
5. P | Q7WKW5 | Acetylornithine aminotransferase 1 | 8.77e-14 | 1.03e-03 | NA | NA |
5. P | Q3APU1 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.39e-11 | 5.91e-06 | NA | NA |
5. P | Q47MD6 | Serine hydroxymethyltransferase | 3.24e-10 | 1.09e-08 | NA | NA |
5. P | A8M1D3 | Serine hydroxymethyltransferase | 1.33e-06 | 4.20e-07 | NA | NA |
5. P | Q3AW44 | LL-diaminopimelate aminotransferase | 3.27e-07 | 3.35e-03 | NA | NA |
5. P | P69909 | Glutamate decarboxylase alpha | 1.34e-10 | 3.10e-06 | NA | NA |
5. P | A4VU42 | Phosphoserine aminotransferase | 6.99e-15 | 1.98e-10 | NA | NA |
5. P | P22806 | 8-amino-7-oxononanoate synthase | 5.21e-11 | 1.23e-08 | NA | NA |
5. P | P9WGI8 | Serine hydroxymethyltransferase 1 | 4.40e-10 | 3.88e-08 | NA | NA |
5. P | B5FM42 | Histidinol-phosphate aminotransferase | 5.31e-08 | 1.31e-09 | NA | NA |
5. P | O33822 | Probable aspartate/prephenate aminotransferase | 1.12e-08 | 2.55e-05 | NA | NA |
5. P | B8GTH6 | 8-amino-7-oxononanoate synthase | 1.67e-15 | 6.71e-09 | NA | NA |
5. P | B2HVG6 | Histidine decarboxylase | 4.66e-10 | 1.46e-12 | NA | NA |
5. P | Q6GBA6 | Histidinol-phosphate aminotransferase | 2.16e-09 | 1.20e-08 | NA | NA |
5. P | B7NC61 | Histidinol-phosphate aminotransferase | 4.42e-08 | 2.47e-09 | NA | NA |
5. P | A6Q7H8 | Serine hydroxymethyltransferase | 2.68e-10 | 5.50e-07 | NA | NA |
5. P | Q5ZXK6 | Serine hydroxymethyltransferase | 4.61e-10 | 1.46e-07 | NA | NA |
5. P | A1KV06 | Histidinol-phosphate aminotransferase | 8.90e-13 | 8.15e-11 | NA | NA |
5. P | Q9HZ68 | Histidinol-phosphate aminotransferase 2 | 1.44e-09 | 1.15e-04 | NA | NA |
5. P | Q0SR63 | L-seryl-tRNA(Sec) selenium transferase | 9.12e-07 | 1.21e-02 | NA | NA |
5. P | Q32D21 | Serine hydroxymethyltransferase | 2.76e-10 | 3.75e-08 | NA | NA |
5. P | Q58694 | Putative 8-amino-7-oxononanoate synthase | 1.51e-10 | 2.99e-07 | NA | NA |
5. P | A6L8U2 | LL-diaminopimelate aminotransferase | 1.62e-06 | 3.81e-05 | NA | NA |
5. P | Q10VS0 | Histidinol-phosphate aminotransferase | 1.69e-09 | 3.98e-09 | NA | NA |
5. P | P08080 | 5-aminolevulinate synthase | 2.08e-11 | 2.05e-08 | NA | NA |
5. P | A8AHE0 | Succinylornithine transaminase | 2.08e-14 | 2.36e-03 | NA | NA |
5. P | B7J3Y7 | 8-amino-7-oxononanoate synthase | 1.16e-10 | 5.09e-07 | NA | NA |
5. P | B7KD38 | Serine hydroxymethyltransferase | 5.37e-10 | 1.08e-06 | NA | NA |
5. P | A7ZNJ3 | Histidinol-phosphate aminotransferase | 4.70e-08 | 3.27e-09 | NA | NA |
5. P | A6TQQ1 | Serine hydroxymethyltransferase | 1.86e-10 | 1.48e-07 | NA | NA |
5. P | Q7M7Y6 | Histidinol-phosphate aminotransferase | 2.41e-09 | 2.41e-07 | NA | NA |
5. P | B7LM78 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.55e-13 | 1.13e-03 | NA | NA |
5. P | Q749W3 | 8-amino-7-oxononanoate synthase | 1.78e-15 | 1.73e-07 | NA | NA |
5. P | B3ECG2 | Histidinol-phosphate aminotransferase | 2.82e-09 | 2.59e-10 | NA | NA |
5. P | Q4UK96 | Serine hydroxymethyltransferase | 2.35e-10 | 3.00e-06 | NA | NA |
5. P | O67140 | L-seryl-tRNA(Sec) selenium transferase | 1.45e-06 | 2.41e-03 | NA | NA |
5. P | Q6AMK5 | L-seryl-tRNA(Sec) selenium transferase | 8.63e-06 | 3.68e-02 | NA | NA |
5. P | Q82DR2 | Aspartate aminotransferase | 2.04e-08 | 5.79e-06 | NA | NA |
5. P | B0R4Q4 | Histidinol-phosphate aminotransferase | 6.75e-09 | 9.31e-08 | NA | NA |
5. P | C0Q071 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 7.24e-14 | 9.89e-04 | NA | NA |
5. P | A5V5D1 | Serine hydroxymethyltransferase | 1.00e-09 | 5.26e-07 | NA | NA |
5. P | B8F738 | L-seryl-tRNA(Sec) selenium transferase | 1.08e-05 | 1.77e-02 | NA | NA |
5. P | Q7VDS8 | Serine hydroxymethyltransferase | 3.72e-10 | 1.88e-06 | NA | NA |
5. P | Q31I36 | Histidinol-phosphate aminotransferase 1 | 8.37e-10 | 1.93e-10 | NA | NA |
5. P | A1B0I7 | Serine hydroxymethyltransferase | 5.54e-10 | 4.86e-07 | NA | NA |
5. P | Q4JSJ5 | Putative phenylalanine aminotransferase | 3.58e-09 | 4.15e-06 | NA | NA |
5. P | Q93PM7 | Serine hydroxymethyltransferase | 3.53e-10 | 1.98e-09 | NA | NA |
5. P | Q660S1 | Serine hydroxymethyltransferase | 1.20e-09 | 1.43e-09 | NA | NA |
5. P | Q8X823 | 8-amino-7-oxononanoate synthase | 2.16e-11 | 2.75e-06 | NA | NA |
5. P | Q3Z0G4 | Histidinol-phosphate aminotransferase | 4.74e-08 | 1.98e-09 | NA | NA |
5. P | D3DKC4 | Serine hydroxymethyltransferase | 2.50e-10 | 8.31e-06 | NA | NA |
5. P | Q9HTE9 | Serine hydroxymethyltransferase 1 | 4.20e-10 | 1.62e-07 | NA | NA |
5. P | A9BV10 | 8-amino-7-oxononanoate synthase | 4.88e-15 | 5.95e-09 | NA | NA |
5. P | Q54Z26 | Serine hydroxymethyltransferase 1 | 5.71e-10 | 4.24e-06 | NA | NA |
5. P | A9LYX4 | Serine hydroxymethyltransferase | 2.23e-10 | 2.45e-05 | NA | NA |
5. P | B0BC25 | LL-diaminopimelate aminotransferase | 1.27e-07 | 4.13e-09 | NA | NA |
5. P | B0UKC8 | 8-amino-7-oxononanoate synthase | 1.29e-10 | 3.65e-06 | NA | NA |
5. P | A0RQ16 | Serine hydroxymethyltransferase | 2.89e-10 | 6.05e-08 | NA | NA |
5. P | Q9RI00 | Histidinol-phosphate aminotransferase | 3.60e-09 | 3.43e-07 | NA | NA |
5. P | O75600 | 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial | 9.59e-11 | 3.62e-02 | NA | NA |
5. P | A1U4B1 | 8-amino-7-oxononanoate synthase | 1.44e-15 | 1.52e-09 | NA | NA |
5. P | B5RB01 | Succinylornithine transaminase | 3.50e-14 | 5.89e-03 | NA | NA |
5. P | P0C9D0 | NifS-like protein | NA | 4.15e-06 | NA | NA |
5. P | Q9X0Z7 | L-alanine/L-glutamate racemase | 1.17e-06 | 3.66e-08 | NA | NA |
5. P | Q3AW18 | Serine hydroxymethyltransferase | 7.46e-10 | 1.34e-06 | NA | NA |
5. P | P00504 | Aspartate aminotransferase, cytoplasmic | 2.60e-06 | 1.80e-03 | NA | NA |
5. P | B7IHE6 | Serine hydroxymethyltransferase | 7.82e-10 | 6.42e-08 | NA | NA |
5. P | P0A959 | Glutamate-pyruvate aminotransferase AlaA | 6.56e-07 | 8.31e-06 | NA | NA |
5. P | B1XGK9 | Succinylornithine transaminase | 3.10e-14 | 1.05e-02 | NA | NA |
5. P | Q8ZGB4 | Phosphoserine aminotransferase | 9.66e-14 | 3.74e-10 | NA | NA |
5. P | Q7WHN5 | Histidinol-phosphate aminotransferase 1 | 6.77e-10 | 2.76e-09 | NA | NA |
5. P | Q1RB45 | Succinylornithine transaminase | 2.54e-14 | 7.44e-03 | NA | NA |
5. P | Q803A7 | O-phosphoseryl-tRNA(Sec) selenium transferase | 3.80e-07 | 2.27e-02 | NA | NA |
5. P | Q4QM19 | Serine hydroxymethyltransferase | 2.99e-10 | 1.46e-07 | NA | NA |
5. P | P0A853 | Tryptophanase | 4.40e-07 | 2.61e-03 | NA | NA |
5. P | Q6GID1 | Ornithine aminotransferase 2 | 2.09e-14 | 3.00e-03 | NA | NA |
5. P | O08370 | Serine hydroxymethyltransferase | 4.70e-10 | 6.10e-06 | NA | NA |
5. P | A0Q587 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.70e-10 | 6.69e-10 | NA | NA |
5. P | B0SMK7 | LL-diaminopimelate aminotransferase | 3.71e-07 | 3.11e-03 | NA | NA |
5. P | Q3J9D6 | 8-amino-7-oxononanoate synthase | 2.33e-15 | 1.30e-08 | NA | NA |
5. P | Q47WY2 | Serine hydroxymethyltransferase 4 | 6.00e-10 | 5.39e-08 | NA | NA |
5. P | Q0P9D3 | UDP-N-acetylbacillosamine transaminase | 5.07e-12 | 1.86e-02 | NA | NA |
5. P | Q9RRM7 | Histidinol-phosphate aminotransferase | 6.61e-10 | 1.18e-08 | NA | NA |
5. P | A5N7Q7 | Histidinol-phosphate aminotransferase | 3.06e-09 | 1.30e-07 | NA | NA |
5. P | P95957 | Uncharacterized aminotransferase SSO0104 | 5.05e-08 | 6.69e-10 | NA | NA |
5. P | A4G5N9 | 8-amino-7-oxononanoate synthase | 4.43e-11 | 2.01e-07 | NA | NA |
5. P | Q4FLT4 | Serine hydroxymethyltransferase | 3.91e-10 | 1.84e-06 | NA | NA |
5. P | Q02R23 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 2.02e-13 | 9.63e-03 | NA | NA |
5. P | Q4JW58 | Histidinol-phosphate aminotransferase | 6.14e-09 | 7.93e-05 | NA | NA |
5. P | Q7W9I4 | Putative 8-amino-7-oxononanoate synthase | 6.13e-11 | 2.76e-09 | NA | NA |
5. P | B1L9T8 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.05e-07 | 2.54e-08 | NA | NA |
5. P | Q65HG0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.56e-11 | 1.82e-06 | NA | NA |
5. P | Q6LT75 | Histidinol-phosphate aminotransferase | 3.83e-09 | 2.87e-10 | NA | NA |
5. P | P54772 | Histidine decarboxylase | 1.74e-10 | 1.12e-09 | NA | NA |
5. P | Q73WG1 | Serine hydroxymethyltransferase | 3.67e-10 | 2.00e-09 | NA | NA |
5. P | B3EAE0 | 8-amino-7-oxononanoate synthase | 2.84e-11 | 6.47e-09 | NA | NA |
5. P | B8DP96 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.68e-08 | 8.65e-09 | NA | NA |
5. P | Q0T6I4 | 8-amino-7-oxononanoate synthase | 1.85e-11 | 2.24e-06 | NA | NA |
5. P | B8I2N8 | Serine hydroxymethyltransferase | 1.55e-10 | 1.27e-07 | NA | NA |
5. P | Q83A83 | Cystathionine beta-lyase | 1.93e-08 | 1.83e-05 | NA | NA |
5. P | Q5E9P9 | Serine hydroxymethyltransferase, cytosolic | 9.06e-07 | 1.74e-02 | NA | NA |
5. P | Q8NXN3 | Histidinol-phosphate aminotransferase | 2.31e-09 | 1.20e-08 | NA | NA |
5. P | Q11DR9 | Histidinol-phosphate aminotransferase | 5.04e-14 | 1.26e-07 | NA | NA |
5. P | P63515 | Putative phosphoserine aminotransferase | 4.42e-08 | 1.72e-10 | NA | NA |
5. P | B1IXT4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.13e-13 | 6.57e-04 | NA | NA |
5. P | P0A827 | Serine hydroxymethyltransferase | 2.54e-10 | 1.69e-08 | NA | NA |
5. P | B4E9L6 | 8-amino-7-oxononanoate synthase | 9.09e-11 | 1.54e-06 | NA | NA |
5. P | Q46WL3 | Histidinol-phosphate aminotransferase 2 | 5.78e-08 | 2.79e-09 | NA | NA |
5. P | Q630T3 | Serine hydroxymethyltransferase | 2.33e-10 | 5.32e-08 | NA | NA |
5. P | Q15WB3 | Serine hydroxymethyltransferase | 8.02e-10 | 9.30e-09 | NA | NA |
5. P | A4WAM5 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.28e-13 | 2.52e-03 | NA | NA |
5. P | A5FH28 | Phosphoserine aminotransferase | 1.04e-12 | 5.89e-13 | NA | NA |
5. P | A0KIC7 | 8-amino-7-oxononanoate synthase | 8.88e-16 | 8.10e-08 | NA | NA |
5. P | B4ET24 | Phosphoserine aminotransferase | 6.97e-14 | 1.02e-09 | NA | NA |
5. P | Q8U7Y5 | Serine hydroxymethyltransferase 2 | 5.12e-10 | 1.63e-05 | NA | NA |
5. P | Q1RA52 | Histidinol-phosphate aminotransferase | 5.06e-08 | 2.29e-09 | NA | NA |
5. P | Q87AS2 | Serine hydroxymethyltransferase | 4.13e-10 | 3.97e-07 | NA | NA |
5. P | C0ZBR4 | Ornithine aminotransferase | 3.77e-14 | 2.19e-03 | NA | NA |
5. P | Q67KI2 | Histidinol-phosphate aminotransferase | 1.08e-09 | 1.40e-06 | NA | NA |
5. P | A8A0U0 | Succinylornithine transaminase | 3.13e-14 | 8.97e-03 | NA | NA |
5. P | Q12CL3 | Phosphoserine aminotransferase | 4.54e-14 | 1.54e-11 | NA | NA |
5. P | Q5HE87 | Serine hydroxymethyltransferase | 1.64e-10 | 1.44e-06 | NA | NA |
5. P | B2SFM4 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.63e-07 | 6.96e-08 | NA | NA |
5. P | A5CWI3 | Serine hydroxymethyltransferase | 6.18e-10 | 7.09e-06 | NA | NA |
5. P | C0Q1K1 | Histidinol-phosphate aminotransferase | 5.06e-08 | 1.25e-09 | NA | NA |
5. P | Q8EM73 | Serine hydroxymethyltransferase | 2.19e-10 | 5.46e-09 | NA | NA |
5. P | Q9HMV2 | Probable tryptophanase | 4.57e-07 | 1.11e-05 | NA | NA |
5. P | Q8FU28 | Putative phenylalanine aminotransferase | 2.62e-09 | 1.50e-08 | NA | NA |
5. P | Q66D66 | 8-amino-7-oxononanoate synthase | 3.62e-11 | 1.65e-06 | NA | NA |
5. P | B1Z7Y8 | 8-amino-7-oxononanoate synthase | 6.17e-11 | 1.31e-04 | NA | NA |
5. P | B9E6R9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.07e-08 | 2.05e-06 | NA | NA |
5. P | Q5FG30 | Serine hydroxymethyltransferase | 3.48e-10 | 2.14e-06 | NA | NA |
5. P | Q8X598 | Succinylornithine transaminase | 2.70e-14 | 3.61e-03 | NA | NA |
5. P | B1JSS3 | 8-amino-7-oxononanoate synthase | 3.60e-11 | 1.58e-06 | NA | NA |
5. P | Q9ZMP7 | Serine hydroxymethyltransferase | 2.34e-10 | 2.13e-07 | NA | NA |
5. P | C1F3Q7 | Serine hydroxymethyltransferase | 2.09e-10 | 3.51e-07 | NA | NA |
5. P | A3M7A4 | Histidine decarboxylase | 4.15e-10 | 2.11e-12 | NA | NA |
5. P | Q04Z75 | Histidinol-phosphate aminotransferase | 2.52e-09 | 1.04e-07 | NA | NA |
5. P | A0RYP2 | Serine hydroxymethyltransferase | 1.34e-10 | 2.21e-09 | NA | NA |
5. P | B1JBC0 | Histidinol-phosphate aminotransferase | 6.98e-08 | 3.08e-09 | NA | NA |
5. P | A9KCT6 | Phosphoserine aminotransferase | 1.08e-13 | 2.77e-07 | NA | NA |
5. P | B3H053 | Serine hydroxymethyltransferase | 3.16e-10 | 8.00e-08 | NA | NA |
5. P | Q6M0Y7 | Probable L-tyrosine/L-aspartate decarboxylase | 1.90e-12 | 2.87e-10 | NA | NA |
5. P | C0R1Z0 | Histidinol-phosphate aminotransferase | 2.86e-13 | 1.24e-08 | NA | NA |
5. P | Q47QS8 | Histidinol-phosphate aminotransferase | 3.24e-09 | 4.49e-07 | NA | NA |
5. P | A7ZP71 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.07e-13 | 1.02e-03 | NA | NA |
5. P | Q6HAW9 | Serine hydroxymethyltransferase | 2.34e-10 | 5.20e-08 | NA | NA |
5. P | B1WPY4 | Serine hydroxymethyltransferase | 5.17e-10 | 1.91e-05 | NA | NA |
5. P | Q6P6M7 | O-phosphoseryl-tRNA(Sec) selenium transferase | 1.11e-06 | 1.55e-03 | NA | NA |
5. P | Q8RXU4 | Probable low-specificity L-threonine aldolase 1 | 2.02e-14 | 2.49e-10 | NA | NA |
5. P | P62031 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.41e-10 | 1.07e-07 | NA | NA |
5. P | A5GD93 | LL-diaminopimelate aminotransferase | 1.85e-07 | 7.95e-04 | NA | NA |
5. P | B0B804 | Serine hydroxymethyltransferase | 1.20e-09 | 1.06e-03 | NA | NA |
5. P | Q9ZGH4 | dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase | 1.35e-07 | 1.61e-05 | NA | NA |
5. P | Q6HL37 | Histidinol-phosphate aminotransferase 1 | 1.31e-09 | 5.39e-08 | NA | NA |
5. P | B9IXL8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.88e-08 | 9.24e-06 | NA | NA |
5. P | Q9APM5 | Taurine--pyruvate aminotransferase | 4.38e-12 | 2.18e-02 | NA | NA |
5. P | Q1DZA6 | Kynureninase | 0.00e+00 | 3.54e-11 | NA | NA |
5. P | P0A4X5 | 8-amino-7-oxononanoate synthase | 2.22e-14 | 1.90e-07 | NA | NA |
5. P | Q9CHW5 | Phosphoserine aminotransferase | 2.30e-14 | 5.75e-12 | NA | NA |
5. P | Q07907 | Acetylornithine aminotransferase | 7.77e-15 | 1.09e-03 | NA | NA |
5. P | A1VY36 | Histidinol-phosphate aminotransferase | 6.80e-10 | 3.93e-08 | NA | NA |
5. P | Q0AVH8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 6.51e-08 | 3.13e-07 | NA | NA |
5. P | D9R201 | Tyrosine phenol-lyase | 1.26e-08 | 2.74e-05 | NA | NA |
5. P | Q3IT46 | Probable L-aspartate decarboxylase | 4.74e-13 | 3.27e-11 | NA | NA |
5. P | Q795J3 | Putative pyridoxal phosphate-dependent aminotransferase EpsN | 4.47e-09 | 2.85e-02 | NA | NA |
5. P | B5BA72 | Succinylornithine transaminase | 3.60e-14 | 3.64e-03 | NA | NA |
5. P | Q7AC24 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.06e-13 | 1.58e-03 | NA | NA |
5. P | Q5QKR7 | UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase | 2.75e-13 | 1.66e-03 | NA | NA |
5. P | Q8Z892 | 8-amino-7-oxononanoate synthase | 1.87e-11 | 1.88e-07 | NA | NA |
5. P | B8HJY4 | LL-diaminopimelate aminotransferase | 2.99e-07 | 4.18e-04 | NA | NA |
5. P | Q8X4S6 | Acetylornithine/succinyldiaminopimelate aminotransferase | 1.13e-13 | 1.25e-02 | NA | NA |
5. P | Q3AC10 | LL-diaminopimelate aminotransferase | 1.52e-07 | 3.47e-07 | NA | NA |
5. P | Q7N6Q6 | 8-amino-7-oxononanoate synthase | 2.51e-11 | 5.98e-08 | NA | NA |
5. P | Q9X4H1 | Phosphoserine aminotransferase | 4.54e-14 | 1.23e-07 | NA | NA |
5. P | B0R5J9 | Serine hydroxymethyltransferase | 3.49e-10 | 7.84e-11 | NA | NA |
5. P | Q9XCW4 | dTDP-4-amino-4,6-dideoxy-D-glucose transaminase | 1.76e-09 | 1.80e-04 | NA | NA |
5. P | Q10104 | Serine hydroxymethyltransferase, mitochondrial | 2.39e-09 | 2.92e-03 | NA | NA |
5. P | A5UML0 | Glutamate-1-semialdehyde 2,1-aminomutase | 1.21e-13 | 1.62e-02 | NA | NA |
5. P | Q6CWC1 | Ornithine aminotransferase | 1.36e-13 | 4.37e-03 | NA | NA |
5. P | Q4JAP8 | [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase | 2.92e-14 | 3.64e-03 | NA | NA |
5. P | Q72XD7 | Serine hydroxymethyltransferase | 2.06e-10 | 3.21e-08 | NA | NA |
5. P | Q59282 | Acetylornithine aminotransferase | 2.99e-13 | 2.27e-02 | NA | NA |
5. P | A1JS45 | Succinylornithine transaminase | 5.18e-14 | 7.78e-03 | NA | NA |
5. P | Q3IRT1 | Histidinol-phosphate aminotransferase | 4.28e-09 | 1.43e-08 | NA | NA |
5. P | Q98BB7 | Acetylornithine aminotransferase | 2.36e-14 | 1.01e-02 | NA | NA |
5. P | A9KYJ6 | Serine hydroxymethyltransferase | 3.07e-10 | 2.44e-09 | NA | NA |
5. P | P34895 | Serine hydroxymethyltransferase | 3.55e-10 | 9.74e-06 | NA | NA |
5. P | B7LC58 | 8-amino-7-oxononanoate synthase | 2.51e-11 | 1.84e-06 | NA | NA |
5. P | Q8G4S8 | Histidinol-phosphate aminotransferase | 3.88e-09 | 2.96e-07 | NA | NA |
5. P | B1N009 | Histidinol-phosphate aminotransferase | 2.77e-09 | 6.95e-10 | NA | NA |
5. P | B7MWU0 | Histidinol-phosphate aminotransferase | 4.71e-08 | 3.88e-09 | NA | NA |
5. P | Q28N04 | Serine hydroxymethyltransferase | 9.03e-10 | 5.95e-07 | NA | NA |
5. P | B2VBJ1 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.85e-13 | 9.98e-03 | NA | NA |
5. P | O94570 | Aromatic amino acid aminotransferase C1773.13 | 3.37e-06 | 6.37e-06 | NA | NA |
5. P | Q2IWS4 | Serine hydroxymethyltransferase | 7.87e-10 | 7.27e-07 | NA | NA |
5. P | Q4ZSZ4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.24e-13 | 1.03e-03 | NA | NA |
5. P | A4XL61 | Serine hydroxymethyltransferase | 3.75e-10 | 1.61e-08 | NA | NA |
5. P | B8GN16 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.78e-14 | 3.33e-08 | NA | NA |
5. P | O27139 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 2.00e-15 | 4.24e-24 | NA | NA |
5. P | B9EAM9 | Ornithine aminotransferase | 4.61e-14 | 5.58e-03 | NA | NA |
5. P | Q9KN05 | Tryptophanase | 4.78e-07 | 1.96e-02 | NA | NA |
5. P | Q8FCC1 | L-seryl-tRNA(Sec) selenium transferase | 7.88e-06 | 2.18e-02 | NA | NA |
5. P | Q92JE7 | Probable aspartate/prephenate aminotransferase | 1.38e-08 | 2.34e-03 | NA | NA |
5. P | A2CCJ3 | Serine hydroxymethyltransferase | 6.48e-10 | 2.23e-08 | NA | NA |
5. P | Q8CT82 | Ornithine aminotransferase | 3.29e-14 | 1.09e-03 | NA | NA |
5. P | Q8PDF1 | 8-amino-7-oxononanoate synthase | 4.40e-11 | 4.96e-08 | NA | NA |
5. P | B8ZPH5 | Serine hydroxymethyltransferase | 5.54e-10 | 3.18e-08 | NA | NA |
5. P | Q58466 | Uncharacterized protein MJ1066 | 2.37e-13 | 1.48e-02 | NA | NA |
5. P | Q7MV30 | Phosphoserine aminotransferase | 1.90e-13 | 5.45e-11 | NA | NA |
5. P | B1X9T7 | Tryptophanase | 4.41e-07 | 2.61e-03 | NA | NA |
5. P | Q05979 | Kynureninase | 0.00e+00 | 3.54e-16 | NA | NA |
5. P | P56069 | Cystathionine gamma-synthase | 3.57e-12 | 1.91e-05 | NA | NA |
5. P | C1F0N9 | Serine hydroxymethyltransferase | 2.60e-10 | 2.76e-08 | NA | NA |
5. P | A4WUN9 | Histidinol-phosphate aminotransferase | 8.82e-14 | 5.51e-08 | NA | NA |
5. P | B5EEV8 | 8-amino-7-oxononanoate synthase | 8.44e-15 | 5.40e-09 | NA | NA |
5. P | B1XYE7 | Serine hydroxymethyltransferase | 1.18e-10 | 2.13e-07 | NA | NA |
5. P | B2K8T1 | 8-amino-7-oxononanoate synthase | 3.22e-11 | 1.65e-06 | NA | NA |
5. P | P05201 | Aspartate aminotransferase, cytoplasmic | 8.66e-06 | 1.23e-03 | NA | NA |
5. P | B2VBT8 | 8-amino-7-oxononanoate synthase | 5.30e-11 | 1.01e-06 | NA | NA |
5. P | Q9ZMW7 | Cystathionine gamma-synthase | 2.59e-12 | 1.99e-04 | NA | NA |
5. P | Q6D3C0 | 8-amino-7-oxononanoate synthase | 3.48e-11 | 7.38e-08 | NA | NA |
5. P | Q0BH96 | Phosphoserine aminotransferase | 6.85e-14 | 5.02e-12 | NA | NA |
5. P | B4SE31 | Serine hydroxymethyltransferase | 1.43e-09 | 2.31e-07 | NA | NA |
5. P | B3QLR6 | 8-amino-7-oxononanoate synthase | 1.57e-10 | 4.97e-05 | NA | NA |
5. P | Q18953 | O-phosphoseryl-tRNA(Sec) selenium transferase | 7.93e-07 | 4.10e-04 | NA | NA |
5. P | A7GV66 | Serine hydroxymethyltransferase | 2.18e-10 | 3.25e-08 | NA | NA |
5. P | Q5WL78 | Diaminobutyrate--2-oxoglutarate transaminase | 5.79e-12 | 3.07e-02 | NA | NA |
5. P | B7IHH3 | Glutamate-1-semialdehyde 2,1-aminomutase | 3.49e-13 | 3.29e-02 | NA | NA |
5. P | B2SNV6 | Serine hydroxymethyltransferase | 4.72e-10 | 5.82e-07 | NA | NA |
5. P | Q2NIT8 | Serine hydroxymethyltransferase | 4.82e-10 | 2.72e-09 | NA | NA |
5. P | P0C2T9 | Cystathionine beta-lyase | 1.68e-12 | 1.06e-03 | NA | NA |
5. P | Q59196 | Phosphoserine aminotransferase | 3.23e-14 | 3.06e-10 | NA | NA |
5. P | B7LD99 | Phosphoserine aminotransferase | 6.76e-14 | 7.49e-10 | NA | NA |
5. P | Q3SK88 | Phosphoserine aminotransferase | 1.01e-13 | 9.56e-12 | NA | NA |
5. P | Q1GZA7 | 8-amino-7-oxononanoate synthase | 7.01e-11 | 1.12e-05 | NA | NA |
5. P | A8GBC6 | 8-amino-7-oxononanoate synthase | 4.95e-11 | 6.30e-06 | NA | NA |
5. P | A0Q9F3 | Putative phenylalanine aminotransferase | 1.03e-13 | 3.37e-08 | NA | NA |
5. P | A8FN57 | L-seryl-tRNA(Sec) selenium transferase | 3.08e-05 | 1.34e-02 | NA | NA |
5. P | Q3MAL4 | LL-diaminopimelate aminotransferase 1 | 2.65e-07 | 5.21e-04 | NA | NA |
5. P | Q1JGU8 | Serine hydroxymethyltransferase | 5.13e-10 | 2.61e-07 | NA | NA |
5. P | Q4FQF9 | Histidinol-phosphate aminotransferase 2 | 1.71e-09 | 4.38e-06 | NA | NA |
5. P | B2IPI0 | Serine hydroxymethyltransferase | 5.61e-10 | 3.18e-08 | NA | NA |
5. P | B4SGL8 | Histidinol-phosphate aminotransferase | 4.27e-09 | 4.13e-09 | NA | NA |
5. P | A7I757 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 1 | 4.44e-16 | 2.45e-20 | NA | NA |
5. P | A1JS67 | 8-amino-7-oxononanoate synthase | 4.25e-11 | 1.81e-05 | NA | NA |
5. P | B9IRU8 | Serine hydroxymethyltransferase | 2.13e-10 | 3.21e-08 | NA | NA |
5. P | A0LK14 | Phosphoserine aminotransferase | 4.84e-13 | 6.33e-14 | NA | NA |
5. P | B8FLC3 | Phosphoserine aminotransferase | 1.98e-13 | 2.01e-13 | NA | NA |
5. P | O25320 | 8-amino-7-oxononanoate synthase | 7.22e-15 | 7.03e-10 | NA | NA |
5. P | A5N7P5 | Serine hydroxymethyltransferase | 1.51e-10 | 2.99e-08 | NA | NA |
5. P | Q47KH1 | Putative phenylalanine aminotransferase | 6.08e-14 | 1.48e-06 | NA | NA |
5. P | Q03VY3 | Histidinol-phosphate aminotransferase | 6.23e-10 | 3.38e-10 | NA | NA |
5. P | B9LNJ8 | Histidinol-phosphate aminotransferase | 3.51e-09 | 6.61e-10 | NA | NA |
5. P | C5A7A4 | Histidinol-phosphate aminotransferase | 3.45e-12 | 2.56e-09 | NA | NA |
5. P | A1VUJ6 | 8-amino-7-oxononanoate synthase | 9.38e-11 | 6.96e-08 | NA | NA |
5. P | Q0TJE6 | Phosphoserine aminotransferase | 4.11e-14 | 1.25e-09 | NA | NA |
5. P | B9MDV4 | Histidinol-phosphate aminotransferase | 1.96e-13 | 3.65e-06 | NA | NA |
5. P | A2C090 | Serine hydroxymethyltransferase | 2.37e-10 | 8.04e-07 | NA | NA |
5. P | A2XLL2 | 1-aminocyclopropane-1-carboxylate synthase 1 | 1.30e-05 | 1.19e-03 | NA | NA |
5. P | B1X847 | Phosphoserine aminotransferase | 6.81e-14 | 1.68e-09 | NA | NA |
5. P | B2AG98 | 8-amino-7-oxononanoate synthase | 6.81e-11 | 4.36e-08 | NA | NA |
5. P | Q4UTC9 | Phosphoserine aminotransferase | 1.99e-14 | 1.42e-11 | NA | NA |
5. P | O33062 | Putative phosphoserine aminotransferase | 4.75e-08 | 6.89e-11 | NA | NA |
5. P | P57379 | Adenosylmethionine-8-amino-7-oxononanoate aminotransferase | 9.54e-09 | 1.22e-02 | NA | NA |
5. P | B1MYF5 | Serine hydroxymethyltransferase | 1.63e-10 | 3.14e-08 | NA | NA |
5. P | Q5LDN9 | Phosphoserine aminotransferase | 5.04e-13 | 1.06e-10 | NA | NA |
5. P | Q3SI68 | Histidinol-phosphate aminotransferase 2 | 1.15e-09 | 1.52e-08 | NA | NA |
5. P | Q3YZV3 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.71e-14 | 9.43e-04 | NA | NA |
5. P | Q17YS0 | Serine hydroxymethyltransferase | 2.37e-10 | 1.06e-07 | NA | NA |
5. P | C0R4C7 | Serine hydroxymethyltransferase | 2.71e-10 | 7.80e-06 | NA | NA |
5. P | Q9KMP4 | Serine hydroxymethyltransferase 2 | 4.86e-10 | 1.01e-06 | NA | NA |
5. P | Q8I566 | Serine hydroxymethyltransferase | 7.96e-10 | 1.43e-08 | NA | NA |
5. P | Q83BT3 | Serine hydroxymethyltransferase | 3.44e-10 | 1.29e-06 | NA | NA |
5. P | P27833 | dTDP-4-amino-4,6-dideoxygalactose transaminase | 1.55e-09 | 6.38e-04 | NA | NA |
5. P | A5GF66 | Serine hydroxymethyltransferase | 2.38e-10 | 5.08e-08 | NA | NA |
5. P | B7JYG9 | Serine hydroxymethyltransferase | 7.95e-10 | 1.05e-05 | NA | NA |
5. P | B4RLC9 | Serine hydroxymethyltransferase | 2.44e-10 | 6.73e-07 | NA | NA |
5. P | Q7N216 | Serine hydroxymethyltransferase | 2.93e-10 | 1.09e-08 | NA | NA |
5. P | Q72PG3 | Histidinol-phosphate aminotransferase | 2.89e-09 | 2.52e-07 | NA | NA |
5. P | Q2JI36 | Serine hydroxymethyltransferase | 7.43e-10 | 4.57e-06 | NA | NA |
5. P | Q30P60 | Serine hydroxymethyltransferase 2 | 2.74e-10 | 3.93e-07 | NA | NA |
5. P | Q1MR87 | LL-diaminopimelate aminotransferase | 1.76e-07 | 4.65e-07 | NA | NA |
5. P | P21633 | Threonine-phosphate decarboxylase | 4.60e-07 | 2.21e-06 | NA | NA |
5. P | Q8RCW2 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.39e-08 | 2.52e-05 | NA | NA |
5. P | B0TZJ6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.35e-10 | 4.82e-10 | NA | NA |
5. P | A2SSJ1 | Histidinol-phosphate aminotransferase | 1.88e-07 | 1.70e-09 | NA | NA |
5. P | B6I3U1 | Tryptophanase | 4.20e-07 | 2.61e-03 | NA | NA |
5. P | Q65192 | NifS-like protein | NA | 5.68e-05 | NA | NA |
5. P | Q57PX9 | Succinylornithine transaminase | 2.74e-14 | 5.10e-03 | NA | NA |
5. P | A6URB4 | Probable L-tyrosine/L-aspartate decarboxylase | 2.11e-12 | 6.80e-11 | NA | NA |
5. P | Q18026 | Kynureninase | 0.00e+00 | 1.73e-09 | NA | NA |
5. P | Q87WC1 | Serine hydroxymethyltransferase 2 | 2.16e-10 | 4.30e-07 | NA | NA |
5. P | Q9CXF0 | Kynureninase | 0.00e+00 | 2.21e-11 | NA | NA |
5. P | Q4XWV5 | Ornithine aminotransferase | 2.61e-10 | 1.48e-03 | NA | NA |
5. P | A2BT75 | LL-diaminopimelate aminotransferase | 3.86e-07 | 1.25e-03 | NA | NA |
5. P | Q2P8F2 | 8-amino-7-oxononanoate synthase | 3.87e-11 | 6.88e-08 | NA | NA |
5. P | B3QUG2 | Serine hydroxymethyltransferase | 1.73e-09 | 1.67e-06 | NA | NA |
5. P | P34037 | Histidinol-phosphate aminotransferase | 2.07e-13 | 1.77e-07 | NA | NA |
5. P | Q9K9K5 | Arginine decarboxylase | 2.97e-09 | 7.80e-04 | NA | NA |
5. P | P38716 | Uncharacterized trans-sulfuration enzyme YHR112C | 2.46e-08 | 7.95e-07 | NA | NA |
5. P | Q6GJB8 | Putative pyridoxal phosphate-dependent acyltransferase | 3.82e-11 | 1.67e-07 | NA | NA |
5. P | Q7VWL5 | Histidinol-phosphate aminotransferase 1 | 5.83e-10 | 8.49e-10 | NA | NA |
5. P | A2R7T0 | Kynureninase 1 | 0.00e+00 | 4.18e-09 | NA | NA |
5. P | B9DMF3 | Serine hydroxymethyltransferase | 1.83e-10 | 4.63e-08 | NA | NA |
5. P | Q54Q04 | Kynureninase | 0.00e+00 | 1.66e-10 | NA | NA |
5. P | A7X4V7 | Serine hydroxymethyltransferase | 1.66e-10 | 1.44e-06 | NA | NA |
5. P | Q8KDS8 | Aspartate/prephenate aminotransferase | 2.28e-08 | 8.05e-06 | NA | NA |
5. P | P37291 | Serine hydroxymethyltransferase, cytosolic | 8.04e-07 | 6.96e-07 | NA | NA |
5. P | Q9FN30 | Probable aminotransferase TAT2 | 1.24e-09 | 2.42e-08 | NA | NA |
5. P | Q8EEH2 | Phosphoserine aminotransferase | 9.52e-07 | 1.67e-08 | NA | NA |
5. P | Q81M98 | Acetylornithine aminotransferase | 2.91e-14 | 9.13e-03 | NA | NA |
5. P | Q0HIX3 | Phosphoserine aminotransferase | 1.50e-09 | 1.04e-07 | NA | NA |
5. P | A5VPU7 | Serine hydroxymethyltransferase | 4.59e-10 | 2.77e-07 | NA | NA |
5. P | Q59228 | Aspartate aminotransferase | 2.62e-08 | 8.50e-07 | NA | NA |
5. P | A1BGB4 | Histidinol-phosphate aminotransferase | 1.74e-09 | 2.31e-10 | NA | NA |
5. P | A6VZ92 | Phosphoserine aminotransferase | 1.10e-13 | 2.34e-10 | NA | NA |
5. P | C6DAW7 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 7.83e-14 | 1.22e-02 | NA | NA |
5. P | Q976K0 | [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase | 4.54e-14 | 7.02e-04 | NA | NA |
5. P | B7USC9 | Succinylornithine transaminase | 2.72e-14 | 8.43e-03 | NA | NA |
5. P | Q7N9E5 | Acetylornithine/succinyldiaminopimelate aminotransferase | 5.23e-14 | 2.29e-02 | NA | NA |
5. P | Q146K3 | 8-amino-7-oxononanoate synthase | 6.94e-11 | 3.20e-06 | NA | NA |
5. P | A5WH82 | Serine hydroxymethyltransferase | 9.46e-10 | 1.46e-06 | NA | NA |
5. P | A9N5B4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 8.04e-14 | 9.52e-04 | NA | NA |
5. P | A5GW23 | LL-diaminopimelate aminotransferase | 3.11e-07 | 8.42e-04 | NA | NA |
5. P | O25130 | UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase | 1.02e-13 | 2.15e-03 | NA | NA |
5. P | Q8Z1Z3 | Acetylornithine/succinyldiaminopimelate aminotransferase | 1.10e-13 | 1.04e-02 | NA | NA |
5. P | Q8NWC9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.75e-08 | 5.79e-06 | NA | NA |
5. P | Q82WA8 | Aspartate/prephenate aminotransferase | 9.43e-09 | 8.22e-07 | NA | NA |
5. P | B5EZH6 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 7.84e-14 | 9.52e-04 | NA | NA |
5. P | A6T700 | Phosphoserine aminotransferase | 7.46e-14 | 4.72e-11 | NA | NA |
5. P | A1W6H6 | Serine hydroxymethyltransferase | 1.10e-10 | 1.44e-07 | NA | NA |
5. P | Q10ZC3 | LL-diaminopimelate aminotransferase | 1.93e-07 | 2.35e-04 | NA | NA |
5. P | P59432 | Serine hydroxymethyltransferase | 3.34e-10 | 1.58e-08 | NA | NA |
5. P | A4TN19 | Phosphoserine aminotransferase | 7.17e-14 | 1.51e-10 | NA | NA |
5. P | P04693 | Aromatic-amino-acid aminotransferase | 1.24e-06 | 3.51e-05 | NA | NA |
5. P | Q1R089 | Histidinol-phosphate aminotransferase | 1.67e-09 | 7.35e-07 | NA | NA |
5. P | Q8Y0Z0 | Phosphoserine aminotransferase | 5.37e-14 | 1.34e-14 | NA | NA |
5. P | Q7VFL1 | Serine hydroxymethyltransferase | 3.02e-10 | 1.58e-08 | NA | NA |
5. P | Q8DM42 | Histidinol-phosphate aminotransferase | 9.37e-10 | 1.56e-09 | NA | NA |
5. P | A7FKM8 | 8-amino-7-oxononanoate synthase | 3.48e-11 | 1.58e-06 | NA | NA |
5. P | Q9YA15 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.19e-08 | 2.20e-08 | NA | NA |
5. P | Q47XB7 | Histidinol-phosphate aminotransferase | 5.21e-06 | 2.53e-09 | NA | NA |
5. P | B5XLJ2 | Serine hydroxymethyltransferase | 4.69e-10 | 5.39e-08 | NA | NA |
5. P | Q84I52 | Histidinol-phosphate aminotransferase | 7.72e-09 | 1.08e-10 | NA | NA |
5. P | B0XS72 | Kynureninase 1 | 0.00e+00 | 5.43e-06 | NA | NA |
5. P | A6UWX3 | Putative 8-amino-7-oxononanoate synthase | 2.89e-15 | 5.91e-08 | NA | NA |
5. P | P61000 | Histidinol-phosphate aminotransferase | 2.67e-09 | 6.05e-11 | NA | NA |
5. P | B2JZM8 | Histidinol-phosphate aminotransferase | 1.02e-07 | 2.60e-08 | NA | NA |
5. P | Q1MIU5 | Serine hydroxymethyltransferase | 3.31e-10 | 2.44e-07 | NA | NA |
5. P | B8F713 | Putative 8-amino-7-oxononanoate synthase | 4.86e-14 | 2.58e-06 | NA | NA |
5. P | P34896 | Serine hydroxymethyltransferase, cytosolic | 9.99e-07 | 1.01e-02 | NA | NA |
5. P | B0TZJ5 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 3.34e-07 | 1.58e-07 | NA | NA |
5. P | A4TNQ5 | 8-amino-7-oxononanoate synthase | 4.06e-11 | 1.31e-06 | NA | NA |
5. P | Q70KD4 | Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase | 2.41e-07 | 2.81e-03 | NA | NA |
5. P | Q1RGX5 | Serine hydroxymethyltransferase | 4.74e-10 | 1.02e-07 | NA | NA |
5. P | B4U313 | Serine hydroxymethyltransferase | 5.60e-10 | 7.55e-08 | NA | NA |
5. P | B2HQA3 | Histidinol-phosphate aminotransferase | 5.81e-09 | 9.19e-07 | NA | NA |
5. P | Q882K8 | Acetylornithine aminotransferase 2 | 2.79e-14 | 1.11e-02 | NA | NA |
5. P | B0TY45 | Histidinol-phosphate aminotransferase | 3.00e-07 | 3.14e-10 | NA | NA |
5. P | Q601P7 | Serine hydroxymethyltransferase | 2.03e-10 | 7.38e-08 | NA | NA |
5. P | Q5E706 | Serine hydroxymethyltransferase | 3.21e-10 | 5.40e-09 | NA | NA |
5. P | P17174 | Aspartate aminotransferase, cytoplasmic | 1.76e-06 | 1.89e-04 | NA | NA |
5. P | Q1B7G5 | Histidinol-phosphate aminotransferase | 4.71e-09 | 2.19e-06 | NA | NA |
5. P | Q2NUB0 | Phosphoserine aminotransferase | 4.83e-14 | 8.70e-11 | NA | NA |
5. P | Q9Z856 | LL-diaminopimelate aminotransferase | 8.22e-08 | 2.28e-07 | NA | NA |
5. P | B9EAC1 | Histidinol-phosphate aminotransferase | 2.38e-09 | 2.51e-08 | NA | NA |
5. P | B9KDG5 | L-seryl-tRNA(Sec) selenium transferase | 3.16e-06 | 1.64e-03 | NA | NA |
5. P | Q9LR29 | Tryptophan aminotransferase-related protein 1 | 1.53e-04 | 3.22e-17 | NA | NA |
5. P | B1L869 | Histidinol-phosphate aminotransferase | 3.07e-08 | 1.02e-08 | NA | NA |
5. P | B5BCP8 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 7.62e-14 | 1.57e-03 | NA | NA |
5. P | Q82WM3 | Histidinol-phosphate aminotransferase 1 | 9.61e-10 | 4.20e-10 | NA | NA |
5. P | Q2NRV5 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.64e-13 | 3.35e-03 | NA | NA |
5. P | A4SVI6 | Serine hydroxymethyltransferase | 8.72e-11 | 1.20e-07 | NA | NA |
5. P | Q0T2N0 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.07e-13 | 1.08e-03 | NA | NA |
5. P | A6LMP4 | 8-amino-7-oxononanoate synthase | 2.66e-15 | 6.29e-07 | NA | NA |
5. P | Q9C876 | Probable cystathionine gamma-synthase 2 | 2.27e-06 | 9.64e-06 | NA | NA |
5. P | Q00257 | 1-aminocyclopropane-1-carboxylate synthase CMA101 | 3.30e-05 | 4.43e-04 | NA | NA |
5. P | Q4ZM83 | Serine hydroxymethyltransferase 2 | 5.15e-10 | 4.81e-07 | NA | NA |
5. P | B4ESU4 | 8-amino-7-oxononanoate synthase | 3.72e-11 | 1.03e-07 | NA | NA |
5. P | A1V819 | 8-amino-7-oxononanoate synthase | 1.15e-10 | 1.86e-07 | NA | NA |
5. P | A8AKE2 | Tryptophanase | 2.37e-07 | 1.10e-06 | NA | NA |
5. P | Q6D410 | Histidinol-phosphate aminotransferase | 2.75e-09 | 2.87e-10 | NA | NA |
5. P | Q84I53 | Histidinol-phosphate aminotransferase | 2.08e-07 | 9.53e-09 | NA | NA |
5. P | A9MJE5 | 8-amino-7-oxononanoate synthase | 2.02e-11 | 4.63e-08 | NA | NA |
5. P | A1KJ00 | 8-amino-7-oxononanoate synthase | 2.25e-14 | 1.90e-07 | NA | NA |
5. P | P63501 | Uncharacterized aminotransferase Mb2256c | 7.40e-09 | 1.66e-07 | NA | NA |
5. P | Q58CZ9 | Tyrosine aminotransferase | 1.02e-06 | 1.84e-03 | NA | NA |
5. P | P40732 | Acetylornithine/succinyldiaminopimelate aminotransferase | 1.09e-13 | 1.03e-02 | NA | NA |
5. P | Q7VZG4 | Phosphoserine aminotransferase | 3.00e-14 | 3.88e-08 | NA | NA |
5. P | B7LK50 | Tryptophanase | 4.93e-07 | 2.57e-03 | NA | NA |
5. P | C0Q6X9 | Succinylornithine transaminase | 2.64e-14 | 2.97e-03 | NA | NA |
5. P | P60297 | Ornithine aminotransferase 2 | 2.32e-14 | 2.57e-03 | NA | NA |
5. P | A2SD53 | 8-amino-7-oxononanoate synthase | 9.13e-11 | 6.20e-08 | NA | NA |
5. P | Q5P7U7 | Phosphoserine aminotransferase | 4.17e-14 | 2.05e-08 | NA | NA |
5. P | A1WWA5 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.48e-10 | 8.15e-09 | NA | NA |
5. P | Q5HR08 | Histidinol-phosphate aminotransferase | 1.94e-09 | 2.20e-07 | NA | NA |
5. P | A0R5R7 | Putative aminotransferase MSMEG_6286/MSMEI_6121 | 2.33e-05 | 1.96e-11 | NA | NA |
5. P | C6E348 | Serine hydroxymethyltransferase | 2.53e-10 | 2.06e-07 | NA | NA |
5. P | B8HTV6 | Putative 8-amino-7-oxononanoate synthase | 9.99e-16 | 8.22e-07 | NA | NA |
5. P | Q5H079 | Phosphoserine aminotransferase | 4.09e-14 | 2.06e-10 | NA | NA |
5. P | Q1CKB8 | Serine hydroxymethyltransferase | 3.74e-10 | 3.07e-08 | NA | NA |
5. P | B0R7Q6 | Probable tryptophanase | 5.31e-07 | 1.11e-05 | NA | NA |
5. P | A9M185 | Histidinol-phosphate aminotransferase | 8.51e-13 | 8.15e-11 | NA | NA |
5. P | C1CE16 | Serine hydroxymethyltransferase | 5.21e-10 | 3.18e-08 | NA | NA |
5. P | B5XZ74 | 8-amino-7-oxononanoate synthase | 3.81e-11 | 3.20e-07 | NA | NA |
5. P | Q0AM22 | Histidinol-phosphate aminotransferase | 2.16e-09 | 8.00e-08 | NA | NA |
5. P | B8D981 | Serine hydroxymethyltransferase | 3.03e-10 | 1.36e-09 | NA | NA |
5. P | P31756 | Alliin lyase (Fragment) | 2.69e-04 | 1.89e-04 | NA | NA |
5. P | B3PI88 | 8-amino-7-oxononanoate synthase | 5.74e-11 | 2.86e-07 | NA | NA |
5. P | P19689 | Phosphoserine aminotransferase | 8.56e-14 | 6.61e-10 | NA | NA |
5. P | Q1IAK7 | Histidine decarboxylase | 9.31e-10 | 7.25e-13 | NA | NA |
5. P | Q8EP32 | Ornithine aminotransferase | 6.67e-14 | 1.93e-03 | NA | NA |
5. P | Q07MT9 | Serine hydroxymethyltransferase | 7.81e-10 | 6.96e-07 | NA | NA |
5. P | P66806 | Serine hydroxymethyltransferase | 6.54e-10 | 5.78e-08 | NA | NA |
5. P | A5I245 | Histidinol-phosphate aminotransferase | 8.62e-10 | 6.80e-11 | NA | NA |
5. P | Q6KHH3 | Serine hydroxymethyltransferase | 2.63e-10 | 1.75e-07 | NA | NA |
5. P | Q55CQ6 | Probable phosphoserine aminotransferase | 8.77e-15 | 3.59e-11 | NA | NA |
5. P | B2T637 | Phosphoserine aminotransferase | 7.82e-14 | 2.06e-11 | NA | NA |
5. P | Q3J445 | Histidinol-phosphate aminotransferase | 8.39e-14 | 7.38e-08 | NA | NA |
5. P | A1ACN3 | Histidinol-phosphate aminotransferase | 4.70e-08 | 1.20e-09 | NA | NA |
5. P | Q4R0W2 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase | 4.26e-09 | 7.39e-05 | NA | NA |
5. P | Q5SK88 | O-acetyl-L-homoserine sulfhydrylase 1 | 1.30e-07 | 2.69e-04 | NA | NA |
5. P | Q06774 | Glutamate-1-semialdehyde 2,1-aminomutase | 9.26e-13 | 2.85e-02 | NA | NA |
5. P | P59316 | Acetylornithine aminotransferase | 9.21e-15 | 2.38e-03 | NA | NA |
5. P | Q9PIR7 | Acetylornithine aminotransferase | 7.99e-15 | 1.91e-03 | NA | NA |
5. P | Q1J6L7 | Serine hydroxymethyltransferase | 5.26e-10 | 1.60e-07 | NA | NA |
5. P | Q7D515 | Probable hercynylcysteine sulfoxide lyase | 0.00e+00 | 3.34e-33 | NA | NA |
5. P | B7V9J9 | Phosphoserine aminotransferase | 8.08e-14 | 8.92e-10 | NA | NA |
5. P | Q795M6 | Putative aminotransferase YugH | 1.24e-08 | 1.86e-08 | NA | NA |
5. P | Q7MLS5 | Histidinol-phosphate aminotransferase | 1.65e-09 | 3.56e-10 | NA | NA |
5. P | B0SZS9 | Putative 8-amino-7-oxononanoate synthase | 7.60e-11 | 6.37e-06 | NA | NA |
5. P | B1WSG7 | LL-diaminopimelate aminotransferase | 1.95e-07 | 1.01e-03 | NA | NA |
5. P | Q9K625 | Putative 8-amino-7-oxononanoate synthase | 1.84e-10 | 5.02e-08 | NA | NA |
5. P | P0AB79 | 2-amino-3-ketobutyrate coenzyme A ligase | 6.23e-11 | 4.77e-06 | NA | NA |
5. P | A6VIC0 | Probable L-tyrosine/L-aspartate decarboxylase | 1.65e-12 | 5.14e-10 | NA | NA |
5. P | Q32I45 | 8-amino-7-oxononanoate synthase | 2.15e-11 | 1.40e-06 | NA | NA |
5. P | Q8TXP1 | UPF0425 pyridoxal phosphate-dependent protein MK0620 | 5.85e-07 | 1.17e-10 | NA | NA |
5. P | Q03JH6 | Phosphoserine aminotransferase | 1.63e-14 | 4.36e-10 | NA | NA |
5. P | B8IRU5 | Histidinol-phosphate aminotransferase | 2.30e-13 | 3.49e-08 | NA | NA |
5. P | Q3K122 | Serine hydroxymethyltransferase | 5.03e-10 | 1.73e-07 | NA | NA |
5. P | B5FCJ8 | Phosphoserine aminotransferase | 4.15e-14 | 1.38e-09 | NA | NA |
5. P | A5UKY0 | Histidinol-phosphate aminotransferase | 2.82e-10 | 7.95e-09 | NA | NA |
5. P | B9M3X6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 7.32e-11 | 2.57e-08 | NA | NA |
5. P | Q928K4 | Probable glutamate decarboxylase gamma | 2.89e-15 | 2.23e-07 | NA | NA |
5. P | Q3KDV1 | Serine hydroxymethyltransferase 1 | 2.79e-10 | 2.47e-09 | NA | NA |
5. P | A7HP29 | Putative 8-amino-7-oxononanoate synthase | 5.93e-11 | 1.64e-07 | NA | NA |
5. P | A1TKZ0 | Histidinol-phosphate aminotransferase | 1.15e-09 | 4.45e-05 | NA | NA |
5. P | Q81V80 | Putative pyridoxal phosphate-dependent acyltransferase | 7.72e-11 | 5.03e-07 | NA | NA |
5. P | B5R8J4 | Phosphoserine aminotransferase | 3.28e-14 | 5.20e-10 | NA | NA |
5. P | B1YEH3 | Serine hydroxymethyltransferase | 2.43e-10 | 3.29e-08 | NA | NA |
5. P | A1WQP4 | Serine hydroxymethyltransferase | 1.27e-10 | 9.50e-07 | NA | NA |
5. P | Q2RFW7 | Serine hydroxymethyltransferase | 2.79e-10 | 6.73e-07 | NA | NA |
5. P | Q7M9L1 | L-seryl-tRNA(Sec) selenium transferase | 1.48e-05 | 6.05e-03 | NA | NA |
5. P | P9WGJ6 | Protein MT3510 | 1.93e-08 | 1.79e-07 | NA | NA |
5. P | B8HW95 | Histidinol-phosphate aminotransferase | 1.65e-09 | 4.96e-09 | NA | NA |
5. P | Q8VYP2 | Probable aminotransferase TAT4 | 1.81e-08 | 8.43e-05 | NA | NA |
5. P | Q1B3G6 | Putative phosphoserine aminotransferase | 4.79e-10 | 1.57e-10 | NA | NA |
5. P | A1S6D1 | Phosphoserine aminotransferase | 1.98e-13 | 4.63e-08 | NA | NA |
5. P | Q8CSG1 | Acetylornithine aminotransferase | 3.14e-14 | 7.50e-03 | NA | NA |
5. P | A8FKB5 | Phosphoserine aminotransferase | 2.30e-13 | 3.19e-11 | NA | NA |
5. P | Q2NFU1 | LL-diaminopimelate aminotransferase | 1.69e-07 | 2.01e-04 | NA | NA |
5. P | Q0I322 | Phosphoserine aminotransferase | 4.44e-14 | 2.20e-12 | NA | NA |
5. P | Q1LTL2 | Phosphoserine aminotransferase | 2.38e-14 | 5.67e-11 | NA | NA |
5. P | Q6GAW9 | Ornithine aminotransferase 2 | 1.90e-14 | 2.57e-03 | NA | NA |
5. P | Q71WN9 | Serine hydroxymethyltransferase | 2.71e-10 | 3.88e-07 | NA | NA |
5. P | A8GTI9 | Serine hydroxymethyltransferase | 4.30e-10 | 2.55e-06 | NA | NA |
5. P | Q6LFH8 | Ornithine aminotransferase | 4.22e-14 | 5.68e-03 | NA | NA |
5. P | Q8YJK3 | Histidinol-phosphate aminotransferase | 1.24e-13 | 3.14e-08 | NA | NA |
5. P | P60296 | Ornithine aminotransferase 1 | 3.28e-14 | 5.94e-03 | NA | NA |
5. P | B9M8U3 | 8-amino-7-oxononanoate synthase | 2.33e-15 | 9.98e-08 | NA | NA |
5. P | A7ZPZ4 | Serine hydroxymethyltransferase | 2.66e-10 | 1.69e-08 | NA | NA |
5. P | C3P8D4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.98e-08 | 7.32e-06 | NA | NA |
5. P | Q758F0 | Serine hydroxymethyltransferase, mitochondrial | 2.79e-09 | 2.87e-02 | NA | NA |
5. P | B2J2A2 | Serine hydroxymethyltransferase | 6.06e-10 | 1.96e-06 | NA | NA |
5. P | B1WY56 | Histidinol-phosphate aminotransferase | 2.20e-09 | 2.40e-10 | NA | NA |
5. P | B2V9M1 | Serine hydroxymethyltransferase | 2.67e-10 | 5.09e-07 | NA | NA |
5. P | O08501 | Tyrosine phenol-lyase | 1.31e-08 | 4.27e-05 | NA | NA |
5. P | Q5P7P1 | Serine hydroxymethyltransferase | 1.12e-10 | 2.63e-08 | NA | NA |
5. P | Q89UL9 | Histidinol-phosphate aminotransferase 2 | 1.36e-13 | 1.33e-07 | NA | NA |
5. P | O66776 | Serine hydroxymethyltransferase | 2.24e-10 | 2.60e-05 | NA | NA |
5. P | P95477 | Histidine decarboxylase | 9.75e-10 | 8.59e-12 | NA | NA |
5. P | B5QX66 | 8-amino-7-oxononanoate synthase | 1.97e-11 | 1.88e-07 | NA | NA |
5. P | O08321 | Acetylornithine aminotransferase | 1.65e-13 | 1.28e-04 | NA | NA |
5. P | B0KJ54 | 8-amino-7-oxononanoate synthase | 1.22e-15 | 1.98e-08 | NA | NA |
5. P | Q9HV01 | L-seryl-tRNA(Sec) selenium transferase | 4.74e-06 | 4.87e-02 | NA | NA |
5. P | Q88Q27 | Serine hydroxymethyltransferase 2 | 2.41e-10 | 1.38e-06 | NA | NA |
5. P | P91856 | Probable phosphoserine aminotransferase | 1.08e-09 | 6.45e-11 | NA | NA |
5. P | O05394 | Cystathionine gamma-lyase | 5.62e-12 | 7.54e-05 | NA | NA |
5. P | B7JMV0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.51e-08 | 7.32e-06 | NA | NA |
5. P | A1T8W2 | Histidinol-phosphate aminotransferase | 4.76e-09 | 8.86e-06 | NA | NA |
5. P | B8ERL9 | 8-amino-7-oxononanoate synthase | 2.00e-15 | 1.80e-08 | NA | NA |
5. P | A3PMF8 | Aspartate/prephenate aminotransferase | 1.11e-08 | 1.40e-04 | NA | NA |
5. P | Q56114 | Aspartate aminotransferase | 7.05e-06 | 1.13e-04 | NA | NA |
5. P | Q6N622 | Serine hydroxymethyltransferase 2 | 7.83e-10 | 2.03e-05 | NA | NA |
5. P | Q8U0B4 | Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase | 4.36e-13 | 8.28e-03 | NA | NA |
5. P | O69689 | Aspartate aminotransferase | 4.29e-05 | 9.69e-12 | NA | NA |
5. P | Q2W047 | Histidinol-phosphate aminotransferase | 1.21e-09 | 8.55e-09 | NA | NA |
5. P | B7HFL3 | Serine hydroxymethyltransferase | 2.30e-10 | 9.09e-08 | NA | NA |
5. P | B8DJF7 | Serine hydroxymethyltransferase | 2.35e-10 | 1.64e-07 | NA | NA |
5. P | P0A961 | Glutamate-pyruvate aminotransferase AlaA | 6.58e-07 | 8.31e-06 | NA | NA |
5. P | A8MEH2 | Histidinol-phosphate aminotransferase | 7.85e-10 | 6.08e-07 | NA | NA |
5. P | A9KBN4 | Serine hydroxymethyltransferase | 4.10e-10 | 1.29e-06 | NA | NA |
5. P | P12677 | Adenosylmethionine-8-amino-7-oxononanoate aminotransferase | 3.26e-12 | 5.73e-03 | NA | NA |
5. P | A9VG56 | Putative 8-amino-7-oxononanoate synthase | 8.90e-11 | 4.39e-07 | NA | NA |
5. P | A7GX48 | Serine hydroxymethyltransferase | 3.14e-10 | 9.98e-08 | NA | NA |
5. P | Q58786 | LL-diaminopimelate aminotransferase | 5.69e-07 | 2.66e-06 | NA | NA |
5. P | B8GVE2 | Putative 8-amino-7-oxononanoate synthase | 3.80e-11 | 3.59e-07 | NA | NA |
5. P | Q7CH66 | 8-amino-7-oxononanoate synthase | 4.04e-11 | 1.31e-06 | NA | NA |
5. P | A0B5D0 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 2.11e-15 | 4.31e-29 | NA | NA |
5. P | Q92MG0 | Histidinol-phosphate aminotransferase 1 | 1.45e-13 | 3.79e-08 | NA | NA |
5. P | Q5HHC8 | Ornithine aminotransferase 2 | 1.89e-14 | 2.57e-03 | NA | NA |
5. P | Q39A26 | Serine hydroxymethyltransferase 1 | 4.99e-10 | 2.67e-07 | NA | NA |
5. P | Q046F8 | Serine hydroxymethyltransferase | 4.51e-10 | 4.91e-08 | NA | NA |
5. P | Q10DK7 | 1-aminocyclopropane-1-carboxylate synthase 1 | 1.61e-05 | 1.19e-03 | NA | NA |
5. P | Q3BYN0 | 8-amino-7-oxononanoate synthase | 4.48e-11 | 4.79e-08 | NA | NA |
5. P | A7Z6M3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.19e-08 | 4.65e-07 | NA | NA |
5. P | Q8YP73 | LL-diaminopimelate aminotransferase 2 | 1.16e-07 | 4.15e-06 | NA | NA |
5. P | Q9LVY1 | Tyrosine aminotransferase | 3.44e-07 | 6.04e-05 | NA | NA |
5. P | A9BCJ1 | LL-diaminopimelate aminotransferase | 5.28e-07 | 1.91e-03 | NA | NA |
5. P | P59492 | Phosphoserine aminotransferase | 8.70e-14 | 9.06e-12 | NA | NA |
5. P | A1UN51 | Putative phenylalanine aminotransferase | 2.24e-13 | 1.95e-09 | NA | NA |
5. P | Q06965 | 5-aminolevulinate synthase 2 | 2.57e-11 | 2.57e-08 | NA | NA |
5. P | A8G097 | Tryptophanase | 2.44e-07 | 5.95e-07 | NA | NA |
5. P | Q04QW8 | Histidinol-phosphate aminotransferase | 3.03e-09 | 1.04e-07 | NA | NA |
5. P | B1HM45 | Serine hydroxymethyltransferase | 2.25e-10 | 2.81e-06 | NA | NA |
5. P | B5F1D2 | Serine hydroxymethyltransferase | 2.64e-10 | 4.47e-08 | NA | NA |
5. P | O34662 | Uncharacterized aminotransferase YodT | 3.45e-12 | 2.75e-02 | NA | NA |
5. P | Q2FY34 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.42e-08 | 5.79e-06 | NA | NA |
5. P | C1ERU9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.65e-08 | 7.32e-06 | NA | NA |
5. P | Q59342 | Tryptophanase | 2.27e-07 | 2.83e-07 | NA | NA |
5. P | Q8TVG3 | Histidinol-phosphate aminotransferase | 2.34e-09 | 3.43e-07 | NA | NA |
5. P | Q18ES5 | Glutamate-1-semialdehyde 2,1-aminomutase | 7.87e-12 | 3.05e-02 | NA | NA |
5. P | Q7V4U3 | Serine hydroxymethyltransferase | 4.43e-10 | 1.62e-07 | NA | NA |
5. P | Q8D900 | Phosphoserine aminotransferase | 3.39e-14 | 5.45e-11 | NA | NA |
5. P | A4J2F8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.74e-11 | 8.99e-08 | NA | NA |
5. P | A7Z5B4 | Putative 8-amino-7-oxononanoate synthase 2 | 8.88e-16 | 7.38e-08 | NA | NA |
5. P | Q54VQ6 | O-phosphoseryl-tRNA(Sec) selenium transferase | 8.78e-09 | 9.14e-06 | NA | NA |
5. P | Q67N86 | 8-amino-7-oxononanoate synthase | 7.68e-11 | 2.64e-06 | NA | NA |
5. P | Q30ZX9 | LL-diaminopimelate aminotransferase | 2.30e-07 | 1.52e-04 | NA | NA |
5. P | B2SWS7 | 8-amino-7-oxononanoate synthase | 7.88e-11 | 9.60e-07 | NA | NA |
5. P | A2C4T7 | LL-diaminopimelate aminotransferase | 1.29e-07 | 2.25e-05 | NA | NA |
5. P | A9AE46 | 8-amino-7-oxononanoate synthase | 8.42e-11 | 1.56e-06 | NA | NA |
5. P | A5EV80 | Phosphoserine aminotransferase | 6.11e-14 | 8.91e-13 | NA | NA |
5. P | A4XMY1 | Histidinol-phosphate aminotransferase | 6.51e-10 | 1.66e-07 | NA | NA |
5. P | B4RJ05 | Histidinol-phosphate aminotransferase | 6.92e-13 | 2.90e-09 | NA | NA |
5. P | Q82WQ4 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.26e-10 | 8.86e-09 | NA | NA |
5. P | A5IUQ8 | Serine hydroxymethyltransferase | 1.88e-10 | 1.44e-06 | NA | NA |
5. P | B1IXJ2 | 8-amino-7-oxononanoate synthase | 2.20e-11 | 2.47e-06 | NA | NA |
5. P | P53656 | Adenosylmethionine-8-amino-7-oxononanoate aminotransferase | 3.03e-12 | 2.05e-02 | NA | NA |
5. P | Q89AK4 | Adenosylmethionine-8-amino-7-oxononanoate aminotransferase | 2.00e-12 | 4.14e-02 | NA | NA |
5. P | Q9KSZ3 | 8-amino-7-oxononanoate synthase | 7.50e-11 | 2.50e-07 | NA | NA |
5. P | P69908 | Glutamate decarboxylase alpha | 1.21e-10 | 3.10e-06 | NA | NA |
5. P | B7HY76 | Serine hydroxymethyltransferase | 2.16e-10 | 5.98e-08 | NA | NA |
5. P | A6UVR4 | Probable L-tyrosine/L-aspartate decarboxylase | 1.47e-12 | 1.47e-09 | NA | NA |
5. P | Q07703 | Cystathionine beta-lyase | 2.07e-08 | 9.95e-06 | NA | NA |
5. P | Q1CUJ7 | Glutamate-1-semialdehyde 2,1-aminomutase | 7.27e-13 | 2.12e-02 | NA | NA |
5. P | P43089 | 5-aminolevulinate synthase | 2.80e-11 | 8.04e-07 | NA | NA |
5. P | B9M0W5 | Serine hydroxymethyltransferase | 1.84e-10 | 9.09e-08 | NA | NA |
5. P | O86459 | Probable aspartate/prephenate aminotransferase | 9.49e-09 | 4.68e-05 | NA | NA |
5. P | Q4K5R9 | Serine hydroxymethyltransferase 1 | 2.16e-10 | 1.94e-07 | NA | NA |
5. P | B2A250 | LL-diaminopimelate aminotransferase | 1.01e-07 | 4.58e-05 | NA | NA |
5. P | Q72VI2 | Phosphoserine aminotransferase | 9.15e-14 | 1.48e-11 | NA | NA |
5. P | P63566 | Acetylornithine aminotransferase | 1.69e-14 | 2.16e-02 | NA | NA |
5. P | O66442 | Acetylornithine aminotransferase | 9.36e-14 | 1.36e-02 | NA | NA |
5. P | A7H1W2 | L-seryl-tRNA(Sec) selenium transferase | 2.98e-05 | 8.66e-03 | NA | NA |
5. P | Q8PQD8 | 8-amino-7-oxononanoate synthase | 4.13e-11 | 5.78e-08 | NA | NA |
5. P | C6DF75 | Histidinol-phosphate aminotransferase | 6.25e-08 | 6.77e-10 | NA | NA |
5. P | Q1QYD6 | 8-amino-7-oxononanoate synthase | 3.06e-11 | 3.88e-07 | NA | NA |
5. P | A8GDR5 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 1.97e-13 | 4.21e-03 | NA | NA |
5. P | C8V1D1 | 8-amino-7-oxononanoate synthase | 2.89e-11 | 2.23e-05 | NA | NA |
5. P | B2FNK2 | Serine hydroxymethyltransferase | 4.02e-10 | 7.64e-08 | NA | NA |
5. P | C4XJB9 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 8.48e-11 | 1.86e-09 | NA | NA |
5. P | Q0P5L8 | 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial | 8.92e-11 | 1.01e-02 | NA | NA |
5. P | P0A960 | Glutamate-pyruvate aminotransferase AlaA | 6.44e-07 | 8.31e-06 | NA | NA |
5. P | A3N522 | 8-amino-7-oxononanoate synthase | 1.24e-10 | 1.86e-07 | NA | NA |
5. P | Q3SMC1 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 5.72e-07 | 3.24e-06 | NA | NA |
5. P | Q8ZCR1 | Serine hydroxymethyltransferase | 3.27e-10 | 3.07e-08 | NA | NA |
5. P | Q9EYW9 | Glutamate decarboxylase beta | 1.67e-15 | 3.03e-07 | NA | NA |
5. P | Q87DM8 | Acetylornithine aminotransferase | 1.31e-13 | 1.35e-02 | NA | NA |
5. P | B3E1Z8 | Serine hydroxymethyltransferase | 3.14e-10 | 3.24e-07 | NA | NA |
5. P | Q86AG8 | Aromatic amino acid aminotransferase DDB_G0272014 | 1.17e-05 | 2.11e-03 | NA | NA |
5. P | B0UWS8 | Serine hydroxymethyltransferase | 2.37e-10 | 6.88e-08 | NA | NA |
5. P | Q609V1 | 8-amino-7-oxononanoate synthase | 3.00e-15 | 4.08e-09 | NA | NA |
5. P | Q3JMZ7 | Histidinol-phosphate aminotransferase 2 | 1.17e-09 | 2.25e-08 | NA | NA |
5. P | A1TSA3 | Phosphoserine aminotransferase | 4.57e-14 | 7.93e-12 | NA | NA |
5. P | B3QP11 | Histidinol-phosphate aminotransferase | 3.54e-09 | 1.54e-08 | NA | NA |
5. P | Q2YN95 | Serine hydroxymethyltransferase | 3.58e-10 | 1.37e-06 | NA | NA |
5. P | B7LQ44 | Succinylornithine transaminase | 3.02e-14 | 4.65e-03 | NA | NA |
5. P | Q3A4L9 | Serine hydroxymethyltransferase | 3.08e-10 | 1.17e-06 | NA | NA |
5. P | B7NRK2 | Serine hydroxymethyltransferase | 2.56e-10 | 1.69e-08 | NA | NA |
5. P | Q6LHN7 | Serine hydroxymethyltransferase 2 | 3.20e-10 | 1.84e-06 | NA | NA |
5. P | A0QHJ9 | 8-amino-7-oxononanoate synthase | 1.39e-14 | 4.21e-08 | NA | NA |
5. P | B2VC80 | Phosphoserine aminotransferase | 8.10e-14 | 1.68e-10 | NA | NA |
5. P | B4T1D1 | Serine hydroxymethyltransferase | 2.83e-10 | 4.47e-08 | NA | NA |
5. P | A8GC78 | Histidinol-phosphate aminotransferase | 6.58e-08 | 4.58e-10 | NA | NA |
5. P | Q3K6J0 | Serine hydroxymethyltransferase 2 | 2.21e-10 | 8.79e-07 | NA | NA |
5. P | Q323J1 | Histidinol-phosphate aminotransferase | 4.91e-08 | 1.79e-09 | NA | NA |
5. P | B2S513 | Serine hydroxymethyltransferase | 3.57e-10 | 1.37e-06 | NA | NA |
5. P | B4S8L6 | Histidinol-phosphate aminotransferase | 1.66e-09 | 2.36e-11 | NA | NA |
5. P | P31012 | Tyrosine phenol-lyase | 3.52e-07 | 6.58e-07 | NA | NA |
5. P | Q926T3 | Phosphoserine aminotransferase | 6.57e-10 | 1.74e-10 | NA | NA |
5. P | A9W106 | 8-amino-7-oxononanoate synthase | 9.63e-11 | 6.22e-05 | NA | NA |
5. P | Q2NS25 | Serine hydroxymethyltransferase | 2.57e-10 | 4.50e-09 | NA | NA |
5. P | P61001 | Histidinol-phosphate aminotransferase | 1.45e-08 | 6.96e-07 | NA | NA |
5. P | Q5KX77 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.98e-08 | 1.59e-06 | NA | NA |
5. P | Q8D8Q1 | Histidinol-phosphate aminotransferase | 1.57e-09 | 5.75e-10 | NA | NA |
5. P | Q8DU67 | Serine hydroxymethyltransferase | 4.96e-10 | 2.54e-08 | NA | NA |
5. P | A9VH11 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 3.17e-08 | 2.97e-06 | NA | NA |
5. P | Q2SYS4 | Serine hydroxymethyltransferase 1 | 1.23e-10 | 6.13e-08 | NA | NA |
5. P | P06986 | Histidinol-phosphate aminotransferase | 2.11e-09 | 1.54e-09 | NA | NA |
5. P | Q8ZV07 | Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase | 4.65e-14 | 9.38e-03 | NA | NA |
5. P | B5YRL5 | 8-amino-7-oxononanoate synthase | 2.18e-11 | 2.75e-06 | NA | NA |
5. P | Q5HHU9 | Histidinol-phosphate aminotransferase | 1.40e-07 | 9.53e-09 | NA | NA |
5. P | B2V398 | Serine hydroxymethyltransferase | 1.57e-10 | 1.46e-07 | NA | NA |
5. P | B2TN52 | Serine hydroxymethyltransferase | 1.42e-10 | 7.13e-08 | NA | NA |
5. P | Q71Z79 | Acetylornithine aminotransferase | 1.58e-14 | 3.38e-03 | NA | NA |
5. P | Q7VSZ0 | Histidinol-phosphate aminotransferase 2 | 5.39e-08 | 1.92e-06 | NA | NA |
5. P | A5IKK7 | Probable glycine dehydrogenase (decarboxylating) subunit 2 | 4.24e-07 | 7.04e-08 | NA | NA |
5. P | B1I544 | LL-diaminopimelate aminotransferase | 2.12e-07 | 6.58e-06 | NA | NA |
5. P | Q5KUI2 | Serine hydroxymethyltransferase | 2.01e-10 | 9.31e-08 | NA | NA |
5. P | Q3ARM7 | Histidinol-phosphate aminotransferase | 1.58e-13 | 4.30e-07 | NA | NA |
5. P | Q6LPD9 | Phosphoserine aminotransferase | 8.32e-14 | 5.97e-11 | NA | NA |
5. P | B5RBR3 | Histidinol-phosphate aminotransferase | 2.24e-09 | 1.17e-09 | NA | NA |
5. P | Q2U038 | Kynureninase 1 | 0.00e+00 | 3.49e-11 | NA | NA |
5. P | A6LBG7 | Serine hydroxymethyltransferase | 1.95e-09 | 4.39e-07 | NA | NA |
5. P | A1RHD0 | Serine hydroxymethyltransferase | 3.44e-10 | 2.38e-09 | NA | NA |
5. P | A5FRC5 | LL-diaminopimelate aminotransferase | 1.59e-07 | 1.54e-06 | NA | NA |
5. P | Q9RI02 | Phosphoserine aminotransferase | 9.63e-14 | 4.13e-09 | NA | NA |
5. P | B7VH15 | 8-amino-7-oxononanoate synthase | 8.78e-11 | 1.63e-08 | NA | NA |
5. P | Q4L7Z4 | Serine hydroxymethyltransferase | 1.68e-10 | 5.45e-08 | NA | NA |
5. P | A5A6K8 | Aspartate aminotransferase, cytoplasmic | 1.75e-06 | 2.11e-04 | NA | NA |
5. P | Q3YRD1 | Serine hydroxymethyltransferase | 3.21e-10 | 4.35e-07 | NA | NA |
5. P | B5R762 | 8-amino-7-oxononanoate synthase | 1.89e-11 | 1.88e-07 | NA | NA |
5. P | Q9SAR0 | 1-aminocyclopropane-1-carboxylate synthase 6 | 3.26e-05 | 6.68e-03 | NA | NA |
5. P | Q98FF1 | Uncharacterized protein mlr3804 | 4.74e-07 | 8.95e-06 | NA | NA |
5. P | Q12W26 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase 2 | 1.40e-14 | 2.76e-27 | NA | NA |
5. P | Q5PHC8 | Succinylornithine transaminase | 3.57e-14 | 3.64e-03 | NA | NA |
5. P | B7MHL6 | Phosphoserine aminotransferase | 4.19e-14 | 9.15e-10 | NA | NA |
5. P | Q8XJ32 | Serine hydroxymethyltransferase | 1.07e-10 | 7.13e-09 | NA | NA |
5. P | A1R032 | Serine hydroxymethyltransferase | 1.12e-09 | 5.20e-10 | NA | NA |
5. P | B3QPR3 | Serine hydroxymethyltransferase | 1.42e-09 | 1.53e-07 | NA | NA |
5. P | B5RMF3 | Serine hydroxymethyltransferase | 1.24e-09 | 2.21e-11 | NA | NA |
5. P | Q474L3 | Serine hydroxymethyltransferase 1 | 1.53e-10 | 1.60e-08 | NA | NA |
5. P | A2BYM6 | LL-diaminopimelate aminotransferase | 4.73e-07 | 8.86e-05 | NA | NA |
5. P | A1TF55 | Putative phosphoserine aminotransferase | 3.63e-08 | 1.20e-10 | NA | NA |
5. P | Q7W5Z9 | Phosphoserine aminotransferase | 2.14e-14 | 1.93e-08 | NA | NA |
5. P | P12998 | 8-amino-7-oxononanoate synthase | 3.98e-11 | 2.12e-06 | NA | NA |
5. P | B7HB99 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.62e-08 | 7.47e-06 | NA | NA |
5. P | B5EGX2 | LL-diaminopimelate aminotransferase | 2.12e-07 | 5.58e-04 | NA | NA |
5. P | P44422 | Putative 8-amino-7-oxononanoate synthase | 3.85e-14 | 1.48e-04 | NA | NA |
5. P | Q4FUZ8 | Serine hydroxymethyltransferase | 7.56e-10 | 2.69e-05 | NA | NA |
5. P | Q2IS68 | Histidinol-phosphate aminotransferase | 1.27e-13 | 1.55e-07 | NA | NA |
5. P | B6I8X9 | Phosphoserine aminotransferase | 6.88e-14 | 7.49e-10 | NA | NA |
5. P | Q07262 | 1-aminocyclopropane-1-carboxylate synthase | 1.06e-05 | 9.13e-03 | NA | NA |
5. P | B2KA22 | Phosphoserine aminotransferase | 9.03e-14 | 2.01e-11 | NA | NA |
5. P | B0BSL4 | Serine hydroxymethyltransferase | 3.12e-10 | 8.00e-08 | NA | NA |
5. P | A8F595 | Serine hydroxymethyltransferase | 9.13e-10 | 5.20e-07 | NA | NA |
5. P | Q8PA97 | Phosphoserine aminotransferase | 1.92e-14 | 1.42e-11 | NA | NA |
5. P | Q311A7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 8.25e-08 | 7.12e-10 | NA | NA |
5. P | A5FZN8 | Putative 8-amino-7-oxononanoate synthase | 6.24e-11 | 4.21e-08 | NA | NA |
5. P | B0JPX8 | Serine hydroxymethyltransferase | 5.79e-10 | 6.86e-06 | NA | NA |
5. P | P50125 | Homocysteine synthase | 7.27e-08 | 1.43e-04 | NA | NA |
5. P | Q47IH1 | Serine hydroxymethyltransferase | 1.34e-10 | 3.07e-08 | NA | NA |
5. P | Q5HW65 | Serine hydroxymethyltransferase | 3.68e-10 | 8.58e-08 | NA | NA |
5. P | Q2Y6Y6 | Histidinol-phosphate aminotransferase 2 | 2.02e-09 | 3.48e-09 | NA | NA |
5. P | B9LZ53 | Histidinol-phosphate aminotransferase | 4.40e-13 | 9.52e-11 | NA | NA |
5. P | P58661 | Aspartate aminotransferase | 7.79e-06 | 1.21e-04 | NA | NA |
5. P | A1BE30 | Serine hydroxymethyltransferase | 1.26e-09 | 2.61e-07 | NA | NA |
5. P | A8AXC8 | Serine hydroxymethyltransferase | 7.28e-10 | 2.41e-07 | NA | NA |
5. P | Q59072 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 1.33e-15 | 2.23e-24 | NA | NA |
5. P | P78011 | Serine hydroxymethyltransferase | 5.33e-14 | 3.65e-06 | NA | NA |
5. P | B4SP45 | Phosphoserine aminotransferase | 1.48e-13 | 2.89e-12 | NA | NA |
5. P | P73807 | Histidinol-phosphate aminotransferase | 3.70e-13 | 9.30e-09 | NA | NA |
5. P | Q24MM6 | Serine hydroxymethyltransferase | 1.82e-10 | 3.45e-08 | NA | NA |
5. P | Q41233 | Alliin lyase 2 | 3.59e-04 | 2.87e-02 | NA | NA |
5. P | Q62MX1 | 8-amino-7-oxononanoate synthase | 1.07e-10 | 1.86e-07 | NA | NA |
5. P | Q46RR4 | Serine hydroxymethyltransferase 2 | 4.48e-10 | 1.03e-06 | NA | NA |
5. P | A1ATI6 | LL-diaminopimelate aminotransferase | 1.68e-07 | 2.49e-04 | NA | NA |
5. P | Q2J8K9 | Histidinol-phosphate aminotransferase | 8.39e-09 | 1.24e-03 | NA | NA |
5. P | Q8D7G5 | Serine hydroxymethyltransferase 2 | 6.21e-10 | 3.24e-07 | NA | NA |
5. P | B1I6M4 | Serine hydroxymethyltransferase | 1.97e-10 | 9.08e-07 | NA | NA |
5. P | O31665 | L-glutamine--4-(methylsulfanyl)-2-oxobutanoate aminotransferase | 9.31e-08 | 5.95e-07 | NA | NA |
5. P | Q9A353 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.58e-10 | 1.24e-08 | NA | NA |
5. P | Q9RYB2 | Serine hydroxymethyltransferase | 5.86e-10 | 1.04e-11 | NA | NA |
5. P | B8ZR84 | 8-amino-7-oxononanoate synthase | 1.61e-14 | 7.29e-08 | NA | NA |
5. P | B7LAR8 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.91e-14 | 1.02e-03 | NA | NA |
5. P | Q8DZM7 | Serine hydroxymethyltransferase | 5.15e-10 | 1.73e-07 | NA | NA |
5. P | Q9YCI2 | Probable tryptophanase | 3.95e-07 | 8.95e-06 | NA | NA |
5. P | Q8FFM3 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.64e-14 | 1.23e-03 | NA | NA |
5. P | Q5PBM8 | Serine hydroxymethyltransferase | 5.52e-10 | 5.69e-07 | NA | NA |
5. P | Q5KXV3 | Histidinol-phosphate aminotransferase | 6.92e-10 | 2.05e-06 | NA | NA |
5. P | Q5E5Y7 | Glutamate decarboxylase | 5.60e-09 | 5.91e-08 | NA | NA |
5. P | Q6HDT7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.52e-08 | 9.64e-06 | NA | NA |
5. P | Q634V7 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.91e-08 | 7.32e-06 | NA | NA |
5. P | B7GMG4 | Serine hydroxymethyltransferase | 1.72e-10 | 1.31e-05 | NA | NA |
5. P | Q635G4 | Putative 8-amino-7-oxononanoate synthase | 1.26e-10 | 1.04e-07 | NA | NA |
5. P | A9MSC2 | Histidinol-phosphate aminotransferase | 5.06e-08 | 1.25e-09 | NA | NA |
5. P | Q5F8C0 | Serine hydroxymethyltransferase | 2.32e-10 | 7.52e-07 | NA | NA |
5. P | Q62I16 | Serine hydroxymethyltransferase 1 | 1.20e-10 | 4.52e-08 | NA | NA |
5. P | Q39CE6 | 8-amino-7-oxononanoate synthase | 8.08e-11 | 1.86e-07 | NA | NA |
5. P | Q4ZNW0 | Histidinol-phosphate aminotransferase | 1.86e-09 | 4.31e-08 | NA | NA |
5. P | A4SG06 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.74e-11 | 3.27e-06 | NA | NA |
5. P | B4RP93 | Putative 8-amino-7-oxononanoate synthase | 7.69e-14 | 3.34e-05 | NA | NA |
5. P | Q2S9R4 | Serine hydroxymethyltransferase 2 | 5.86e-10 | 3.98e-09 | NA | NA |
5. P | B3DXN2 | Histidinol-phosphate aminotransferase | 6.01e-10 | 7.60e-07 | NA | NA |
5. P | Q1B7F0 | 8-amino-7-oxononanoate synthase | 1.49e-14 | 5.27e-09 | NA | NA |
5. P | B5FBF0 | Serine hydroxymethyltransferase | 2.84e-10 | 5.40e-09 | NA | NA |
5. P | A0KNH4 | Serine hydroxymethyltransferase | 3.49e-10 | 7.31e-09 | NA | NA |
5. P | P9WML7 | Histidinol-phosphate aminotransferase | 9.20e-09 | 1.10e-06 | NA | NA |
5. P | P9WGB7 | Cystathionine gamma-synthase | 1.69e-08 | 4.83e-04 | NA | NA |
5. P | E5Y945 | Taurine--pyruvate aminotransferase | 4.41e-12 | 2.18e-02 | NA | NA |
5. P | Q92413 | Ornithine aminotransferase | 5.68e-13 | 2.07e-03 | NA | NA |
5. P | A9HJ57 | 8-amino-7-oxononanoate synthase | 8.76e-11 | 9.15e-10 | NA | NA |
5. P | Q4L4E7 | Histidinol-phosphate aminotransferase | 1.91e-09 | 2.50e-09 | NA | NA |
5. P | B7UMH5 | Tryptophanase | 4.55e-07 | 2.61e-03 | NA | NA |
5. P | B7NQG9 | Histidinol-phosphate aminotransferase | 5.00e-08 | 3.04e-09 | NA | NA |
5. P | A6UUU3 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 1.22e-15 | 3.40e-28 | NA | NA |
5. P | Q9M2Y8 | 1-aminocyclopropane-1-carboxylate synthase 9 | 1.01e-05 | 3.11e-03 | NA | NA |
5. P | B2HLJ8 | Putative phenylalanine aminotransferase | 7.99e-10 | 6.13e-08 | NA | NA |
5. P | Q2GAI1 | Histidinol-phosphate aminotransferase | 1.76e-13 | 1.46e-07 | NA | NA |
5. P | B1IVS6 | Serine hydroxymethyltransferase | 2.75e-10 | 1.69e-08 | NA | NA |
5. P | B2I9H7 | 8-amino-7-oxononanoate synthase | 2.94e-11 | 3.62e-08 | NA | NA |
5. P | B7MG20 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.76e-14 | 1.23e-03 | NA | NA |
5. P | Q8PPE3 | Serine hydroxymethyltransferase | 3.75e-10 | 1.06e-07 | NA | NA |
5. P | Q086C9 | Serine hydroxymethyltransferase | 4.19e-10 | 8.05e-09 | NA | NA |
5. P | O69668 | Probable hercynylcysteine sulfoxide lyase | 0.00e+00 | 4.38e-32 | NA | NA |
5. P | B1X7A6 | 8-amino-7-oxononanoate synthase | 3.07e-11 | 2.12e-06 | NA | NA |
5. P | B2G679 | Serine hydroxymethyltransferase | 2.33e-10 | 7.38e-08 | NA | NA |
5. P | C4L2E7 | Ornithine aminotransferase | 4.02e-14 | 2.61e-03 | NA | NA |
5. P | Q5N2P9 | Serine hydroxymethyltransferase | 3.54e-10 | 1.88e-06 | NA | NA |
5. P | B9KDN6 | Histidinol-phosphate aminotransferase | 5.64e-10 | 2.77e-07 | NA | NA |
5. P | A1VE02 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.07e-10 | 6.47e-09 | NA | NA |
5. P | A0L3L7 | Putative 8-amino-7-oxononanoate synthase | 6.38e-11 | 1.45e-09 | NA | NA |
5. P | P53001 | Aspartate aminotransferase | 2.63e-08 | 7.32e-06 | NA | NA |
5. P | B5YX44 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.19e-14 | 1.58e-03 | NA | NA |
5. P | A0QX82 | Histidinol-phosphate aminotransferase | 4.87e-09 | 2.83e-07 | NA | NA |
5. P | Q6GEW2 | Serine hydroxymethyltransferase | 1.89e-10 | 1.44e-06 | NA | NA |
5. P | Q58131 | Acetylornithine aminotransferase | 3.82e-14 | 7.57e-03 | NA | NA |
5. P | A2EYC4 | Probable beta-eliminating lyase | 5.90e-07 | 1.29e-06 | NA | NA |
5. P | P31013 | Tyrosine phenol-lyase | 3.35e-07 | 1.44e-06 | NA | NA |
5. P | A4YW97 | Serine hydroxymethyltransferase | 8.36e-10 | 1.92e-06 | NA | NA |
5. P | Q6F961 | Phosphoserine aminotransferase | 4.84e-14 | 1.98e-09 | NA | NA |
5. P | B0C205 | Putative 8-amino-7-oxononanoate synthase | 2.55e-15 | 1.83e-07 | NA | NA |
5. P | B1HSN6 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 1.85e-11 | 1.20e-05 | NA | NA |
5. P | Q21NP8 | Serine hydroxymethyltransferase | 8.16e-10 | 2.15e-07 | NA | NA |
5. P | Q970Z4 | Histidinol-phosphate aminotransferase | 1.01e-12 | 1.24e-08 | NA | NA |
5. P | A1K9B2 | Serine hydroxymethyltransferase | 1.05e-10 | 1.84e-08 | NA | NA |
5. P | Q0C406 | Tryptophanase | 1.16e-08 | 2.14e-05 | NA | NA |
5. P | A7H543 | Phosphoserine aminotransferase | 2.14e-13 | 3.27e-11 | NA | NA |
5. P | Q5FNK4 | Serine hydroxymethyltransferase | 4.31e-10 | 8.59e-07 | NA | NA |
5. P | A7NFV2 | Histidinol-phosphate aminotransferase | 9.68e-10 | 6.58e-07 | NA | NA |
5. P | B1LLK7 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 9.81e-14 | 1.02e-03 | NA | NA |
5. P | B6JKN5 | Glutamate-1-semialdehyde 2,1-aminomutase | 9.63e-13 | 1.81e-02 | NA | NA |
5. P | Q15RU8 | Histidinol-phosphate aminotransferase | 3.66e-09 | 3.07e-08 | NA | NA |
5. P | O74267 | Low-specificity L-threonine aldolase | 2.51e-13 | 4.72e-06 | NA | NA |
5. P | A1UHM3 | 8-amino-7-oxononanoate synthase | 9.55e-15 | 5.27e-09 | NA | NA |
5. P | B5EPR5 | Phosphoserine aminotransferase | 6.91e-14 | 2.16e-13 | NA | NA |
5. P | Q9XAZ1 | Serine hydroxymethyltransferase | 2.27e-10 | 3.00e-06 | NA | NA |
5. P | A1VDD3 | LL-diaminopimelate aminotransferase | 1.57e-07 | 4.57e-06 | NA | NA |
5. P | Q4X1D4 | Kynureninase 1 | 0.00e+00 | 5.43e-06 | NA | NA |
5. P | Q8TYR3 | O-phospho-L-seryl-tRNA:Cys-tRNA synthase | 1.25e-14 | 1.54e-23 | NA | NA |
5. P | A3QC57 | Serine hydroxymethyltransferase | 3.39e-10 | 4.55e-09 | NA | NA |
5. P | A0LV49 | Serine hydroxymethyltransferase | 3.64e-10 | 2.35e-05 | NA | NA |
5. P | Q92SA0 | Acetylornithine aminotransferase | 2.07e-14 | 1.27e-04 | NA | NA |
5. P | Q2FLH5 | Serine hydroxymethyltransferase | 2.35e-10 | 9.44e-06 | NA | NA |
5. P | Q9ZNA8 | Tryptophanase | 6.09e-07 | 4.82e-06 | NA | NA |
5. P | B2JKH6 | 8-amino-7-oxononanoate synthase | 7.63e-11 | 1.86e-07 | NA | NA |
5. P | A8AD38 | Serine hydroxymethyltransferase | 2.71e-10 | 6.80e-09 | NA | NA |
5. P | Q9KSU7 | Phosphoserine aminotransferase | 4.87e-14 | 1.83e-11 | NA | NA |
5. P | C1ATN6 | Phosphoserine aminotransferase | 5.28e-14 | 5.14e-10 | NA | NA |
5. P | Q3ZZG3 | Serine hydroxymethyltransferase | 1.72e-10 | 7.13e-09 | NA | NA |
5. P | Q7ND67 | Serine hydroxymethyltransferase | 3.61e-10 | 9.08e-07 | NA | NA |
5. P | Q73GC3 | Serine hydroxymethyltransferase | 3.06e-10 | 2.36e-06 | NA | NA |
5. P | Q98A81 | Serine hydroxymethyltransferase 2 | 6.04e-10 | 3.45e-08 | NA | NA |
5. P | Q32EF0 | Histidinol-phosphate aminotransferase | 4.83e-08 | 1.02e-09 | NA | NA |
5. P | B1IJJ8 | Serine hydroxymethyltransferase | 1.78e-10 | 3.97e-08 | NA | NA |
5. P | Q16719 | Kynureninase | 0.00e+00 | 1.55e-10 | NA | NA |
5. P | A9R7I1 | Phosphoserine aminotransferase | 8.59e-14 | 3.74e-10 | NA | NA |
5. P | A3M7Z0 | Phosphoserine aminotransferase | 7.89e-14 | 4.36e-10 | NA | NA |
5. P | Q5QXT4 | Serine hydroxymethyltransferase | 7.04e-10 | 3.93e-07 | NA | NA |
5. P | Q9V0L2 | Aspartate aminotransferase | 1.61e-08 | 1.97e-04 | NA | NA |
5. P | B5FJD8 | Succinylornithine transaminase | 2.62e-14 | 3.23e-03 | NA | NA |
5. P | Q3K5K9 | Serine hydroxymethyltransferase 3 | 4.58e-10 | 2.80e-07 | NA | NA |
5. P | A7HQY0 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.70e-14 | 2.96e-07 | NA | NA |
5. P | Q88M07 | Phosphoserine aminotransferase | 1.03e-13 | 7.95e-09 | NA | NA |
5. P | Q1R503 | L-seryl-tRNA(Sec) selenium transferase | 7.57e-06 | 2.18e-02 | NA | NA |
5. P | Q57RG2 | 8-amino-7-oxononanoate synthase | 3.68e-11 | 3.24e-07 | NA | NA |
5. P | Q0AUC3 | Serine hydroxymethyltransferase | 2.66e-10 | 1.23e-09 | NA | NA |
5. P | Q9A671 | Histidinol-phosphate aminotransferase 1 | 1.02e-09 | 1.06e-10 | NA | NA |
5. P | A3D7D0 | Serine hydroxymethyltransferase | 3.30e-10 | 5.88e-09 | NA | NA |
5. P | P28577 | Histidine decarboxylase | 3.78e-10 | 2.31e-10 | NA | NA |
5. P | Q21FY4 | 8-amino-7-oxononanoate synthase | 4.88e-11 | 5.91e-08 | NA | NA |
5. P | A7HJ69 | Serine hydroxymethyltransferase | 6.54e-10 | 6.15e-07 | NA | NA |
5. P | B7VBN4 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 2.07e-13 | 1.03e-02 | NA | NA |
5. P | Q92441 | Homocysteine/cysteine synthase | 7.60e-08 | 1.50e-03 | NA | NA |
5. P | B0RVE1 | Serine hydroxymethyltransferase | 4.88e-10 | 1.30e-07 | NA | NA |
5. P | B1V975 | Serine hydroxymethyltransferase | 4.56e-10 | 2.15e-08 | NA | NA |
5. P | P0AB77 | 2-amino-3-ketobutyrate coenzyme A ligase | 7.68e-11 | 4.77e-06 | NA | NA |
5. P | G4WJD4 | GDP-4-keto-6-deoxy-D-mannose 3-dehydratase | 1.88e-13 | 5.18e-05 | NA | NA |
5. P | Q2MF71 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase | 6.39e-09 | 2.86e-05 | NA | NA |
5. P | Q9ZPS4 | Glutamate decarboxylase 3 | 1.55e-15 | 4.43e-04 | NA | NA |
5. P | Q55DV9 | Cystathionine gamma-lyase | 2.06e-08 | 6.17e-06 | NA | NA |
5. P | A9VSB4 | Serine hydroxymethyltransferase | 1.97e-10 | 1.02e-07 | NA | NA |
5. P | A5CYB7 | Serine hydroxymethyltransferase | 4.25e-10 | 1.80e-06 | NA | NA |
5. P | B5E9W9 | Histidinol-phosphate aminotransferase | 3.76e-13 | 8.70e-12 | NA | NA |
5. P | Q9STR4 | 1-aminocyclopropane-1-carboxylate synthase 7 | 5.86e-06 | 6.61e-05 | NA | NA |
5. P | B8D7K4 | Phosphoserine aminotransferase | 2.32e-14 | 2.65e-14 | NA | NA |
5. P | A1APU0 | Serine hydroxymethyltransferase | 2.62e-10 | 2.96e-08 | NA | NA |
5. P | Q3A7R3 | Histidinol-phosphate aminotransferase | 3.73e-09 | 2.76e-10 | NA | NA |
5. P | P9WQ87 | 8-amino-7-oxononanoate synthase 1 | 2.32e-14 | 1.90e-07 | NA | NA |
5. P | Q4FSH2 | Histidinol-phosphate aminotransferase 1 | 1.75e-09 | 9.95e-06 | NA | NA |
5. P | Q3J7H2 | Histidinol-phosphate aminotransferase 2 | 4.77e-08 | 2.66e-10 | NA | NA |
5. P | Q10349 | Putative phosphoserine aminotransferase | 3.13e-14 | 1.36e-09 | NA | NA |
5. P | B6IXI3 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 4.04e-10 | 1.09e-09 | NA | NA |
5. P | P58350 | Aspartate aminotransferase | 7.91e-09 | 9.80e-04 | NA | NA |
5. P | O30971 | Tryptophanase | 1.04e-08 | 8.40e-06 | NA | NA |
5. P | Q9T065 | 1-aminocyclopropane-1-carboxylate synthase 8 | 2.70e-05 | 1.93e-03 | NA | NA |
5. P | B2GBR8 | Histidinol-phosphate aminotransferase | 2.89e-10 | 1.52e-08 | NA | NA |
5. P | Q0CPB0 | Kynureninase 1 | 0.00e+00 | 1.64e-10 | NA | NA |
5. P | P71348 | Glutamate-pyruvate aminotransferase AlaA | 6.10e-07 | 1.03e-04 | NA | NA |
5. P | Q9S7N2 | L-tryptophan--pyruvate aminotransferase 1 | 4.61e-04 | 2.66e-16 | NA | NA |
5. P | P99091 | Serine hydroxymethyltransferase | 1.89e-10 | 1.44e-06 | NA | NA |
5. P | A7ZTR3 | Tryptophanase | 4.11e-07 | 2.61e-03 | NA | NA |
5. P | A1AHD0 | L-seryl-tRNA(Sec) selenium transferase | 9.63e-06 | 2.18e-02 | NA | NA |
5. P | Q24QJ1 | Histidinol-phosphate aminotransferase | 4.21e-08 | 1.40e-08 | NA | NA |
5. P | P31011 | Tyrosine phenol-lyase | 2.75e-07 | 1.72e-06 | NA | NA |
5. P | O52815 | (S)-3,5-dihydroxyphenylglycine transaminase | 3.96e-06 | 5.44e-07 | NA | NA |
5. P | P38840 | Aromatic amino acid aminotransferase 2 | 8.66e-06 | 8.86e-05 | NA | NA |
5. P | P08906 | Aspartate aminotransferase, cytoplasmic | 2.00e-06 | 4.78e-04 | NA | NA |
5. P | Q7UZZ3 | LL-diaminopimelate aminotransferase | 2.91e-07 | 2.25e-05 | NA | NA |
5. P | Q8NXY3 | Putative pyridoxal phosphate-dependent acyltransferase | 4.40e-11 | 6.58e-07 | NA | NA |
5. P | Q2S1V4 | Tryptophanase | 5.23e-07 | 1.59e-02 | NA | NA |
5. P | A8GCH0 | Phosphoserine aminotransferase | 5.76e-14 | 1.70e-09 | NA | NA |
5. P | Q9HVI7 | Serine hydroxymethyltransferase 3 | 2.39e-10 | 1.79e-07 | NA | NA |
5. P | Q9FPH3 | Probable low-specificity L-threonine aldolase 2 | 1.32e-14 | 2.87e-11 | NA | NA |
5. P | H3ZPL1 | Aromatic-amino-acid aminotransferase 1 | 2.48e-07 | 9.64e-08 | NA | NA |
5. P | A7H084 | Histidinol-phosphate aminotransferase | 7.57e-10 | 9.30e-09 | NA | NA |
5. P | A5VSV7 | Histidinol-phosphate aminotransferase | 1.26e-13 | 3.45e-08 | NA | NA |
5. P | Q73KM3 | 8-amino-7-oxononanoate synthase | 6.33e-15 | 6.65e-07 | NA | NA |
5. P | Q81ZZ4 | 8-amino-7-oxononanoate synthase | 4.88e-11 | 8.29e-08 | NA | NA |
5. P | Q99K85 | Phosphoserine aminotransferase | 8.73e-14 | 3.54e-11 | NA | NA |
5. P | Q2P354 | Phosphoserine aminotransferase | 3.59e-14 | 2.06e-10 | NA | NA |
5. P | P18079 | 5-aminolevulinate synthase | 2.87e-11 | 1.48e-07 | NA | NA |
5. P | Q983B6 | Serine hydroxymethyltransferase 1 | 3.24e-10 | 1.77e-07 | NA | NA |
5. P | Q8N5Z0 | Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial | 3.29e-07 | 9.64e-06 | NA | NA |
5. P | P56089 | Serine hydroxymethyltransferase | 2.56e-10 | 4.92e-07 | NA | NA |
5. P | P9WQ88 | Uncharacterized aminotransferase MT2290 | 7.69e-09 | 1.66e-07 | NA | NA |
5. P | Q9PJW0 | Serine hydroxymethyltransferase | 2.14e-09 | 4.51e-04 | NA | NA |
5. P | Q9PB19 | Phosphoserine aminotransferase | 1.38e-14 | 2.19e-13 | NA | NA |
5. P | Q885T5 | Phosphoserine aminotransferase | 5.97e-14 | 1.69e-08 | NA | NA |
5. P | A5IKK8 | Probable glycine dehydrogenase (decarboxylating) subunit 1 | 2.18e-07 | 9.93e-07 | NA | NA |
5. P | Q9M1R1 | L-cysteine desulfhydrase | 0.00e+00 | 1.02e-20 | NA | NA |
5. P | O31777 | 8-amino-7-oxononanoate synthase 1 | 1.33e-15 | 4.07e-08 | NA | NA |
5. P | Q6G7J7 | Serine hydroxymethyltransferase | 1.66e-10 | 1.44e-06 | NA | NA |
5. P | A8MBA2 | Serine hydroxymethyltransferase | 6.00e-10 | 3.54e-11 | NA | NA |
5. P | A6V1P2 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 2.06e-13 | 9.89e-03 | NA | NA |
5. P | B2TUR7 | Tryptophanase | 4.39e-07 | 2.97e-03 | NA | NA |
5. P | B1JH26 | L-seryl-tRNA(Sec) selenium transferase | 1.03e-05 | 4.87e-02 | NA | NA |
5. P | A1K6Q1 | 8-amino-7-oxononanoate synthase | 2.31e-11 | 2.55e-07 | NA | NA |
5. P | Q60358 | L-tyrosine/L-aspartate decarboxylase | 2.07e-12 | 1.77e-09 | NA | NA |
5. P | Q64602 | Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial | 2.78e-07 | 1.58e-05 | NA | NA |
5. P | B5RCC2 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase | 8.86e-14 | 7.36e-04 | NA | NA |
5. P | Q0BVW4 | Histidinol-phosphate aminotransferase | 6.87e-14 | 3.49e-08 | NA | NA |
5. P | A3DEB1 | Serine hydroxymethyltransferase | 3.79e-10 | 1.39e-07 | NA | NA |
5. P | A5CVR5 | Histidinol-phosphate aminotransferase | 8.31e-10 | 8.92e-10 | NA | NA |
5. P | Q0SHX9 | Histidinol-phosphate aminotransferase | 6.59e-09 | 3.17e-07 | NA | NA |
5. P | P37833 | Aspartate aminotransferase, cytoplasmic | 9.28e-07 | 1.57e-04 | NA | NA |
5. P | Q02135 | Histidinol-phosphate aminotransferase | 8.21e-08 | 3.26e-10 | NA | NA |
5. P | Q9X0D0 | Histidinol-phosphate aminotransferase | 2.48e-08 | 1.20e-08 | NA | NA |
5. P | A8A359 | Serine hydroxymethyltransferase | 2.85e-10 | 1.69e-08 | NA | NA |
5. P | B8JEW9 | Serine hydroxymethyltransferase | 2.71e-10 | 9.20e-08 | NA | NA |
5. P | B1HSU6 | Phosphoserine aminotransferase | 2.74e-14 | 5.45e-12 | NA | NA |
5. P | P33189 | Uncharacterized aminotransferase YhxA | 9.42e-09 | 3.32e-02 | NA | NA |
5. P | B7JGP1 | Serine hydroxymethyltransferase | 2.33e-10 | 2.76e-08 | NA | NA |
5. P | A5UCE4 | Putative 8-amino-7-oxononanoate synthase | 5.48e-14 | 1.09e-05 | NA | NA |
5. P | Q6CZV5 | Serine hydroxymethyltransferase 2 | 8.18e-10 | 1.41e-07 | NA | NA |
5. P | P17736 | Histidinol-phosphate aminotransferase | 2.12e-09 | 1.17e-09 | NA | NA |
6. F | Q7VI68 | L-seryl-tRNA(Sec) selenium transferase | 5.15e-06 | NA | NA | 0.4545 |
6. F | B5RGJ4 | L-seryl-tRNA(Sec) selenium transferase | 7.19e-06 | NA | NA | 0.4482 |
6. F | B4L340 | Molybdenum cofactor sulfurase | 1.78e-15 | NA | NA | 0.8123 |
6. F | B0Y691 | Molybdenum cofactor sulfurase | 6.77e-15 | NA | NA | 0.8134 |
6. F | P00508 | Aspartate aminotransferase, mitochondrial | 2.71e-05 | NA | NA | 0.5082 |
6. F | B4SWN1 | L-seryl-tRNA(Sec) selenium transferase | 7.41e-06 | NA | NA | 0.4473 |
6. F | Q5PLQ2 | L-seryl-tRNA(Sec) selenium transferase | 8.02e-06 | NA | NA | 0.4358 |
6. F | B6VP39 | Fluorothreonine transaldolase | 3.49e-08 | NA | NA | 0.6307 |
6. F | A1CHL0 | Molybdenum cofactor sulfurase | 8.55e-15 | NA | NA | 0.8282 |
6. F | A1CX75 | Molybdenum cofactor sulfurase | 7.22e-15 | NA | NA | 0.836 |
6. F | B7LTJ8 | L-seryl-tRNA(Sec) selenium transferase | 7.72e-06 | NA | NA | 0.4438 |
6. F | E9L7A5 | Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase | 5.45e-08 | NA | NA | 0.5575 |
6. F | Q16S21 | 3,4-dihydroxyphenylacetaldehyde synthase | 1.34e-08 | NA | NA | 0.6499 |
6. F | Q5REB0 | Aspartate aminotransferase, mitochondrial | 2.60e-05 | NA | NA | 0.4812 |
6. F | Q7MY02 | L-seryl-tRNA(Sec) selenium transferase | 7.08e-06 | NA | NA | 0.4308 |
6. F | A9MVI1 | L-seryl-tRNA(Sec) selenium transferase | 7.79e-06 | NA | NA | 0.4273 |
6. F | A1JT25 | L-seryl-tRNA(Sec) selenium transferase | 6.32e-06 | NA | NA | 0.4252 |
6. F | Q7SE17 | Molybdenum cofactor sulfurase | 1.31e-14 | NA | NA | 0.7981 |
6. F | Q0CLW8 | Molybdenum cofactor sulfurase | 1.33e-15 | NA | NA | 0.8213 |
6. F | B5EX94 | L-seryl-tRNA(Sec) selenium transferase | 8.41e-06 | NA | NA | 0.4362 |
6. F | B4H0S8 | Molybdenum cofactor sulfurase | 2.00e-15 | NA | NA | 0.7905 |
6. F | Q02FL3 | L-seryl-tRNA(Sec) selenium transferase | 5.10e-06 | NA | NA | 0.4587 |
6. F | Q28F67 | Aspartate aminotransferase, mitochondrial | 2.28e-05 | NA | NA | 0.4951 |
6. F | A7FP80 | L-seryl-tRNA(Sec) selenium transferase | 7.87e-06 | NA | NA | 0.4346 |
6. F | P56372 | L-seryl-tRNA(Sec) selenium transferase | 2.29e-06 | NA | NA | 0.4155 |
6. F | Q5R4G0 | Sphingosine-1-phosphate lyase 1 | 1.67e-11 | NA | NA | 0.6327 |
6. F | C0Q1E4 | L-seryl-tRNA(Sec) selenium transferase | 7.30e-06 | NA | NA | 0.4366 |
6. F | Q5F4K8 | Aspartate aminotransferase | 8.85e-08 | NA | NA | 0.5597 |
6. F | A7ZBQ0 | L-seryl-tRNA(Sec) selenium transferase | 5.01e-06 | NA | NA | 0.4331 |
6. F | Q93QX0 | Bifunctional aspartate aminotransferase and L-aspartate beta-decarboxylase | 2.11e-05 | NA | NA | 0.54 |
6. F | A9MLE0 | L-seryl-tRNA(Sec) selenium transferase | 8.04e-06 | NA | NA | 0.4483 |
6. F | B5R5B6 | L-seryl-tRNA(Sec) selenium transferase | 7.42e-06 | NA | NA | 0.4488 |
6. F | Q1K8G0 | Cystathionine beta-lyase | 4.99e-09 | NA | NA | 0.6085 |
6. F | Q2T9S8 | Putative aspartate aminotransferase, cytoplasmic 2 | 3.86e-04 | NA | NA | 0.5032 |
6. F | P00506 | Aspartate aminotransferase, mitochondrial | 2.84e-05 | NA | NA | 0.5073 |
6. F | Q2HE65 | Molybdenum cofactor sulfurase | 5.55e-16 | NA | NA | 0.7986 |
6. F | P12344 | Aspartate aminotransferase, mitochondrial | 3.05e-05 | NA | NA | 0.4975 |
6. F | Q2UH11 | Molybdenum cofactor sulfurase | 6.55e-15 | NA | NA | 0.8241 |
6. F | Q9UV64 | Molybdenum cofactor sulfurase | 5.66e-15 | NA | NA | 0.8003 |
6. F | A4RK48 | Molybdenum cofactor sulfurase | 3.94e-09 | NA | NA | 0.7999 |
6. F | B5BHW8 | L-seryl-tRNA(Sec) selenium transferase | 7.87e-06 | NA | NA | 0.439 |
6. F | B7V1L9 | L-seryl-tRNA(Sec) selenium transferase | 4.82e-06 | NA | NA | 0.4533 |
6. F | Q01856 | Uncharacterized HTH-type transcriptional regulator RHOS4_30730 | 1.45e-05 | NA | NA | 0.5208 |
6. F | B4JXP7 | Molybdenum cofactor sulfurase | 1.11e-15 | NA | NA | 0.8082 |
6. F | Q8Z2D8 | L-seryl-tRNA(Sec) selenium transferase | 8.31e-06 | NA | NA | 0.4472 |
6. F | Q53IZ1 | Bifunctional aspartate aminotransferase and L-aspartate beta-decarboxylase | 1.80e-05 | NA | NA | 0.5217 |
6. F | B4TZT5 | L-seryl-tRNA(Sec) selenium transferase | 4.80e-05 | NA | NA | 0.4289 |
6. F | Q83GV1 | Glycine dehydrogenase (decarboxylating) | 8.10e-05 | NA | NA | 0.6567 |
6. F | Q4WPE6 | Molybdenum cofactor sulfurase | 6.11e-15 | NA | NA | 0.809 |
6. F | P12345 | Aspartate aminotransferase, mitochondrial | 2.88e-05 | NA | NA | 0.5035 |
6. F | Q83IA7 | Glycine dehydrogenase (decarboxylating) | 7.62e-05 | NA | NA | 0.6128 |
6. F | A6SRX6 | Molybdenum cofactor sulfurase | 9.99e-16 | NA | NA | 0.8117 |
6. F | Q16P87 | Molybdenum cofactor sulfurase 2 | 1.33e-15 | NA | NA | 0.8116 |
6. F | Q4R559 | Aspartate aminotransferase, mitochondrial | 2.66e-05 | NA | NA | 0.4878 |
6. F | Q8ZL69 | L-seryl-tRNA(Sec) selenium transferase | 7.26e-06 | NA | NA | 0.4386 |
6. F | W7L9E0 | Aminotransferase FUM8 | 3.82e-04 | NA | NA | 0.4641 |
6. F | Q57IE9 | L-seryl-tRNA(Sec) selenium transferase | 7.74e-06 | NA | NA | 0.4567 |
7. B | O74351 | Probable cysteine desulfurase, mitochondrial | 0.00e+00 | NA | 2.13e-26 | NA |
7. B | B0WSX1 | Molybdenum cofactor sulfurase 2 | 5.55e-16 | NA | 7.51e-09 | NA |
7. B | Q9VRA2 | Molybdenum cofactor sulfurase | 9.99e-16 | NA | 2.31e-07 | NA |
7. B | Q559G8 | Molybdenum cofactor sulfurase | 3.44e-15 | NA | 6.31e-15 | NA |
7. B | Q9C5X8 | Molybdenum cofactor sulfurase | 1.11e-16 | NA | 4.73e-07 | NA |
7. B | Q29GM0 | Molybdenum cofactor sulfurase | 3.89e-15 | NA | 1.45e-05 | NA |
7. B | A2VD33 | Molybdenum cofactor sulfurase | 4.44e-16 | NA | 1.97e-08 | NA |
7. B | Q21657 | Molybdenum cofactor sulfurase | 1.11e-16 | NA | 1.17e-07 | NA |
7. B | Q655R6 | Molybdenum cofactor sulfurase | 2.46e-10 | NA | 7.13e-04 | NA |
7. B | Q4WD47 | Nonribosomal peptide synthetase-like enzyme fsqF | 4.25e-02 | NA | 5.91e-21 | NA |