Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54803.1
JCVISYN3A_0442
Iron-sulfur cluster assembly scaffold protein.
M. mycoides homolog: Q6MTA6.
TIGRfam Classification: 3=Putative.
Category: Essential.
Statistics
Total GO Annotation: 19
Unique PROST Go: 4
Unique BLAST Go: 3
Unique Foldseek Go: 1
Total Homologs: 41
Unique PROST Homologs: 7
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 10
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
O32163
(Zinc-dependent sulfurtransferase SufU) with a FATCAT P-Value: 0 and RMSD of 2.33 angstrom. The sequence alignment identity is 26.6%.
Structural alignment shown in left. Query protein AVX54803.1 colored as red in alignment, homolog O32163 colored as blue.
Query protein AVX54803.1 is also shown in right top, homolog O32163 showed in right bottom. They are colored based on secondary structures.
AVX54803.1 MIDIN-N-DSLLREIIIKHFLNPENKTLTNNKNAIIKELKSQTCADQLIIEILIENKIIKSMKFDGSACAIATSSIDLLINNLLNLDIKKAIELIKNYQI 98 O32163 M-SFNANLDTLYRQVIMDHYKNPRNKGVLN--DSIVVDMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSK---I 94 AVX54803.1 F--LLTGTLINAD--QLNELVVMKNIHKQKNRILCASLALNDLLEILNSYE--- 145 O32163 FSDMMQGKEYD-DSIDLGDIEALQGVSKFPARIKCATLSWKALEKGVAKEEGGN 147
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0051539 | 4 iron, 4 sulfur cluster binding |
| 1. PBF | GO:0016226 | iron-sulfur cluster assembly |
| 1. PBF | GO:0051536 | iron-sulfur cluster binding |
| 1. PBF | GO:0051537 | 2 iron, 2 sulfur cluster binding |
| 1. PBF | GO:0008198 | ferrous iron binding |
| 1. PBF | GO:0006879 | cellular iron ion homeostasis |
| 1. PBF | GO:0005506 | iron ion binding |
| 2. PF | GO:0032047 | mitosome |
| 2. PF | GO:0001671 | ATPase activator activity |
| 2. PF | GO:0005759 | mitochondrial matrix |
| 3. BF | GO:0009399 | nitrogen fixation |
| 5. P | GO:0044572 | [4Fe-4S] cluster assembly |
| 5. P | GO:0042254 | ribosome biogenesis |
| 5. P | GO:0005198 | structural molecule activity |
| 5. P | GO:0044571 | [2Fe-2S] cluster assembly |
| 6. F | GO:0002098 | tRNA wobble uridine modification |
| 7. B | GO:0016740 | transferase activity |
| 7. B | GO:0000162 | tryptophan biosynthetic process |
| 7. B | GO:0004425 | indole-3-glycerol-phosphate synthase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016226 | iron-sulfur cluster assembly |
| GO:0051536 | iron-sulfur cluster binding |
| GO:0005506 | iron ion binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | B0YLW7 | Iron sulfur cluster assembly protein 1 | 1.75e-09 | 8.17e-10 | 0.005 | 0.5629 |
| 1. PBF | O67045 | Iron-sulfur cluster assembly scaffold protein IscU | 7.95e-05 | 9.88e-08 | 0.005 | 0.5608 |
| 1. PBF | O32163 | Zinc-dependent sulfurtransferase SufU | 0.00e+00 | 1.74e-42 | 2.58e-15 | 0.8705 |
| 1. PBF | Q9X192 | Iron-sulfur cluster assembly scaffold protein IscU | 1.11e-16 | 2.17e-36 | 1.83e-07 | 0.8926 |
| 1. PBF | P75297 | Uncharacterized protein MG337 homolog | 6.99e-15 | 3.13e-44 | 0.019 | 0.8109 |
| 1. PBF | Q9A1G2 | Iron-sulfur cluster assembly scaffold protein IscU | 0.00e+00 | 2.88e-29 | 6.66e-05 | 0.9081 |
| 2. PF | P0ACD6 | Iron-sulfur cluster assembly scaffold protein IscU | 2.27e-10 | 1.35e-14 | NA | 0.5921 |
| 2. PF | Q75C07 | Iron sulfur cluster assembly protein 1, mitochondrial | 2.95e-09 | 3.00e-03 | NA | 0.5587 |
| 2. PF | O31270 | Iron-sulfur cluster assembly scaffold protein IscU | 2.63e-10 | 1.71e-14 | NA | 0.5985 |
| 2. PF | Q9ZD61 | Iron-sulfur cluster assembly scaffold protein IscU | 4.12e-10 | 4.29e-13 | NA | 0.581 |
| 2. PF | P0DMG1 | Iron-sulfur cluster assembly scaffold protein IscU 1 | 9.37e-10 | 2.00e-08 | NA | 0.5294 |
| 2. PF | Q8SSM2 | Iron sulfur cluster assembly protein 1 | 9.22e-10 | 1.94e-15 | NA | 0.5856 |
| 2. PF | Q57074 | Iron-sulfur cluster assembly scaffold protein IscU | 1.21e-10 | 5.92e-15 | NA | 0.6189 |
| 2. PF | P0DMG2 | Iron-sulfur cluster assembly scaffold protein IscU 2 | 2.52e-09 | 2.00e-08 | NA | 0.5429 |
| 2. PF | Q89A18 | Iron-sulfur cluster assembly scaffold protein IscU | 2.19e-10 | 1.52e-15 | NA | 0.6007 |
| 2. PF | O51885 | Iron-sulfur cluster assembly scaffold protein IscU | 1.38e-10 | 4.52e-14 | NA | 0.5901 |
| 2. PF | P57658 | Iron-sulfur cluster assembly scaffold protein IscU | 2.12e-10 | 5.79e-17 | NA | 0.5884 |
| 2. PF | P47579 | Uncharacterized protein MG337 | 1.11e-16 | 3.80e-41 | NA | 0.7302 |
| 2. PF | P0ACD5 | Iron-sulfur cluster assembly scaffold protein IscU | 2.46e-10 | 1.35e-14 | NA | 0.593 |
| 2. PF | P0ACD7 | Iron-sulfur cluster assembly scaffold protein IscU | 2.41e-10 | 1.35e-14 | NA | 0.5932 |
| 2. PF | O51112 | Uncharacterized protein BB_0085 | 7.65e-10 | 8.89e-31 | NA | 0.7243 |
| 3. BF | P05343 | Nitrogen fixation protein NifU | 2.28e-06 | NA | 0.002 | 0.5626 |
| 3. BF | P23121 | Nitrogen fixation protein NifU | 4.50e-06 | NA | 0.007 | 0.555 |
| 5. P | Q9MAB6 | Iron-sulfur cluster assembly protein 2 | 1.38e-05 | 1.73e-03 | NA | NA |
| 5. P | O81433 | Iron-sulfur cluster assembly protein 3 | 2.44e-05 | 3.75e-05 | NA | NA |
| 5. P | O49627 | Iron-sulfur cluster assembly protein 1 | 2.21e-05 | 5.73e-03 | NA | NA |
| 5. P | P0ACD4 | Iron-sulfur cluster assembly scaffold protein IscU | 2.41e-10 | 1.35e-14 | NA | NA |
| 5. P | P0A1T3 | Large ribosomal RNA subunit accumulation protein YceD | 3.19e-01 | 4.53e-02 | NA | NA |
| 5. P | P0A1T2 | Large ribosomal RNA subunit accumulation protein YceD | 3.20e-01 | 4.53e-02 | NA | NA |
| 5. P | Q8LR34 | Iron-sulfur cluster assembly protein 1 | 2.44e-05 | 9.44e-03 | NA | NA |
| 6. F | P05340 | Nitrogen fixation protein NifU | 5.75e-06 | NA | NA | 0.5542 |
| 6. F | P20628 | Nitrogen fixation protein NifU | 1.14e-03 | NA | NA | 0.4793 |
| 6. F | Q1AWB1 | Bifunctional protein NifU/MnmA | 3.89e-03 | NA | NA | 0.6707 |
| 6. F | Q6CRQ9 | Iron sulfur cluster assembly protein 1, mitochondrial | 9.15e-09 | NA | NA | 0.6002 |
| 6. F | Q6BGU0 | Iron sulfur cluster assembly protein 1, mitochondrial | 1.15e-08 | NA | NA | 0.5708 |
| 6. F | Q6CFQ0 | Iron sulfur cluster assembly protein 1, mitochondrial | 7.90e-09 | NA | NA | 0.5407 |
| 6. F | Q43885 | Nitrogen fixation protein NifU | 1.73e-06 | NA | NA | 0.4754 |
| 6. F | Q01180 | Nitrogen fixation protein NifU | 8.42e-07 | NA | NA | 0.6116 |
| 6. F | Q43909 | Nitrogen fixation protein NifU | 2.42e-05 | NA | NA | 0.4426 |
| 6. F | Q6FJY3 | Iron sulfur cluster assembly protein 1, mitochondrial | 1.48e-08 | NA | NA | 0.6368 |
| 7. B | B1XSZ1 | Indole-3-glycerol phosphate synthase | 3.57e-01 | NA | 0.027 | NA |