Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54804.1
JCVISYN3A_0443
5-Formyltetrahydrofolate cyclo-ligase.
M. mycoides homolog: Q6MTA5.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 14
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 16
Unique PROST Homologs: 0
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P75430
(5-formyltetrahydrofolate cyclo-ligase) with a FATCAT P-Value: 0 and RMSD of 1.64 angstrom. The sequence alignment identity is 30.0%.
Structural alignment shown in left. Query protein AVX54804.1 colored as red in alignment, homolog P75430 colored as blue.
Query protein AVX54804.1 is also shown in right top, homolog P75430 showed in right bottom. They are colored based on secondary structures.
AVX54804.1 MNKTLLRKQLLEKR-------KNFDLDYKNTSNLIITNKVIDFI--KQHQFKQICIFLSTKYEIETRNIINWC-----LNHHILVFVPKITTNNNMNMVL 86 P75430 MDKNALRKQILQKRMALSTIEKS-HLDQK------INQKLVAFLTPKP-CIKTIALYEPIKNEV-T--FVDFFFEFLKIN-QIRAVYPKVISDT--EIIF 86 AVX54804.1 LDNSYLTNFNKFNIQEPTSNILANLKEIDCVFTPVVGFDNKLN-RIGMGKGFYDKF-FSLNSFSYLKVGLCFDKQKVDQIIIESNDIKLDYIITENQNIY 184 P75430 IDQE--T--NTF---EP--N------QIDCFLIPLVGF-NKDNYRLGFGKGYYDRYLMQL-TRQQPKIGIAYSFQKGD-FLADPWDVQLDLIINDE---- 164 AVX54804.1 KLN 187 P75430 --- 164
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0046653 | tetrahydrofolate metabolic process |
| 1. PBF | GO:0030272 | 5-formyltetrahydrofolate cyclo-ligase activity |
| 1. PBF | GO:0009396 | folic acid-containing compound biosynthetic process |
| 1. PBF | GO:0035999 | tetrahydrofolate interconversion |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0005542 | folic acid binding |
| 4. PB | GO:0005759 | mitochondrial matrix |
| 4. PB | GO:0006536 | glutamate metabolic process |
| 4. PB | GO:0005739 | mitochondrion |
| 4. PB | GO:0046655 | folic acid metabolic process |
| 4. PB | GO:0046657 | folic acid catabolic process |
| 4. PB | GO:0046872 | metal ion binding |
| 4. PB | GO:0022611 | dormancy process |
| 4. PB | GO:0015942 | formate metabolic process |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0030272 | 5-formyltetrahydrofolate cyclo-ligase activity |
| GO:0016874 | ligase activity |
| GO:0005524 | ATP binding |
| GO:0046872 | metal ion binding |
| GO:0000166 | nucleotide binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P54491 | Uncharacterized protein YqgN | 0.00e+00 | 9.58e-54 | 1.99e-04 | 0.8678 |
| 1. PBF | P44905 | 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 3.14e-46 | 2.85e-19 | 0.8637 |
| 1. PBF | A0R3H2 | 5-formyltetrahydrofolate cyclo-ligase | 1.78e-15 | 8.58e-52 | 3.83e-10 | 0.8559 |
| 1. PBF | Q89AD6 | Uncharacterized protein bbp_370 | 1.11e-16 | 5.50e-59 | 1.85e-10 | 0.8528 |
| 1. PBF | P47487 | 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 1.73e-42 | 2.57e-10 | 0.8916 |
| 1. PBF | Q8K9E3 | Uncharacterized protein BUsg_396 | 0.00e+00 | 1.68e-58 | 1.46e-10 | 0.8808 |
| 1. PBF | P0AC29 | 5-formyltetrahydrofolate cyclo-ligase | 1.11e-16 | 1.64e-55 | 5.24e-14 | 0.8497 |
| 1. PBF | P80405 | 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 4.08e-34 | 4.05e-17 | 0.8341 |
| 1. PBF | P75430 | 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 1.15e-44 | 8.08e-10 | 0.878 |
| 4. PB | Q8L539 | 5-formyltetrahydrofolate cyclo-ligase, mitochondrial | 2.62e-14 | 2.94e-09 | 7.93e-04 | NA |
| 4. PB | P40099 | 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 2.01e-39 | 9.82e-11 | NA |
| 4. PB | Q9XWE6 | Probable 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 4.51e-51 | 1.25e-14 | NA |
| 4. PB | Q9P7W2 | Probable 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 1.67e-50 | 1.84e-16 | NA |
| 4. PB | P49914 | 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 2.44e-35 | 1.17e-18 | NA |
| 4. PB | P0AC28 | 5-formyltetrahydrofolate cyclo-ligase | 1.11e-16 | 1.64e-55 | 5.24e-14 | NA |
| 4. PB | Q9D110 | 5-formyltetrahydrofolate cyclo-ligase | 0.00e+00 | 1.27e-40 | 2.82e-19 | NA |