Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54805.1
JCVISYN3A_0444

Uncharacterized peptidase.
M. mycoides homolog: Q6MTA4.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 113
Unique PROST Go: 11
Unique BLAST Go: 10
Unique Foldseek Go: 0

Total Homologs: 95
Unique PROST Homologs: 53
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: Endopeptidase O|conserved HEXXH Zn binding motif; intracellular
Yang and Tsui [2]: Endopeptidase PepO
Antczak et al. [3]: pepO; Neutral endopeptidase pepO
Zhang et al. [4]: GO:0016486|peptide hormone processing
Bianchi et al. [5]: "endopeptidase, pepO-like"

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q02VB0 (Neutral endopeptidase) with a FATCAT P-Value: 0 and RMSD of 1.29 angstrom. The sequence alignment identity is 42.6%.
Structural alignment shown in left. Query protein AVX54805.1 colored as red in alignment, homolog Q02VB0 colored as blue. Query protein AVX54805.1 is also shown in right top, homolog Q02VB0 showed in right bottom. They are colored based on secondary structures. 

  AVX54805.1 MKYQIKDNLFKAVNQDWLEKTEIPNDRSSIGEFVELDIKNELIIKKIAKDL--LKKQANNL-LDDPNLINFAKFYSLTSNFELRNKNHIEPLKKYVNEIL 97
      Q02VB0 MT-RIQDDLFATVNAEWLENAEIPADKPRISAFDELVLKNE---KNLAKDLADL---SQNLPTDNPELLEAIKFYNKAGDWQAREKADFSAVK---NELA 90

  AVX54805.1 EIKNL----DQLNQMYTTFVYRNYS-LPINFDISNDYIDSSIKTLYLTIASHILPDKSHYQNKEVKNKFYKE---FKA-MTKKLLSAYFNDVKKINLIIK 188
      Q02VB0 KVETLNTFEDFKNNL-TQLVFHSQAPLPFSFSVEPDMKDAIHYSLGFSGPGLILPDTTYY-NDEHPRK--KELLDFWAKNTSEILKTF--DVENAEEIAK 184

  AVX54805.1 NTLEFDEII---ANYSLSSLEKVRYNELYKPYKYEDVIKNTKYLDLNNIIKTLINKDVDQIIFTDDHFATNLDQIYNNKNLELIKSWLVVML--VVR-FS 282
      Q02VB0 SALKFDALLVPSAN---TSEEWAKYAELYHPISTDSFVSKVKNLDLKSLIKDLVKTEPDKVIVYEDRFYESFDSLINEENWSLIKAW---MLTKIARGAT 278

  AVX54805.1 KYLDEKTRTTASKYSLFISGQTKVKNKEKHALNLALDYFSTPIGLYYGQKYLGSKAKKDVENMVSHMINIYKQRLKNNTWLTSQTINKALLKLDKLGVHI 382
      Q02VB0 SFFNEDLRILGGAYGRFLSNVQEARSQEKHQLDLTESYFSQVIGLFYGKKYFGEAGKADVKRMVTAMIKVYQARLSKNEWLSQETAEKAIEKLDAITPFI 378

  AVX54805.1 GYPSEIEPFYANLITNSTNLI-DTVFNFNQVINQYLFSEYKKPINKNYWSMAAYQVNAYYHPMYNHIVFPAGILQGSFYSINHSTSQNYGGIGAVIAHEI 481
      Q02VB0 GFPDKLPEIYSRLKTTSGSLYEDAL-KFDEILTARTFEKFSEDVDKTSWHMPAHMVNAYYSPDSNTIVFPAAILQAPFYSLEQSSSQNYGGIGTVIAHEI 477

  AVX54805.1 SHAFDNNGANFDENGNLKMWWTDEDFDKFKQKTQKMIDLFDNKEIEFGKCNGTLTVSENIADAGGISCALQAAKLEKDYNAQEFFINWAKIWKSK-YK-- 578
      Q02VB0 SHAFDNNGAQFDKEGNLNKWWLDEDYEAFEEKQKEMIALFDGVETEAGPANGKLIVSENIADQGGITAALTAAKDEKDVDLKAFFSQWAKIWRMKASKEF 577

  AVX54805.1 QQTALRLLETDPHAPTELRANIQAANLEEFVDAFNINPEDKMYIDPQKRVKIW 631
      Q02VB0 QQ---MLLSMDFHAPAKLRANIPPTNLEEFYDTFDVKETDKMYRAPENRLKIW 627

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0071492 cellular response to UV-A
1. PBF GO:0090399 replicative senescence
1. PBF GO:0061837 neuropeptide processing
1. PBF GO:0071345 cellular response to cytokine stimulus
1. PBF GO:0007611 learning or memory
1. PBF GO:0004222 metalloendopeptidase activity
1. PBF GO:0007507 heart development
1. PBF GO:0050769 positive regulation of neurogenesis
1. PBF GO:0016486 peptide hormone processing
1. PBF GO:0010002 cardioblast differentiation
1. PBF GO:0016485 protein processing
1. PBF GO:0050435 amyloid-beta metabolic process
1. PBF GO:0005903 brush border
1. PBF GO:0005802 trans-Golgi network
1. PBF GO:0046872 metal ion binding
1. PBF GO:0030425 dendrite
1. PBF GO:1900273 positive regulation of long-term synaptic potentiation
1. PBF GO:0000139 Golgi membrane
1. PBF GO:0030658 transport vesicle membrane
1. PBF GO:0030659 cytoplasmic vesicle membrane
1. PBF GO:0045202 synapse
1. PBF GO:0001786 phosphatidylserine binding
1. PBF GO:0030424 axon
1. PBF GO:0004175 endopeptidase activity
1. PBF GO:0006518 peptide metabolic process
1. PBF GO:0008021 synaptic vesicle
1. PBF GO:0044306 neuron projection terminus
1. PBF GO:0008238 exopeptidase activity
1. PBF GO:0042277 peptide binding
1. PBF GO:0001822 kidney development
1. PBF GO:0046449 creatinine metabolic process
1. PBF GO:0019233 sensory perception of pain
1. PBF GO:0150094 amyloid-beta clearance by cellular catabolic process
1. PBF GO:0007420 brain development
1. PBF GO:0071493 cellular response to UV-B
1. PBF GO:1901612 cardiolipin binding
1. PBF GO:0006508 proteolysis
4. PB GO:0060348 bone development
4. PB GO:0001890 placenta development
4. PB GO:0045745 positive regulation of G protein-coupled receptor signaling pathway
4. PB GO:0005886 plasma membrane
4. PB GO:0034959 endothelin maturation
4. PB GO:1901380 negative regulation of potassium ion transmembrane transport
4. PB GO:0070012 oligopeptidase activity
4. PB GO:0010814 substance P catabolic process
4. PB GO:0019637 organophosphate metabolic process
4. PB GO:0043950 positive regulation of cAMP-mediated signaling
4. PB GO:1990418 response to insulin-like growth factor stimulus
4. PB GO:0010613 positive regulation of cardiac muscle hypertrophy
4. PB GO:0008361 regulation of cell size
4. PB GO:0042447 hormone catabolic process
4. PB GO:0071305 cellular response to vitamin D
4. PB GO:0010816 calcitonin catabolic process
4. PB GO:0001921 positive regulation of receptor recycling
4. PB GO:0042552 myelination
4. PB GO:0008168 methyltransferase activity
4. PB GO:0097746 blood vessel diameter maintenance
4. PB GO:0008217 regulation of blood pressure
4. PB GO:0098793 presynapse
4. PB GO:1904383 response to sodium phosphate
4. PB GO:0030141 secretory granule
4. PB GO:0060416 response to growth hormone
4. PB GO:0002003 angiotensin maturation
4. PB GO:0042803 protein homodimerization activity
4. PB GO:0003100 regulation of systemic arterial blood pressure by endothelin
4. PB GO:0033093 Weibel-Palade body
4. PB GO:0071374 cellular response to parathyroid hormone stimulus
4. PB GO:0048471 perinuclear region of cytoplasm
4. PB GO:0046692 sperm competition
4. PB GO:0005737 cytoplasm
4. PB GO:0048741 skeletal muscle fiber development
4. PB GO:0008237 metallopeptidase activity
4. PB GO:0070372 regulation of ERK1 and ERK2 cascade
4. PB GO:0031982 vesicle
4. PB GO:0045121 membrane raft
4. PB GO:0006874 cellular calcium ion homeostasis
4. PB GO:0042733 embryonic digit morphogenesis
4. PB GO:0005769 early endosome
4. PB GO:0031302 intrinsic component of endosome membrane
4. PB GO:0030282 bone mineralization
4. PB GO:0043583 ear development
4. PB GO:0010961 cellular magnesium ion homeostasis
4. PB GO:0043025 neuronal cell body
4. PB GO:0031410 cytoplasmic vesicle
4. PB GO:0060037 pharyngeal system development
4. PB GO:0016020 membrane
4. PB GO:0042476 odontogenesis
4. PB GO:0030324 lung development
4. PB GO:0010815 bradykinin catabolic process
4. PB GO:0097242 amyloid-beta clearance
4. PB GO:0003016 respiratory system process
4. PB GO:0031133 regulation of axon diameter
5. P GO:0004180 carboxypeptidase activity
5. P GO:0005758 mitochondrial intermembrane space
5. P GO:2000737 negative regulation of stem cell differentiation
5. P GO:0008233 peptidase activity
5. P GO:0006627 protein processing involved in protein targeting to mitochondrion
5. P GO:0035556 intracellular signal transduction
5. P GO:0050821 protein stabilization
5. P GO:0005739 mitochondrion
5. P GO:0006879 cellular iron ion homeostasis
5. P GO:0046686 response to cadmium ion
5. P GO:0005759 mitochondrial matrix
7. B GO:0007218 neuropeptide signaling pathway
7. B GO:0050920 regulation of chemotaxis
7. B GO:0008270 zinc ion binding
7. B GO:0016021 integral component of membrane
7. B GO:0005768 endosome
7. B GO:0008355 olfactory learning
7. B GO:0035994 response to muscle stretch
7. B GO:0009897 external side of plasma membrane
7. B GO:0007568 aging
7. B GO:0007267 cell-cell signaling

Uniprot GO Annotations

GO Description
GO:0004222 metalloendopeptidase activity
GO:0008233 peptidase activity
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
GO:0016787 hydrolase activity
GO:0006508 proteolysis

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q8IS64 Endothelin-converting enzyme homolog 0.00e+00 4.41e-25 5.88e-61 0.9129
1. PBF P0C2B4 Neutral endopeptidase 0.00e+00 2.11e-107 9.12e-168 0.9739
1. PBF P42891 Endothelin-converting enzyme 1 0.00e+00 2.22e-19 1.12e-54 0.9134
1. PBF P42359 Putative zinc metalloproteinase in scaA 5'region (Fragment) 0.00e+00 2.18e-37 2.64e-113 0.959
1. PBF F1N476 Endothelin-converting enzyme 2 0.00e+00 3.15e-16 2.10e-51 0.9152
1. PBF B2RQR8 Endothelin-converting enzyme 2 0.00e+00 1.08e-15 6.85e-52 0.908
1. PBF W4VS99 Neprilysin-1 0.00e+00 1.70e-28 6.17e-42 0.9045
1. PBF P0DPE2 EEF1AKMT4-ECE2 readthrough transcript protein 0.00e+00 3.49e-04 4.69e-51 0.9245
1. PBF Q02VB0 Neutral endopeptidase 0.00e+00 2.11e-107 9.12e-168 0.9737
1. PBF P97739 Endothelin-converting enzyme 1 0.00e+00 4.25e-20 9.78e-55 0.9153
1. PBF P08049 Neprilysin 0.00e+00 2.50e-24 8.83e-50 0.9028
1. PBF Q5RE69 Neprilysin 0.00e+00 4.23e-25 1.19e-51 0.9101
1. PBF Q07744 Neutral endopeptidase 0.00e+00 5.89e-108 5.48e-168 0.974
1. PBF O52071 Neutral endopeptidase 0.00e+00 1.08e-76 5.30e-135 0.9659
4. PB P08473 Neprilysin 0.00e+00 2.65e-25 2.69e-51 NA
4. PB O16796 Neprilysin-11 0.00e+00 2.72e-09 9.16e-46 NA
4. PB Q9EQF2 Kell blood group glycoprotein homolog 0.00e+00 1.29e-18 2.66e-20 NA
4. PB P23276 Kell blood group glycoprotein 0.00e+00 2.70e-16 1.62e-19 NA
4. PB O95672 Endothelin-converting enzyme-like 1 0.00e+00 1.13e-13 3.55e-51 NA
4. PB Q9JLI3 Membrane metallo-endopeptidase-like 1 0.00e+00 5.82e-20 5.37e-53 NA
4. PB Q5UQ76 Putative zinc metalloproteinase R519 NA 1.05e-68 7.31e-21 NA
4. PB Q9W436 Neprilysin-1 0.00e+00 1.82e-07 6.39e-53 NA
4. PB Q9JMI0 Endothelin-converting enzyme-like 1 0.00e+00 3.82e-15 5.59e-51 NA
4. PB P42892 Endothelin-converting enzyme 1 0.00e+00 2.03e-14 5.68e-54 NA
4. PB Q18673 Neprilysin-1 0.00e+00 1.41e-25 8.31e-57 NA
4. PB P78562 Phosphate-regulating neutral endopeptidase PHEX 0.00e+00 4.76e-22 7.52e-39 NA
4. PB O44857 Neprilysin-2 0.00e+00 1.64e-22 9.23e-45 NA
4. PB Q9W5Y0 Neprilysin-3 0.00e+00 5.68e-15 2.24e-57 NA
4. PB P70669 Phosphate-regulating neutral endopeptidase PHEX 0.00e+00 8.88e-21 2.96e-35 NA
4. PB P0DPD9 EEF1AKMT4-ECE2 readthrough transcript protein 0.00e+00 2.04e-03 1.80e-51 NA
4. PB P0C1T0 Membrane metallo-endopeptidase-like 1 0.00e+00 3.81e-20 7.02e-49 NA
4. PB P42893 Endothelin-converting enzyme 1 0.00e+00 3.37e-17 4.95e-53 NA
4. PB Q61391 Neprilysin 0.00e+00 1.26e-23 6.38e-53 NA
4. PB P0DPD6 Endothelin-converting enzyme 2 0.00e+00 2.51e-07 1.23e-52 NA
4. PB P0DPD8 EEF1AKMT4-ECE2 readthrough transcript protein 0.00e+00 5.11e-03 1.05e-52 NA
4. PB Q495T6 Membrane metallo-endopeptidase-like 1 0.00e+00 6.62e-18 1.14e-50 NA
4. PB Q4PZA2 Endothelin-converting enzyme 1 0.00e+00 4.51e-15 1.99e-55 NA
4. PB Q9JHL3 Endothelin-converting enzyme-like 1 0.00e+00 6.17e-14 1.20e-52 NA
4. PB A0A0B4K692 Neprilysin-2 0.00e+00 1.81e-24 3.00e-48 NA
4. PB P07861 Neprilysin 0.00e+00 9.53e-24 4.51e-52 NA
4. PB Q22523 Neprilysin-21 0.00e+00 9.76e-21 3.06e-40 NA
5. P P24155 Thimet oligopeptidase 2.33e-02 4.25e-03 NA NA
5. P Q6CHD6 Mitochondrial intermediate peptidase 3.76e-02 8.56e-03 NA NA
5. P P23384 Bacillolysin 5.98e-01 1.74e-03 NA NA
5. P P00800 Thermolysin 6.07e-01 2.87e-02 NA NA
5. P P37932 Mitochondrial intermediate peptidase 4.88e-02 2.82e-02 NA NA
5. P P24171 Dipeptidyl carboxypeptidase 2.21e-02 4.13e-05 NA NA
5. P O31605 Oligoendopeptidase F homolog 2.90e-02 1.75e-02 NA NA
5. P P23224 Zinc metalloproteinase 6.59e-01 3.73e-02 NA NA
5. P P34025 Zinc metalloproteinase 6.50e-01 2.09e-02 NA NA
5. P Q59223 Thermolysin 5.52e-01 1.06e-02 NA NA
5. P P0CH29 Bacillolysin 5.77e-01 3.07e-02 NA NA
5. P Q98QP0 Oligoendopeptidase F homolog 3.38e-02 4.91e-03 NA NA
5. P Q6BJ61 Mitochondrial intermediate peptidase 5.51e-02 9.56e-03 NA NA
5. P P27298 Oligopeptidase A 1.98e-02 1.76e-04 NA NA
5. P Q949P2 Probable cytosolic oligopeptidase A 3.12e-02 4.66e-03 NA NA
5. P A5E4V6 Mitochondrial intermediate peptidase 9.11e-02 1.23e-03 NA NA
5. P P55110 Zinc metalloproteinase MspA 3.69e-01 1.47e-03 NA NA
5. P P68736 Bacillolysin 4.27e-01 4.91e-02 NA NA
5. P P35999 Mitochondrial intermediate peptidase 2.94e-02 3.73e-04 NA NA
5. P A3LUT4 Mitochondrial intermediate peptidase 4.60e-02 3.00e-03 NA NA
5. P P0CQ21 Mitochondrial intermediate peptidase 2 1.18e-01 1.41e-03 NA NA
5. P Q9XZ14 Protein gone early 0.00e+00 2.01e-08 NA NA
5. P P25375 Saccharolysin 2.78e-02 1.08e-02 NA NA
5. P P52888 Thimet oligopeptidase 2.25e-02 7.90e-03 NA NA
5. P Q6CVF7 Mitochondrial intermediate peptidase 3.42e-02 6.52e-03 NA NA
5. P O51264 Oligoendopeptidase F homolog 5.44e-02 3.45e-02 NA NA
5. P P29148 Bacillolysin 3.88e-01 8.67e-04 NA NA
5. P P68735 Bacillolysin 4.30e-01 4.91e-02 NA NA
5. P D5DEH5 Bacillolysin 5.51e-01 4.96e-02 NA NA
5. P P55111 Zinc metalloproteinase 4.04e-01 3.87e-02 NA NA
5. P P42675 Neurolysin, mitochondrial 2.76e-02 3.07e-02 NA NA
5. P P44573 Oligopeptidase A 2.07e-02 5.32e-05 NA NA
5. P F4KDA5 Mitochondrial intermediate peptidase, mitochondrial 3.68e-02 2.27e-03 NA NA
5. P P39899 Neutral protease B 4.85e-01 3.02e-02 NA NA
5. P Q6FW88 Mitochondrial intermediate peptidase 2.01e-02 1.11e-02 NA NA
5. P Q4PBS8 Mitochondrial intermediate peptidase 8.21e-02 2.15e-02 NA NA
5. P Q1JPJ8 Thimet oligopeptidase 8.95e-02 1.93e-02 NA NA
5. P P27236 Dipeptidyl carboxypeptidase 7.25e-02 8.49e-06 NA NA
5. P P0CQ20 Mitochondrial intermediate peptidase 2 7.29e-02 1.41e-03 NA NA
5. P A6ZZI7 Mitochondrial intermediate peptidase 2.12e-02 7.07e-04 NA NA
5. P Q59193 Thermolysin 5.73e-01 1.10e-02 NA NA
5. P P05806 Bacillolysin 6.59e-01 3.95e-02 NA NA
5. P Q8C1A5 Thimet oligopeptidase 2.44e-02 1.62e-02 NA NA
5. P P0CQ18 Mitochondrial intermediate peptidase 1 7.46e-02 2.66e-02 NA NA
5. P P27237 Oligopeptidase A 1.46e-02 1.51e-04 NA NA
5. P Q59RK9 Mitochondrial intermediate peptidase 3.06e-02 9.09e-03 NA NA
5. P Q54DD2 Thimet-like oligopeptidase 2.88e-02 7.00e-03 NA NA
5. P A7TSL2 Mitochondrial intermediate peptidase 3.27e-02 3.38e-04 NA NA
5. P P0CQ19 Mitochondrial intermediate peptidase 1 4.18e-02 3.39e-02 NA NA
5. P Q753X4 Mitochondrial intermediate peptidase 4.36e-02 1.07e-03 NA NA
5. P Q2HFL8 Mitochondrial intermediate peptidase 1.25e-01 2.58e-02 NA NA
5. P Q43880 Thermolysin 5.52e-01 1.82e-02 NA NA
5. P P06874 Thermostable neutral protease NprT 4.38e-01 1.00e-02 NA NA
7. B Q8T062 Neprilysin-4 0.00e+00 NA 7.00e-39 NA